Citrus Sinensis ID: 033400

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MDSSSVQERLNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
ccccHHHHHHHHHHHHHccccccccccccHHHccHHHHcccccccEEEEccEEEEEEEEccccccccccccEEEEEEccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHccccccc
cccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccEEEEEEEEEEEEEccccccccccccccEEEEcccHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHcc
MDSSSVQERLNAVFRHLLqqpceanpvLHKVALSKLQLqkqeaaepmiiGGMVldihatpsipanprtttlgkanyvlGGVARNVAECMSKlgakpymiSALGLDMEIYCWNtgnllayl
MDSSSVQERLNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
MDSSSVQERLNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
**********NAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAY*
********************************************EPMIIGGMVLDIHATPSIP*****TTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
MDSSSVQERLNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
*********LNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSSVQERLNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLLAYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
255556101 1157 pentatricopeptide repeat-containing prot 0.9 0.093 0.605 3e-29
225427804 426 PREDICTED: pseudouridine kinase [Vitis v 0.9 0.253 0.589 3e-26
147799724 224 hypothetical protein VITISV_031685 [Viti 0.858 0.459 0.622 6e-26
357475207 421 Sugar kinase, putative [Medicago truncat 0.675 0.192 0.738 3e-24
224080307 384 predicted protein [Populus trichocarpa] 0.6 0.187 0.710 4e-24
224080299 381 predicted protein [Populus trichocarpa] 0.516 0.162 0.822 1e-23
449493040 1096 PREDICTED: putative pentatricopeptide re 0.9 0.098 0.517 2e-23
449461160 1096 PREDICTED: LOW QUALITY PROTEIN: putative 0.9 0.098 0.517 2e-23
356576339 390 PREDICTED: pseudouridine kinase-like [Gl 0.566 0.174 0.756 8e-22
326531006 434 predicted protein [Hordeum vulgare subsp 0.741 0.205 0.571 8e-20
>gi|255556101|ref|XP_002519085.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541748|gb|EEF43296.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 80/114 (70%), Gaps = 6/114 (5%)

Query: 4   SSVQERLNAVFRHLLQQPCEANPVLHKVALSKLQLQKQEAAEPMIIGGMVLDIHATPSIP 63
           SSVQ RL+ + RHLL  P      L+ V +   +++  E A+P++IGGMVLDIHATPSIP
Sbjct: 3   SSVQRRLDYISRHLLLLPEVDTLALYPVLVKGEEIKHNEEADPVVIGGMVLDIHATPSIP 62

Query: 64  ANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYCWNTGNLL 117
             PRTTT GK  Y LGGVARN+AECMSKLG KPYMISALG DM       GNLL
Sbjct: 63  PYPRTTTPGKVQYALGGVARNIAECMSKLGTKPYMISALGNDM------AGNLL 110

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427804|ref|XP_002275430.1| PREDICTED: pseudouridine kinase [Vitis vinifera] gi|297744710|emb|CBI37972.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147799724|emb|CAN63901.1| hypothetical protein VITISV_031685 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475207|ref|XP_003607889.1| Sugar kinase, putative [Medicago truncatula] gi|85719355|gb|ABC75360.1| Carbohydrate kinase, PfkB [Medicago truncatula] gi|355508944|gb|AES90086.1| Sugar kinase, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|224080307|ref|XP_002306090.1| predicted protein [Populus trichocarpa] gi|222849054|gb|EEE86601.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224080299|ref|XP_002306088.1| predicted protein [Populus trichocarpa] gi|222849052|gb|EEE86599.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449493040|ref|XP_004159175.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g18840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449461160|ref|XP_004148310.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g18840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356576339|ref|XP_003556290.1| PREDICTED: pseudouridine kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|326531006|dbj|BAK04854.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
TAIR|locus:2010187 378 AT1G49350 [Arabidopsis thalian 0.508 0.161 0.540 3.1e-12
UNIPROTKB|F1P1N5 677 Gga.26687 "Uncharacterized pro 0.625 0.110 0.356 4.6e-06
ZFIN|ZDB-GENE-060421-6632 700 zgc:136858 "zgc:136858" [Danio 0.8 0.137 0.32 5.6e-05
TIGR_CMR|CHY_0076 364 CHY_0076 "kinase, PfkB family" 0.508 0.167 0.360 6e-05
TAIR|locus:2019165467 AT1G74470 [Arabidopsis thalian 0.508 0.130 0.354 0.00064
UNIPROTKB|P30235 313 psuK [Escherichia coli K-12 (t 0.491 0.188 0.338 0.00095
TAIR|locus:2010187 AT1G49350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 170 (64.9 bits), Expect = 3.1e-12, P = 3.1e-12
 Identities = 33/61 (54%), Positives = 42/61 (68%)

Query:    45 EPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGL 104
             EP+IIG ++LD+HA PS      TT  G+  +  GGVARNVA+C+ KLG  P+MI  LGL
Sbjct:     2 EPVIIGALILDVHAKPSTTPISGTTVPGQVLFAPGGVARNVADCIFKLGITPFMIGTLGL 61

Query:   105 D 105
             D
Sbjct:    62 D 62
GO:0004747 "ribokinase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006014 "D-ribose metabolic process" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
UNIPROTKB|F1P1N5 Gga.26687 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060421-6632 zgc:136858 "zgc:136858" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0076 CHY_0076 "kinase, PfkB family" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TAIR|locus:2019165 AT1G74470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P30235 psuK [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
cd01941 288 cd01941, YeiC_kinase_like, YeiC-like sugar kinase 3e-14
COG0524 311 COG0524, RbsK, Sugar kinases, ribokinase family [C 1e-04
PRK09850 313 PRK09850, PRK09850, pseudouridine kinase; Provisio 6e-04
cd00287 196 cd00287, ribokinase_pfkB_like, ribokinase/pfkB sup 0.001
pfam00294 298 pfam00294, PfkB, pfkB family carbohydrate kinase 0.004
>gnl|CDD|238916 cd01941, YeiC_kinase_like, YeiC-like sugar kinase Back     alignment and domain information 
 Score = 66.2 bits (162), Expect = 3e-14
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 45  EPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGL 104
           E ++IG   +D+    S    P T+  G      GGV RN+AE +++LG    ++SA+G 
Sbjct: 1   EIVVIGAANIDLRGKVSGSLVPGTSNPGHVKQSPGGVGRNIAENLARLGVSVALLSAVGD 60

Query: 105 D 105
           D
Sbjct: 61  D 61

Found in eukaryotes and bacteria, YeiC-like kinase is part of the ribokinase/pfkB sugar kinase superfamily. Its oligomerization state is unknown at this time. Length = 288
>gnl|CDD|223598 COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|182111 PRK09850, PRK09850, pseudouridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238177 cd00287, ribokinase_pfkB_like, ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>gnl|CDD|215842 pfam00294, PfkB, pfkB family carbohydrate kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
PRK09850 313 pseudouridine kinase; Provisional 99.54
PTZ00292 326 ribokinase; Provisional 99.53
PRK09954 362 putative kinase; Provisional 99.49
PRK11142 306 ribokinase; Provisional 99.48
cd01939 290 Ketohexokinase Ketohexokinase (fructokinase, KHK) 99.45
cd01947 265 Guanosine_kinase_like Guanosine kinase-like sugar 99.45
cd01174 292 ribokinase Ribokinase catalyses the phosphorylatio 99.44
cd01168 312 adenosine_kinase Adenosine kinase (AK) catalyzes t 99.43
cd01944 289 YegV_kinase_like YegV-like sugar kinase. Found onl 99.42
cd01942 279 ribokinase_group_A Ribokinase-like subgroup A. Fou 99.42
KOG2855 330 consensus Ribokinase [Carbohydrate transport and m 99.41
cd01945 284 ribokinase_group_B Ribokinase-like subgroup B. Fou 99.4
PLN02813 426 pfkB-type carbohydrate kinase family protein 99.4
cd01941 288 YeiC_kinase_like YeiC-like sugar kinase. Found in 99.38
PTZ00247 345 adenosine kinase; Provisional 99.36
PLN02323 330 probable fructokinase 99.32
PF00294 301 PfkB: pfkB family carbohydrate kinase; InterPro: I 99.3
COG0524 311 RbsK Sugar kinases, ribokinase family [Carbohydrat 99.29
PLN02341 470 pfkB-type carbohydrate kinase family protein 99.28
cd01166 294 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho 99.24
TIGR02198 315 rfaE_dom_I rfaE bifunctional protein, domain I. Rf 99.24
PLN02967 581 kinase 99.22
cd01167 295 bac_FRK Fructokinases (FRKs) mainly from bacteria 99.22
cd01172 304 RfaE_like RfaE encodes a bifunctional ADP-heptose 99.19
PRK11316 473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.18
PLN02543 496 pfkB-type carbohydrate kinase family protein 99.16
TIGR02152 293 D_ribokin_bact ribokinase. This model describes ri 99.16
cd01164 289 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 99.15
cd01937 254 ribokinase_group_D Ribokinase-like subgroup D. Fou 99.15
PRK09813 260 fructoselysine 6-kinase; Provisional 99.12
TIGR03828 304 pfkB 1-phosphofructokinase. This enzyme acts in co 99.1
cd01940 264 Fructoselysine_kinase_like Fructoselysine kinase-l 99.08
PRK09434 304 aminoimidazole riboside kinase; Provisional 99.07
PLN02630 335 pfkB-type carbohydrate kinase family protein 99.07
cd00287 196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 98.99
PRK09513 312 fruK 1-phosphofructokinase; Provisional 98.91
TIGR03168 303 1-PFK hexose kinase, 1-phosphofructokinase family. 98.89
cd01946 277 ribokinase_group_C Ribokinase-like subgroup C. Fou 98.87
KOG3009 614 consensus Predicted carbohydrate kinase, contains 98.86
TIGR01231 309 lacC tagatose-6-phosphate kinase. This enzyme is p 98.83
PRK13508 309 tagatose-6-phosphate kinase; Provisional 98.83
PLN02379 367 pfkB-type carbohydrate kinase family protein 98.8
PRK15074 434 inosine/guanosine kinase; Provisional 98.74
COG2870 467 RfaE ADP-heptose synthase, bifunctional sugar kina 98.71
PRK10294 309 6-phosphofructokinase 2; Provisional 98.7
cd01943 328 MAK32 MAK32 kinase. MAK32 is a protein found prima 98.58
PLN02548 332 adenosine kinase 98.33
KOG2947 308 consensus Carbohydrate kinase [Carbohydrate transp 97.91
COG1105 310 FruK Fructose-1-phosphate kinase and related fruct 96.7
KOG2854 343 consensus Possible pfkB family carbohydrate kinase 96.42
>PRK09850 pseudouridine kinase; Provisional Back     alignment and domain information 
Probab=99.54  E-value=1.9e-14  Score=114.16  Aligned_cols=77  Identities=29%  Similarity=0.418  Sum_probs=67.6

Q ss_pred             CCCCcEEEEccccceeeeecCCCCCCCCceeceeeEecCChHHHHHHHHHHcCCCcEEEEeecCChhcc----cHHhcCc
Q 033400           41 QEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIY----CWNTGNL  116 (120)
Q Consensus        41 ~~~~~VlvvGs~~iDii~~v~~~p~~g~~~~~~~~~~~GG~aaNvAvalaRLG~~v~lvs~VGdD~~G~----~~~~~~~  116 (120)
                      +|++.|+|+|++++|++++++.++..+++++......+||+++|+|++++|||.++.++|+||+|.+|+    .|++.||
T Consensus         2 ~~~~~i~~iG~~~vD~~~~~~~~~~~~~~~~~~~~~~~GG~~~NvA~~l~~lG~~~~~ig~vG~D~~g~~i~~~l~~~gV   81 (313)
T PRK09850          2 REKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLLSAVGSDFYGQSLLTQTNQSGV   81 (313)
T ss_pred             CCCCcEEEECcEEEeeeccCCCcCcCCCCCceEEEEeCCcHHHHHHHHHHHcCCCeEEEEEecCchhHHHHHHHHHHcCC
Confidence            467899999999999999987766667777778889999999999999999999999999999999997    4455677


Q ss_pred             c
Q 033400          117 L  117 (120)
Q Consensus       117 ~  117 (120)
                      +
T Consensus        82 d   82 (313)
T PRK09850         82 Y   82 (313)
T ss_pred             C
Confidence            5

>PTZ00292 ribokinase; Provisional Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PRK11142 ribokinase; Provisional Back     alignment and domain information
>cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose Back     alignment and domain information
>cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases Back     alignment and domain information
>cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>cd01944 YegV_kinase_like YegV-like sugar kinase Back     alignment and domain information
>cd01942 ribokinase_group_A Ribokinase-like subgroup A Back     alignment and domain information
>KOG2855 consensus Ribokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01945 ribokinase_group_B Ribokinase-like subgroup B Back     alignment and domain information
>PLN02813 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd01941 YeiC_kinase_like YeiC-like sugar kinase Back     alignment and domain information
>PTZ00247 adenosine kinase; Provisional Back     alignment and domain information
>PLN02323 probable fructokinase Back     alignment and domain information
>PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases Back     alignment and domain information
>COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I Back     alignment and domain information
>PLN02967 kinase Back     alignment and domain information
>cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>PLN02543 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>TIGR02152 D_ribokin_bact ribokinase Back     alignment and domain information
>cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>cd01937 ribokinase_group_D Ribokinase-like subgroup D Back     alignment and domain information
>PRK09813 fructoselysine 6-kinase; Provisional Back     alignment and domain information
>TIGR03828 pfkB 1-phosphofructokinase Back     alignment and domain information
>cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like Back     alignment and domain information
>PRK09434 aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>PLN02630 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>PRK09513 fruK 1-phosphofructokinase; Provisional Back     alignment and domain information
>TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>cd01946 ribokinase_group_C Ribokinase-like subgroup C Back     alignment and domain information
>KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only] Back     alignment and domain information
>TIGR01231 lacC tagatose-6-phosphate kinase Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>PLN02379 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PRK15074 inosine/guanosine kinase; Provisional Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10294 6-phosphofructokinase 2; Provisional Back     alignment and domain information
>cd01943 MAK32 MAK32 kinase Back     alignment and domain information
>PLN02548 adenosine kinase Back     alignment and domain information
>KOG2947 consensus Carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
3kzh_A 328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 4e-11
2nwh_A 317 AGR_C_3442P, carbohydrate kinase; structural genom 1e-08
3bf5_A 306 Ribokinase related protein; 10640157, putative rib 2e-06
1vk4_A 298 PFKB carbohydrate kinase TM0415; structural genomi 2e-05
3kd6_A 313 Carbohydrate kinase, PFKB family; nucleoside kinas 1e-04
2c4e_A 302 Sugar kinase MJ0406; transferase, nucleoside kinas 4e-04
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Length = 328 Back     alignment and structure
 Score = 57.2 bits (139), Expect = 4e-11
 Identities = 19/59 (32%), Positives = 28/59 (47%)

Query: 48  IIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDM 106
           + G  V+D+         P  +T G      GGV RN+AE M+++G     +S LG D 
Sbjct: 11  VFGASVVDVFGFSKASYRPYNSTPGHVKISFGGVCRNIAENMARVGVNTNFMSILGNDE 69
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Length = 317 Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Length = 306 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Length = 298 Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Length = 313 Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Length = 302 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
3kzh_A 328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 99.56
1rkd_A 309 Ribokinase; carbohydrate kinase, ribose, nucleotid 99.54
2fv7_A 331 Ribokinase; structural genomics, structural genomi 99.53
2hlz_A 312 Ketohexokinase; non-protein kinase, creatine kinas 99.52
2c4e_A 302 Sugar kinase MJ0406; transferase, nucleoside kinas 99.51
3ikh_A 299 Carbohydrate kinase; transferase,kinase,SAD,ribose 99.51
3go6_A 310 Ribokinase RBSK; phosphofructokinase, carbohydrate 99.51
2nwh_A 317 AGR_C_3442P, carbohydrate kinase; structural genom 99.5
3ry7_A 304 Ribokinase; transferase; 2.15A {Staphylococcus aur 99.5
1vm7_A 311 Ribokinase; TM0960, structural genomics, JCSG, pro 99.5
2rbc_A 343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 99.47
3bf5_A 306 Ribokinase related protein; 10640157, putative rib 99.45
3ljs_A 338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 99.42
3hj6_A 327 Fructokinase, FRK; fructose, transferase, carbohyd 99.41
3vas_A 370 Putative adenosine kinase; ribokinase, enzyme, tra 99.39
2ajr_A 331 Sugar kinase, PFKB family; TM0828, possible 1-phos 99.39
3pl2_A 319 Sugar kinase, ribokinase family; PFKB PFAM motif, 99.37
3h49_A 325 Ribokinase; transferase,PFKB family,sugar kinase Y 99.36
2qcv_A 332 Putative 5-dehydro-2-deoxygluconokinase; structura 99.36
2pkf_A 334 Adenosine kinase; transferase, S genomics, TB stru 99.35
4du5_A 336 PFKB; structural genomics, PSI-biology, NEW YORK s 99.35
4gm6_A 351 PFKB family carbohydrate kinase; enzyme function i 99.33
3ktn_A 346 Carbohydrate kinase, PFKB family; PFKB family,ribo 99.33
3b1n_A 326 Ribokinase, putative; rossmann fold, ATP binding, 99.33
2v78_A 313 Fructokinase; transferase, PFKB family carbohydrat 99.33
4e3a_A 352 Sugar kinase protein; structural genomics, protein 99.32
2abs_A 383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 99.32
1bx4_A 345 Protein (adenosine kinase); human adenosine kinase 99.32
2dcn_A 311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 99.32
3ewm_A 313 Uncharacterized sugar kinase PH1459; carbohydrate 99.32
2f02_A 323 Tagatose-6-phosphate kinase; LACC, structural geno 99.32
1v1a_A 309 2-keto-3-deoxygluconate kinase; ATP, structural ge 99.29
3iq0_A 330 Putative ribokinase II; transferase,kinase,SAD,rib 99.29
3otx_A 347 Adenosine kinase, putative; AP5A, transferase-tran 99.29
3cqd_A 309 6-phosphofructokinase isozyme 2; phosphofructokina 99.29
3umo_A 309 6-phosphofructokinase isozyme 2; glycolysis, trans 99.29
4e84_A 352 D-beta-D-heptose 7-phosphate kinase; LPS-heptose b 99.28
1tyy_A 339 Putative sugar kinase; ribokinase fold, alpha/beta 99.26
2jg1_A 330 Tagatose-6-phosphate kinase; phosphoryl transfer, 99.26
4e69_A 328 2-dehydro-3-deoxygluconokinase; putative sugar kin 99.26
3ie7_A 320 LIN2199 protein; phosphofructokinases, transferase 99.26
3lhx_A 319 Ketodeoxygluconokinase; structural genomics, PSI-2 99.23
3kd6_A 313 Carbohydrate kinase, PFKB family; nucleoside kinas 99.22
3loo_A 365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 99.21
2jg5_A 306 Fructose 1-phosphate kinase; 1-phosphofructokinase 99.18
2qhp_A 296 Fructokinase; NP_810670.1, PFKB family carbohydrat 99.17
2abq_A 306 Fructose 1-phosphate kinase; dimer, structural gen 99.15
3uq6_A 372 Adenosine kinase, putative; ribokinase, transferas 99.11
2afb_A 351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 98.97
1vk4_A 298 PFKB carbohydrate kinase TM0415; structural genomi 98.6
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Back     alignment and structure
Probab=99.56  E-value=5.8e-15  Score=115.88  Aligned_cols=77  Identities=25%  Similarity=0.371  Sum_probs=69.7

Q ss_pred             CCCCcEEEEccccceeeeecCCCCCCCCceeceeeEecCChHHHHHHHHHHcCCCcEEEEeecCChhcc----cHHhcCc
Q 033400           41 QEAAEPMIIGGMVLDIHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIY----CWNTGNL  116 (120)
Q Consensus        41 ~~~~~VlvvGs~~iDii~~v~~~p~~g~~~~~~~~~~~GG~aaNvAvalaRLG~~v~lvs~VGdD~~G~----~~~~~~~  116 (120)
                      +++++|+|+|++++|++.+++.+|.++++....+...+||+++|+|++++|||.++.++|.||+|.+|+    .|++.||
T Consensus         4 ~~~~~v~viG~~~vD~~~~~~~~~~~g~~~~~~~~~~~GG~~~NvA~~la~LG~~v~~i~~vG~D~~g~~i~~~L~~~gv   83 (328)
T 3kzh_A            4 RKEPYLLVFGASVVDVFGFSKASYRPYNSTPGHVKISFGGVCRNIAENMARVGVNTNFMSILGNDEHGKSIVEHSKKIGY   83 (328)
T ss_dssp             CCCCCEEEECCCEEEEEEEESSCCCTTSEEEEEEEEEEECHHHHHHHHHHHTTCCEEEECEECSSHHHHHHHHHHHHHTE
T ss_pred             CCCCcEEEECcEEeeeeeccCCCCCCCCCceEEEEEccCcHHHHHHHHHHHcCCCcEEEEEecCcHHHHHHHHHHHHcCC
Confidence            457899999999999999999988888887778999999999999999999999999999999999997    4556676


Q ss_pred             c
Q 033400          117 L  117 (120)
Q Consensus       117 ~  117 (120)
                      +
T Consensus        84 ~   84 (328)
T 3kzh_A           84 H   84 (328)
T ss_dssp             E
T ss_pred             C
Confidence            5
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Back     alignment and structure
>3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Back     alignment and structure
>4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Back     alignment and structure
>3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* Back     alignment and structure
>4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Back     alignment and structure
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Back     alignment and structure
>3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1rkda_ 306 c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 2e-07
d2fv7a1 308 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapien 3e-07
d1vk4a_ 288 c.72.1.1 (A:) Hypothetical protein TM0415 {Thermot 1e-05
d2dcna1 308 c.72.1.1 (A:2-309) Hypothetical fructokinase ST247 3e-05
d2afba1 333 c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase 3e-05
d1v19a_ 302 c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Ther 3e-05
d1tyya_ 304 c.72.1.1 (A:) Aminoimidazole riboside kinase {Salm 7e-05
d1vm7a_ 299 c.72.1.1 (A:) Ribokinase {Thermotoga maritima [Tax 4e-04
d2abqa1 306 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase Fru 5e-04
d2ajra1 319 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {T 5e-04
d2f02a1 313 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase Lac 5e-04
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Length = 306 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: Ribokinase
species: Escherichia coli [TaxId: 562]

 Score = 45.9 bits (107), Expect = 2e-07
 Identities = 16/65 (24%), Positives = 21/65 (32%), Gaps = 1/65 (1%)

Query: 48  IIGGMVLD-IHATPSIPANPRTTTLGKANYVLGGVARNVAECMSKLGAKPYMISALGLDM 106
           ++G +  D I    S P    T T        GG   N A    + GA    I+  G D 
Sbjct: 6   VLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDS 65

Query: 107 EIYCW 111
                
Sbjct: 66  IGESV 70
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Length = 288 Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Length = 308 Back     information, alignment and structure
>d2afba1 c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]} Length = 333 Back     information, alignment and structure
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Length = 304 Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Length = 299 Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Length = 306 Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Length = 319 Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d2fv7a1 308 Ribokinase {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1rkda_ 306 Ribokinase {Escherichia coli [TaxId: 562]} 99.57
d1vm7a_ 299 Ribokinase {Thermotoga maritima [TaxId: 2336]} 99.56
d2afba1 333 2-keto-3-deoxygluconate kinase {Thermotoga maritim 99.37
d1v19a_ 302 2-keto-3-deoxygluconate kinase {Thermus thermophil 99.33
d2dcna1 308 Hypothetical fructokinase ST2478 {Sulfolobus tokod 99.33
d2absa1 350 Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} 99.32
d1tyya_ 304 Aminoimidazole riboside kinase {Salmonella typhimu 99.27
d1bx4a_ 342 Adenosine kinase {Human (Homo sapiens) [TaxId: 960 99.16
d2abqa1 306 Fructose 1-phosphate kinase FruB {Bacillus halodur 99.08
d2f02a1 313 Tagatose-6-phosphate kinase LacC {Enterococcus fae 98.94
d1vk4a_ 288 Hypothetical protein TM0415 {Thermotoga maritima [ 98.93
d2ajra1 319 Putative sugar kinase TM0828 {Thermotoga maritima 98.78
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: Ribokinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.58  E-value=1.5e-15  Score=112.53  Aligned_cols=74  Identities=22%  Similarity=0.227  Sum_probs=66.1

Q ss_pred             CcEEEEccccceeeeecCCCCCCCCceec-eeeEecCChHHHHHHHHHHcCCCcEEEEeecCChhccc----HHhcCcc
Q 033400           44 AEPMIIGGMVLDIHATPSIPANPRTTTLG-KANYVLGGVARNVAECMSKLGAKPYMISALGLDMEIYC----WNTGNLL  117 (120)
Q Consensus        44 ~~VlvvGs~~iDii~~v~~~p~~g~~~~~-~~~~~~GG~aaNvAvalaRLG~~v~lvs~VGdD~~G~~----~~~~~~~  117 (120)
                      +.|+|||++++|+++++++.|.+|++... ++...+||+++|+|++|++||.+|.|+|.||+|.+|+.    +++.|+.
T Consensus         2 ~~i~viG~~~iD~~~~~~~~p~~g~~~~~~~~~~~~GG~~~Nva~~l~~lg~~v~~is~vG~D~~g~~i~~~L~~~gi~   80 (308)
T d2fv7a1           2 AAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDIS   80 (308)
T ss_dssp             CSEEEECCCEEEEEEECSSCCCTTCCCCCSEEEEEEECHHHHHHHHHHHTTCCEEEEEEEESSHHHHHHHHHHHTTTEE
T ss_pred             CEEEEEChhheEeEeecCCCCCCCceEeeceEEEecCCHHHHHHHHHHHCCCCEEEEEEeccccccccccchhcccccc
Confidence            47999999999999999999999887665 78999999999999999999999999999999999984    4555554
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure