Citrus Sinensis ID: 033564


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MRVVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLCN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHcccccccc
ccEEEEEEcccHEEccccEEEEEHEEHcccccccccccccccccEcEEEEcccccccHEHHHHEHHccccccccEEEccccccccccHHHHHHHHHHHccccccccccHHHHcccc
MRVVAYITQLpvaakwgnisyIHCLLlfplsgadlsdadlrSADFSLANVTKANlsnanlegalatgntsfrgsnitgadftdvplrddqREYLCKVadgvnpttgnatrdtllcn
MRVVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALAtgntsfrgsnitgadftdvplRDDQREYLCkvadgvnpttgnatrdtllcn
MRVVAYITQLPVAAKWGNISYIHCLLLFPlsgadlsdadlrsadfslaNVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLCN
**VVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGV***************
MRVVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLC*
MRVVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLCN
MRVVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGV*************C*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVVAYITQLPVAAKWGNISYIHCLLLFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLCN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
O22160224 Thylakoid lumenal 15 kDa yes no 0.75 0.388 0.885 5e-38
Q8H1Q1280 Thylakoid lumenal protein no no 0.689 0.285 0.430 3e-06
Q9SE95298 FH protein interacting pr no no 0.586 0.228 0.420 2e-05
>sp|O22160|TL15A_ARATH Thylakoid lumenal 15 kDa protein 1, chloroplastic OS=Arabidopsis thaliana GN=At2g44920 PE=1 SV=2 Back     alignment and function desciption
 Score =  155 bits (393), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 77/87 (88%), Positives = 81/87 (93%)

Query: 30  LSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDD 89
           L+GADLS+ADLR ADFSLANVTK NL+NANLEGA  TGNTSF+GSNITGADFTDVPLRDD
Sbjct: 138 LTGADLSEADLRGADFSLANVTKVNLTNANLEGATVTGNTSFKGSNITGADFTDVPLRDD 197

Query: 90  QREYLCKVADGVNPTTGNATRDTLLCN 116
           QR YLCKVADGVN TTGNATRDTLLCN
Sbjct: 198 QRVYLCKVADGVNATTGNATRDTLLCN 224





Arabidopsis thaliana (taxid: 3702)
>sp|Q8H1Q1|TL225_ARATH Thylakoid lumenal protein At1g12250, chloroplastic OS=Arabidopsis thaliana GN=At1g12250 PE=1 SV=1 Back     alignment and function description
>sp|Q9SE95|FIP2_ARATH FH protein interacting protein FIP2 OS=Arabidopsis thaliana GN=FIP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
388510406 225 unknown [Lotus japonicus] 0.75 0.386 0.965 3e-41
359806262 222 uncharacterized protein LOC100806792 [Gl 0.75 0.391 0.942 1e-40
388521435 225 unknown [Lotus japonicus] 0.75 0.386 0.954 1e-40
224098455 218 predicted protein [Populus trichocarpa] 0.75 0.399 0.954 4e-40
255645177 222 unknown [Glycine max] 0.75 0.391 0.931 4e-40
351722845 224 uncharacterized protein LOC100500352 [Gl 0.75 0.388 0.931 1e-39
147774410 221 hypothetical protein VITISV_013914 [Viti 0.75 0.393 0.942 2e-39
224112717 219 predicted protein [Populus trichocarpa] 0.75 0.397 0.942 2e-39
225449424 221 PREDICTED: thylakoid lumenal 15 kDa prot 0.75 0.393 0.942 2e-39
449441422214 PREDICTED: thylakoid lumenal 15 kDa prot 0.75 0.406 0.919 2e-38
>gi|388510406|gb|AFK43269.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/87 (96%), Positives = 87/87 (100%)

Query: 30  LSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDD 89
           L+GADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSF+GSNITGADFTDVPLRDD
Sbjct: 139 LTGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFKGSNITGADFTDVPLRDD 198

Query: 90  QREYLCKVADGVNPTTGNATRDTLLCN 116
           QREYLCKVADGVNPTTGNATR+TLLCN
Sbjct: 199 QREYLCKVADGVNPTTGNATRETLLCN 225




Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359806262|ref|NP_001240959.1| uncharacterized protein LOC100806792 [Glycine max] gi|255626639|gb|ACU13664.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388521435|gb|AFK48779.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224098455|ref|XP_002311180.1| predicted protein [Populus trichocarpa] gi|222851000|gb|EEE88547.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255645177|gb|ACU23086.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351722845|ref|NP_001236746.1| uncharacterized protein LOC100500352 [Glycine max] gi|255630103|gb|ACU15405.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147774410|emb|CAN74472.1| hypothetical protein VITISV_013914 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112717|ref|XP_002316270.1| predicted protein [Populus trichocarpa] gi|222865310|gb|EEF02441.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225449424|ref|XP_002282933.1| PREDICTED: thylakoid lumenal 15 kDa protein 1, chloroplastic [Vitis vinifera] gi|296086195|emb|CBI31636.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441422|ref|XP_004138481.1| PREDICTED: thylakoid lumenal 15 kDa protein 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
TAIR|locus:2055023224 AT2G44920 "AT2G44920" [Arabido 0.586 0.303 0.897 7.1e-29
TAIR|locus:2202033280 AT1G12250 "AT1G12250" [Arabido 0.560 0.232 0.424 6.4e-07
TAIR|locus:2055023 AT2G44920 "AT2G44920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
 Identities = 61/68 (89%), Positives = 63/68 (92%)

Query:    49 NVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNA 108
             NVTK NL+NANLEGA  TGNTSF+GSNITGADFTDVPLRDDQR YLCKVADGVN TTGNA
Sbjct:   157 NVTKVNLTNANLEGATVTGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNA 216

Query:   109 TRDTLLCN 116
             TRDTLLCN
Sbjct:   217 TRDTLLCN 224




GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:2202033 AT1G12250 "AT1G12250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22160TL15A_ARATHNo assigned EC number0.88500.750.3883yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00080525
hypothetical protein (218 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XII.166.1
hypothetical protein (196 aa)
      0.563

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 7e-08
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 4e-07
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 7e-07
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 8e-07
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 9e-07
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-06
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 4e-06
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 6e-06
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 2e-05
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-05
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 8e-05
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 9e-05
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 1e-04
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 6e-04
COG1357 238 COG1357, COG1357, Pentapeptide repeats containing 7e-04
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 7e-04
PRK15196 350 PRK15196, PRK15196, secreted effector protein PipB 0.002
COG1357 238 COG1357, COG1357, Pentapeptide repeats containing 0.003
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
 Score = 44.7 bits (107), Expect = 7e-08
 Identities = 23/34 (67%), Positives = 26/34 (76%)

Query: 30 LSGADLSDADLRSADFSLANVTKANLSNANLEGA 63
          LSGA+L  ADLR AD S A++T ANLS ANL GA
Sbjct: 3  LSGANLRGADLRGADLSGADLTGANLSGANLSGA 36


These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A(D/N)LXX, where X can be any amino acid. Length = 40

>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
PRK15197291 secreted effector protein PipB; Provisional 99.56
KOG1665302 consensus AFH1-interacting protein FIP2, contains 99.37
PF1359978 Pentapeptide_4: Pentapeptide repeats (9 copies); P 99.31
PF1359978 Pentapeptide_4: Pentapeptide repeats (9 copies); P 99.3
PRK09718 512 hypothetical protein; Validated 99.23
KOG1665302 consensus AFH1-interacting protein FIP2, contains 99.21
>PRK15197 secreted effector protein PipB; Provisional Back     alignment and domain information
Probab=99.56  E-value=1.9e-15  Score=113.59  Aligned_cols=17  Identities=24%  Similarity=0.255  Sum_probs=10.5

Q ss_pred             hccCCCCcccccccccc
Q 033564           97 VADGVNPTTGNATRDTL  113 (116)
Q Consensus        97 ~~~g~~~~~~~~~~~~l  113 (116)
                      .+.|+++.++++|+..|
T Consensus       261 ~L~gad~~ga~~tp~~~  277 (291)
T PRK15197        261 ALTGADLTGSQHTPTPL  277 (291)
T ss_pred             CCCCCcccCCccCCCCC
Confidence            45566777776665543



>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A Back     alignment and domain information
>PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
3n90_A152 The 1.7 Angstrom Resolution Crystal Structure Of At 2e-29
2f3l_A184 Crystal Structure Of A Lumenal Rfr-Domain Protein ( 2e-06
2g0y_A184 Crystal Structure Of A Lumenal Pentapeptide Repeat 2e-06
>pdb|3N90|A Chain A, The 1.7 Angstrom Resolution Crystal Structure Of At2g44920, A Pentapeptide Repeat Protein From Arabidopsis Thaliana Thylakoid Lumen Length = 152 Back     alignment and structure

Iteration: 1

Score = 123 bits (309), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 60/68 (88%), Positives = 62/68 (91%) Query: 49 NVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNA 108 NVTK NL+NANLEGA GNTSF+GSNITGADFTDVPLRDDQR YLCKVADGVN TTGNA Sbjct: 77 NVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNA 136 Query: 109 TRDTLLCN 116 TRDTLLCN Sbjct: 137 TRDTLLCN 144
>pdb|2F3L|A Chain A, Crystal Structure Of A Lumenal Rfr-Domain Protein (Contig83.1_1_243_746) From Cyanothece Sp. 51142 At 2.1 Angstrom Resolution Length = 184 Back     alignment and structure
>pdb|2G0Y|A Chain A, Crystal Structure Of A Lumenal Pentapeptide Repeat Protein From Cyanothece Sp 51142 At 2.3 Angstrom Resolution. Tetragonal Crystal Form Length = 184 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 2e-32
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 6e-26
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 4e-08
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 3e-07
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 9e-13
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 3e-11
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 6e-11
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 3e-09
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 5e-06
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 4e-05
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 9e-05
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-11
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 2e-10
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 3e-10
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 8e-10
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 2e-08
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 5e-08
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-06
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-11
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 5e-11
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 5e-11
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-10
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 7e-10
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-09
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 4e-09
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 6e-09
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 8e-09
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 8e-08
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 4e-07
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 9e-07
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 5e-04
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 3e-11
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 6e-11
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-10
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-10
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 4e-10
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-10
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 6e-10
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 9e-10
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 1e-09
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 3e-09
2bm5_A 186 MFPA, RV3361C, pentapeptide repeat family protein; 9e-08
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 3e-11
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 3e-10
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 4e-10
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 5e-10
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 6e-10
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-10
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-09
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-09
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 2e-09
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 6e-08
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 7e-05
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 4e-11
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 4e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 5e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 6e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 7e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-09
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-09
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 9e-09
2j8k_A 201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-05
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 4e-11
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 9e-11
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-10
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 4e-10
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 4e-10
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 5e-10
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 6e-10
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-09
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 7e-09
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 7e-09
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-08
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-07
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-07
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-06
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 7e-11
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-10
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 4e-10
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 6e-10
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-09
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 2e-09
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 8e-09
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 1e-08
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-08
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 7e-07
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-06
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 1e-10
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 8e-10
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 1e-07
2w7z_A 214 EFSQNR, pentapeptide repeat family protein; glutar 4e-06
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-10
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-10
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 6e-10
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 8e-09
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-07
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 5e-07
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 6e-06
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 6e-05
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
 Score =  110 bits (277), Expect = 2e-32
 Identities = 76/87 (87%), Positives = 80/87 (91%)

Query: 30  LSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDD 89
           L+GADLS+ADLR ADFSLANVTK NL+NANLEGA   GNTSF+GSNITGADFTDVPLRDD
Sbjct: 58  LTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDD 117

Query: 90  QREYLCKVADGVNPTTGNATRDTLLCN 116
           QR YLCKVADGVN TTGNATRDTLLCN
Sbjct: 118 QRVYLCKVADGVNATTGNATRDTLLCN 144


>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.84
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.83
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.66
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.64
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 99.55
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.45
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.39
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
Probab=99.84  E-value=5.3e-21  Score=130.23  Aligned_cols=88  Identities=83%  Similarity=1.156  Sum_probs=68.6

Q ss_pred             CCcccCCcccCccccCcccCCceecCceeccCcccCCccc-CceeccCCeecCCccCCCcCChhhHHHHhhhccCCCCcc
Q 033564           27 LFPLSGADLSDADLRSADFSLANVTKANLSNANLEGALAT-GNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTT  105 (116)
Q Consensus        27 ~~~l~~~~f~~~~l~~~~f~~~~~~~a~f~~a~l~~a~f~-~~~~f~~~~l~~a~~~~a~l~~~~l~~~~~~~~g~~~~~  105 (116)
                      +++|++++|++++|++++|.+|+|++++|.+|+|.++.|. + ++|.+++|++++|++++|++++++++|++.+|+||.+
T Consensus        55 ~a~l~~a~f~~a~l~~a~f~~a~l~~a~f~~a~l~~a~~~g~-~~~~~a~l~~a~~~~a~l~~~~l~~lc~~~~g~n~~~  133 (152)
T 3n90_A           55 DADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGN-TSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATT  133 (152)
T ss_dssp             TCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCCSS-CBCTTCBCTTCBCTTCCCCHHHHHHHHHHCCCBCTTT
T ss_pred             ccCcCCCEeCCCCcCCCCCCCCCcCCCCcCCCCCCCCEEcCC-ceECCCEecCCEecCCccCcHHHHHHhhhhhCcCCcc
Confidence            4455555555555555666666666666666666666666 4 7888899999999999999999999999999999999


Q ss_pred             ccccccccCC
Q 033564          106 GNATRDTLLC  115 (116)
Q Consensus       106 ~~~~~~~l~~  115 (116)
                      +++|++.|-|
T Consensus       134 ~~~tr~~~~~  143 (152)
T 3n90_A          134 GNATRDTLLC  143 (152)
T ss_dssp             CCBHHHHTTT
T ss_pred             ccchhhhhhh
Confidence            9999998865



>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 116
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 7e-15
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 8e-09
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 2e-06
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 3e-04
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 0.001
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 0.004
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 1e-07
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 1e-06
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 1e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-05
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 7e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 1e-04
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: Lumenal RFR-domain protein
species: Cyanothece sp. atcc 51142 [TaxId: 43989]
 Score = 63.7 bits (154), Expect = 7e-15
 Identities = 37/125 (29%), Positives = 50/125 (40%), Gaps = 39/125 (31%)

Query: 30  LSGADLSDADLRSADFSLANVTKAN----------------------------------- 54
           L G D S   L  A F+ A++T +N                                   
Sbjct: 8   LIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTS 67

Query: 55  LSNANLEGALATG----NTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATR 110
              A+L  A+ T      T F  + ITGADF+   L   + + LC  ADGVNP TG +TR
Sbjct: 68  FKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTR 127

Query: 111 DTLLC 115
           ++L C
Sbjct: 128 ESLRC 132


>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.82
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.64
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.49
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.46
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: Lumenal RFR-domain protein
species: Cyanothece sp. atcc 51142 [TaxId: 43989]
Probab=99.82  E-value=6.1e-21  Score=125.32  Aligned_cols=86  Identities=44%  Similarity=0.608  Sum_probs=63.8

Q ss_pred             cccCCcccCccccCcccCCceecCceeccCcccCCcccCceeccCCeecCCccCCCcCChhhHHHHhhhccCCCCccccc
Q 033564           29 PLSGADLSDADLRSADFSLANVTKANLSNANLEGALATGNTSFRGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNA  108 (116)
Q Consensus        29 ~l~~~~f~~~~l~~~~f~~~~~~~a~f~~a~l~~a~f~~~~~f~~~~l~~a~~~~a~l~~~~l~~~~~~~~g~~~~~~~~  108 (116)
                      +|.+++|++++|.+++|.+++|++++|++++|.+++|.+ ++|.+++|++++|++|+|++++++.+|.++.|+||.+...
T Consensus        47 ~l~~~~~~~a~l~~a~~~~~~~~~~~~~~a~~~~a~l~~-a~~~~a~l~~adfs~a~L~~~~l~~~~~~~~g~n~~~~~~  125 (132)
T d2f3la1          47 ALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMR-TKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVS  125 (132)
T ss_dssp             BCTTCBCTTCBCTTCEEEEEECTTCBCTTCBCTTCEEEE-EECTTCBCTTCBCTTCEECHHHHHHHHTTCCCBCTTTCCB
T ss_pred             ccccccccccccccccccccccchhhhccCCcCCCCcCC-CCcCCCEECcCCCCCccCCHHHHHHHhccCcccCCCCcch
Confidence            333444444444444444444455555555555666666 8888888999999999999999999999999999999999


Q ss_pred             cccccCC
Q 033564          109 TRDTLLC  115 (116)
Q Consensus       109 ~~~~l~~  115 (116)
                      |+..|+|
T Consensus       126 ~~~~l~~  132 (132)
T d2f3la1         126 TRESLRC  132 (132)
T ss_dssp             HHHHTTC
T ss_pred             hhhccCC
Confidence            9999999



>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure