Citrus Sinensis ID: 033564
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 116 | ||||||
| 388510406 | 225 | unknown [Lotus japonicus] | 0.75 | 0.386 | 0.965 | 3e-41 | |
| 359806262 | 222 | uncharacterized protein LOC100806792 [Gl | 0.75 | 0.391 | 0.942 | 1e-40 | |
| 388521435 | 225 | unknown [Lotus japonicus] | 0.75 | 0.386 | 0.954 | 1e-40 | |
| 224098455 | 218 | predicted protein [Populus trichocarpa] | 0.75 | 0.399 | 0.954 | 4e-40 | |
| 255645177 | 222 | unknown [Glycine max] | 0.75 | 0.391 | 0.931 | 4e-40 | |
| 351722845 | 224 | uncharacterized protein LOC100500352 [Gl | 0.75 | 0.388 | 0.931 | 1e-39 | |
| 147774410 | 221 | hypothetical protein VITISV_013914 [Viti | 0.75 | 0.393 | 0.942 | 2e-39 | |
| 224112717 | 219 | predicted protein [Populus trichocarpa] | 0.75 | 0.397 | 0.942 | 2e-39 | |
| 225449424 | 221 | PREDICTED: thylakoid lumenal 15 kDa prot | 0.75 | 0.393 | 0.942 | 2e-39 | |
| 449441422 | 214 | PREDICTED: thylakoid lumenal 15 kDa prot | 0.75 | 0.406 | 0.919 | 2e-38 |
| >gi|388510406|gb|AFK43269.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Score = 172 bits (435), Expect = 3e-41, Method: Compositional matrix adjust.
Identities = 84/87 (96%), Positives = 87/87 (100%)
Query: 30 LSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDD 89
L+GADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSF+GSNITGADFTDVPLRDD
Sbjct: 139 LTGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFKGSNITGADFTDVPLRDD 198
Query: 90 QREYLCKVADGVNPTTGNATRDTLLCN 116
QREYLCKVADGVNPTTGNATR+TLLCN
Sbjct: 199 QREYLCKVADGVNPTTGNATRETLLCN 225
|
Source: Lotus japonicus Species: Lotus japonicus Genus: Lotus Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359806262|ref|NP_001240959.1| uncharacterized protein LOC100806792 [Glycine max] gi|255626639|gb|ACU13664.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388521435|gb|AFK48779.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224098455|ref|XP_002311180.1| predicted protein [Populus trichocarpa] gi|222851000|gb|EEE88547.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255645177|gb|ACU23086.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351722845|ref|NP_001236746.1| uncharacterized protein LOC100500352 [Glycine max] gi|255630103|gb|ACU15405.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147774410|emb|CAN74472.1| hypothetical protein VITISV_013914 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224112717|ref|XP_002316270.1| predicted protein [Populus trichocarpa] gi|222865310|gb|EEF02441.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225449424|ref|XP_002282933.1| PREDICTED: thylakoid lumenal 15 kDa protein 1, chloroplastic [Vitis vinifera] gi|296086195|emb|CBI31636.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449441422|ref|XP_004138481.1| PREDICTED: thylakoid lumenal 15 kDa protein 1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 116 | ||||||
| TAIR|locus:2055023 | 224 | AT2G44920 "AT2G44920" [Arabido | 0.586 | 0.303 | 0.897 | 7.1e-29 | |
| TAIR|locus:2202033 | 280 | AT1G12250 "AT1G12250" [Arabido | 0.560 | 0.232 | 0.424 | 6.4e-07 |
| TAIR|locus:2055023 AT2G44920 "AT2G44920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
Identities = 61/68 (89%), Positives = 63/68 (92%)
Query: 49 NVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNA 108
NVTK NL+NANLEGA TGNTSF+GSNITGADFTDVPLRDDQR YLCKVADGVN TTGNA
Sbjct: 157 NVTKVNLTNANLEGATVTGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNA 216
Query: 109 TRDTLLCN 116
TRDTLLCN
Sbjct: 217 TRDTLLCN 224
|
|
| TAIR|locus:2202033 AT1G12250 "AT1G12250" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00080525 | hypothetical protein (218 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XII.166.1 | • | • | 0.563 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 116 | |||
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 7e-08 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 4e-07 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 7e-07 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 8e-07 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 9e-07 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 2e-06 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 4e-06 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 6e-06 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 2e-05 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 2e-05 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 8e-05 | |
| PRK15197 | 291 | PRK15197, PRK15197, secreted effector protein PipB | 9e-05 | |
| PRK15197 | 291 | PRK15197, PRK15197, secreted effector protein PipB | 1e-04 | |
| pfam13599 | 77 | pfam13599, Pentapeptide_4, Pentapeptide repeats (9 | 6e-04 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 7e-04 | |
| PRK15197 | 291 | PRK15197, PRK15197, secreted effector protein PipB | 7e-04 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 0.002 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 0.003 |
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
Score = 44.7 bits (107), Expect = 7e-08
Identities = 23/34 (67%), Positives = 26/34 (76%)
Query: 30 LSGADLSDADLRSADFSLANVTKANLSNANLEGA 63
LSGA+L ADLR AD S A++T ANLS ANL GA
Sbjct: 3 LSGANLRGADLRGADLSGADLTGANLSGANLSGA 36
|
These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A(D/N)LXX, where X can be any amino acid. Length = 40 |
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 116 | |||
| PRK15197 | 291 | secreted effector protein PipB; Provisional | 99.56 | |
| KOG1665 | 302 | consensus AFH1-interacting protein FIP2, contains | 99.37 | |
| PF13599 | 78 | Pentapeptide_4: Pentapeptide repeats (9 copies); P | 99.31 | |
| PF13599 | 78 | Pentapeptide_4: Pentapeptide repeats (9 copies); P | 99.3 | |
| PRK09718 | 512 | hypothetical protein; Validated | 99.23 | |
| KOG1665 | 302 | consensus AFH1-interacting protein FIP2, contains | 99.21 |
| >PRK15197 secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
Probab=99.56 E-value=1.9e-15 Score=113.59 Aligned_cols=17 Identities=24% Similarity=0.255 Sum_probs=10.5
Q ss_pred hccCCCCcccccccccc
Q 033564 97 VADGVNPTTGNATRDTL 113 (116)
Q Consensus 97 ~~~g~~~~~~~~~~~~l 113 (116)
.+.|+++.++++|+..|
T Consensus 261 ~L~gad~~ga~~tp~~~ 277 (291)
T PRK15197 261 ALTGADLTGSQHTPTPL 277 (291)
T ss_pred CCCCCcccCCccCCCCC
Confidence 45566777776665543
|
|
| >KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A | Back alignment and domain information |
|---|
| >PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A | Back alignment and domain information |
|---|
| >PRK09718 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 116 | ||||
| 3n90_A | 152 | The 1.7 Angstrom Resolution Crystal Structure Of At | 2e-29 | ||
| 2f3l_A | 184 | Crystal Structure Of A Lumenal Rfr-Domain Protein ( | 2e-06 | ||
| 2g0y_A | 184 | Crystal Structure Of A Lumenal Pentapeptide Repeat | 2e-06 |
| >pdb|3N90|A Chain A, The 1.7 Angstrom Resolution Crystal Structure Of At2g44920, A Pentapeptide Repeat Protein From Arabidopsis Thaliana Thylakoid Lumen Length = 152 | Back alignment and structure |
|
| >pdb|2F3L|A Chain A, Crystal Structure Of A Lumenal Rfr-Domain Protein (Contig83.1_1_243_746) From Cyanothece Sp. 51142 At 2.1 Angstrom Resolution Length = 184 | Back alignment and structure |
| >pdb|2G0Y|A Chain A, Crystal Structure Of A Lumenal Pentapeptide Repeat Protein From Cyanothece Sp 51142 At 2.3 Angstrom Resolution. Tetragonal Crystal Form Length = 184 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 116 | |||
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 2e-32 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 6e-26 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 4e-08 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 3e-07 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 9e-13 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 3e-11 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 6e-11 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 3e-09 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 5e-06 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 4e-05 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 9e-05 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 1e-11 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 2e-10 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 3e-10 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 8e-10 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 2e-08 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 5e-08 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 1e-06 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-11 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 5e-11 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 5e-11 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-10 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 7e-10 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-09 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 4e-09 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 6e-09 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 8e-09 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 8e-08 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 4e-07 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 9e-07 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 5e-04 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 3e-11 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 6e-11 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 2e-10 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 2e-10 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 4e-10 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 5e-10 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 6e-10 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 9e-10 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 1e-09 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 3e-09 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 9e-08 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 3e-11 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 3e-10 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 4e-10 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 5e-10 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 6e-10 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 7e-10 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-09 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-09 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-09 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 6e-08 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 7e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-11 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 5e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 6e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 7e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-09 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-09 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 9e-09 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-06 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-05 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-11 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 9e-11 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-10 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-10 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-10 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 5e-10 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 6e-10 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 3e-09 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 7e-09 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 7e-09 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-08 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 2e-07 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 3e-07 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-06 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 7e-11 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-10 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 4e-10 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 6e-10 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-09 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-09 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 8e-09 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 1e-08 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-08 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 7e-07 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-06 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-10 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 8e-10 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-07 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 4e-06 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 2e-10 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-10 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 6e-10 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 8e-09 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-07 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 5e-07 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 6e-06 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 6e-05 |
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
Score = 110 bits (277), Expect = 2e-32
Identities = 76/87 (87%), Positives = 80/87 (91%)
Query: 30 LSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDD 89
L+GADLS+ADLR ADFSLANVTK NL+NANLEGA GNTSF+GSNITGADFTDVPLRDD
Sbjct: 58 LTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDD 117
Query: 90 QREYLCKVADGVNPTTGNATRDTLLCN 116
QR YLCKVADGVN TTGNATRDTLLCN
Sbjct: 118 QRVYLCKVADGVNATTGNATRDTLLCN 144
|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 116 | |||
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 99.84 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 99.83 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 99.66 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 99.64 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 99.55 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 99.45 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 99.39 |
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 | Back alignment and structure |
|---|
Probab=99.84 E-value=5.3e-21 Score=130.23 Aligned_cols=88 Identities=83% Similarity=1.156 Sum_probs=68.6
Q ss_pred CCcccCCcccCccccCcccCCceecCceeccCcccCCccc-CceeccCCeecCCccCCCcCChhhHHHHhhhccCCCCcc
Q 033564 27 LFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALAT-GNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTT 105 (116)
Q Consensus 27 ~~~l~~~~f~~~~l~~~~f~~~~~~~a~f~~a~l~~a~f~-~~~~f~~~~l~~a~~~~a~l~~~~l~~~~~~~~g~~~~~ 105 (116)
+++|++++|++++|++++|.+|+|++++|.+|+|.++.|. + ++|.+++|++++|++++|++++++++|++.+|+||.+
T Consensus 55 ~a~l~~a~f~~a~l~~a~f~~a~l~~a~f~~a~l~~a~~~g~-~~~~~a~l~~a~~~~a~l~~~~l~~lc~~~~g~n~~~ 133 (152)
T 3n90_A 55 DADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGN-TSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATT 133 (152)
T ss_dssp TCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCCSS-CBCTTCBCTTCBCTTCCCCHHHHHHHHHHCCCBCTTT
T ss_pred ccCcCCCEeCCCCcCCCCCCCCCcCCCCcCCCCCCCCEEcCC-ceECCCEecCCEecCCccCcHHHHHHhhhhhCcCCcc
Confidence 4455555555555555666666666666666666666666 4 7888899999999999999999999999999999999
Q ss_pred ccccccccCC
Q 033564 106 GNATRDTLLC 115 (116)
Q Consensus 106 ~~~~~~~l~~ 115 (116)
+++|++.|-|
T Consensus 134 ~~~tr~~~~~ 143 (152)
T 3n90_A 134 GNATRDTLLC 143 (152)
T ss_dssp CCBHHHHTTT
T ss_pred ccchhhhhhh
Confidence 9999998865
|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 116 | ||||
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 7e-15 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 8e-09 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 2e-06 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 3e-04 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 0.001 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 0.004 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 1e-07 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 1e-06 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 1e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 2e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 7e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 1e-04 |
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pentapeptide repeat-like family: Pentapeptide repeats domain: Lumenal RFR-domain protein species: Cyanothece sp. atcc 51142 [TaxId: 43989]
Score = 63.7 bits (154), Expect = 7e-15
Identities = 37/125 (29%), Positives = 50/125 (40%), Gaps = 39/125 (31%)
Query: 30 LSGADLSDADLRSADFSLANVTKAN----------------------------------- 54
L G D S L A F+ A++T +N
Sbjct: 8 LIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTS 67
Query: 55 LSNANLEGALATG----NTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATR 110
A+L A+ T T F + ITGADF+ L + + LC ADGVNP TG +TR
Sbjct: 68 FKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTR 127
Query: 111 DTLLC 115
++L C
Sbjct: 128 ESLRC 132
|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 116 | |||
| d2f3la1 | 132 | Lumenal RFR-domain protein {Cyanothece sp. atcc 51 | 99.82 | |
| d2f3la1 | 132 | Lumenal RFR-domain protein {Cyanothece sp. atcc 51 | 99.64 | |
| d2j8ka1 | 175 | NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | 99.49 | |
| d2j8ka1 | 175 | NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | 99.46 |
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pentapeptide repeat-like family: Pentapeptide repeats domain: Lumenal RFR-domain protein species: Cyanothece sp. atcc 51142 [TaxId: 43989]
Probab=99.82 E-value=6.1e-21 Score=125.32 Aligned_cols=86 Identities=44% Similarity=0.608 Sum_probs=63.8
Q ss_pred cccCCcccCccccCcccCCceecCceeccCcccCCcccCceeccCCeecCCccCCCcCChhhHHHHhhhccCCCCccccc
Q 033564 29 PLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNA 108 (116)
Q Consensus 29 ~l~~~~f~~~~l~~~~f~~~~~~~a~f~~a~l~~a~f~~~~~f~~~~l~~a~~~~a~l~~~~l~~~~~~~~g~~~~~~~~ 108 (116)
+|.+++|++++|.+++|.+++|++++|++++|.+++|.+ ++|.+++|++++|++|+|++++++.+|.++.|+||.+...
T Consensus 47 ~l~~~~~~~a~l~~a~~~~~~~~~~~~~~a~~~~a~l~~-a~~~~a~l~~adfs~a~L~~~~l~~~~~~~~g~n~~~~~~ 125 (132)
T d2f3la1 47 ALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMR-TKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVS 125 (132)
T ss_dssp BCTTCBCTTCBCTTCEEEEEECTTCBCTTCBCTTCEEEE-EECTTCBCTTCBCTTCEECHHHHHHHHTTCCCBCTTTCCB
T ss_pred ccccccccccccccccccccccchhhhccCCcCCCCcCC-CCcCCCEECcCCCCCccCCHHHHHHHhccCcccCCCCcch
Confidence 333444444444444444444455555555555666666 8888888999999999999999999999999999999999
Q ss_pred cccccCC
Q 033564 109 TRDTLLC 115 (116)
Q Consensus 109 ~~~~l~~ 115 (116)
|+..|+|
T Consensus 126 ~~~~l~~ 132 (132)
T d2f3la1 126 TRESLRC 132 (132)
T ss_dssp HHHHTTC
T ss_pred hhhccCC
Confidence 9999999
|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|