Citrus Sinensis ID: 033664

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MGEGEEAAMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA
cccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccHHHHcccccEEEEEEEccHHHHHHHHccHHHHHHHHHHHHHHHccEEEcccccccccccc
cccHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEcccccccccccccccEEEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHcEEEEEccccccccccc
MGEGEEAAMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAvksfewgqdvegQEMLRQGFTHAFLMTFnkkedyttfashpshvefSATFSAAIEKIVLldfptvlgkapaa
mgegeeaamgefkhlvivkfkegvVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA
mgegeeaamgeFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA
**********EFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVL******
************KHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLG*****
********MGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA
********MGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEGEEAAMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q9FK81111 Uncharacterized protein A yes no 0.912 0.936 0.634 8e-33
Q9LUV2109 Probable protein Pop3 OS= no no 0.877 0.917 0.409 5e-17
I6WU39101 Olivetolic acid cyclase O N/A no 0.798 0.900 0.336 4e-08
>sp|Q9FK81|Y5258_ARATH Uncharacterized protein At5g22580 OS=Arabidopsis thaliana GN=At5g22580 PE=1 SV=1 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (75%)

Query: 8   AMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFL 67
           A   FKHLV+VKFKE   V++I+KG++ LVS+ID VKSFEWG+D E  +MLRQGFTHAF 
Sbjct: 2   ATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFS 61

Query: 68  MTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKA 111
           MTF  K+ Y  F SHP HVEFSA F+A I+KIVLLDFP    K+
Sbjct: 62  MTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKS 105

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LUV2|POP3_ARATH Probable protein Pop3 OS=Arabidopsis thaliana GN=At3g17210 PE=1 SV=1 Back     alignment and function description
>sp|I6WU39|OLIAC_CANSA Olivetolic acid cyclase OS=Cannabis sativa GN=OAC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
225436329105 PREDICTED: uncharacterized protein At5g2 0.912 0.990 0.798 6e-42
388514441107 unknown [Lotus japonicus] 0.929 0.990 0.764 9e-41
407260761110 stress responsive A/B barrel domain fami 0.929 0.963 0.785 2e-40
351723495105 uncharacterized protein LOC100500080 [Gl 0.921 1.0 0.761 2e-40
224105013112 predicted protein [Populus trichocarpa] 0.938 0.955 0.766 3e-40
407260763110 stress responsive A/B barrel domain fami 0.903 0.936 0.786 1e-39
217075526111 unknown [Medicago truncatula] gi|3885050 0.912 0.936 0.769 4e-39
224085591110 predicted protein [Populus trichocarpa] 0.964 1.0 0.728 6e-39
449456098108 PREDICTED: uncharacterized protein At5g2 0.894 0.944 0.725 9e-37
255585865107 conserved hypothetical protein [Ricinus 0.929 0.990 0.745 2e-36
>gi|225436329|ref|XP_002268144.1| PREDICTED: uncharacterized protein At5g22580 [Vitis vinifera] gi|147803505|emb|CAN68720.1| hypothetical protein VITISV_033679 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/104 (79%), Positives = 93/104 (89%)

Query: 9   MGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLM 68
           MG+FKHLV+ KFKEGV VE+IVKGM+KLV++IDAVKSFEWGQD+E QEMLRQGFTHAFLM
Sbjct: 1   MGDFKHLVVAKFKEGVAVEEIVKGMEKLVADIDAVKSFEWGQDLESQEMLRQGFTHAFLM 60

Query: 69  TFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAP 112
           TFN + D+T F SHP+HVEFS TFSAAIEKIVLLDFP V  KAP
Sbjct: 61  TFNNQGDFTAFLSHPNHVEFSTTFSAAIEKIVLLDFPAVPVKAP 104

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388514441|gb|AFK45282.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|407260761|gb|AFT91999.1| stress responsive A/B barrel domain family protein [Populus tomentosa] gi|407260785|gb|AFT92011.1| stress responsive A/B barrel domain family protein [Populus tomentosa] Back     alignment and taxonomy information
>gi|351723495|ref|NP_001236513.1| uncharacterized protein LOC100500080 [Glycine max] gi|255628995|gb|ACU14842.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224105013|ref|XP_002313655.1| predicted protein [Populus trichocarpa] gi|118484440|gb|ABK94096.1| unknown [Populus trichocarpa] gi|222850063|gb|EEE87610.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|407260763|gb|AFT92000.1| stress responsive A/B barrel domain family protein [Populus alba x Populus tremula var. glandulosa] gi|407260787|gb|AFT92012.1| stress responsive A/B barrel domain family protein [Populus alba x Populus tremula var. glandulosa] Back     alignment and taxonomy information
>gi|217075526|gb|ACJ86123.1| unknown [Medicago truncatula] gi|388505032|gb|AFK40582.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224085591|ref|XP_002335271.1| predicted protein [Populus trichocarpa] gi|224131636|ref|XP_002328071.1| predicted protein [Populus trichocarpa] gi|222833185|gb|EEE71662.1| predicted protein [Populus trichocarpa] gi|222837586|gb|EEE75951.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449456098|ref|XP_004145787.1| PREDICTED: uncharacterized protein At5g22580-like isoform 1 [Cucumis sativus] gi|449456100|ref|XP_004145788.1| PREDICTED: uncharacterized protein At5g22580-like isoform 2 [Cucumis sativus] gi|449456102|ref|XP_004145789.1| PREDICTED: uncharacterized protein At5g22580-like isoform 3 [Cucumis sativus] gi|449496254|ref|XP_004160085.1| PREDICTED: uncharacterized protein At5g22580-like isoform 1 [Cucumis sativus] gi|449496258|ref|XP_004160086.1| PREDICTED: uncharacterized protein At5g22580-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255585865|ref|XP_002533607.1| conserved hypothetical protein [Ricinus communis] gi|223526508|gb|EEF28776.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
TAIR|locus:2171102111 AT5G22580 "AT5G22580" [Arabido 0.877 0.900 0.65 4.7e-32
TAIR|locus:2089055109 HS1 "heat stable protein 1" [A 0.815 0.853 0.408 9.5e-18
UNIPROTKB|I6WU39101 OAC "Olivetolic acid cyclase" 0.798 0.900 0.336 5.8e-11
ASPGD|ASPL0000077771111 AN8584 [Emericella nidulans (t 0.789 0.810 0.284 2.1e-06
UNIPROTKB|G4MRR7110 MGG_13796 "Stress responsive A 0.798 0.827 0.300 1.1e-05
ASPGD|ASPL0000057435110 AN1204 [Emericella nidulans (t 0.789 0.818 0.303 1.9e-05
UNIPROTKB|G4MMF5110 MGG_15996 "Uncharacterized pro 0.798 0.827 0.271 2.4e-05
TAIR|locus:2008261 210 DABB1 "dimeric A/B barrel doma 0.868 0.471 0.264 0.00073
UNIPROTKB|G4MPY9110 MGG_05763 "Stress responsive A 0.578 0.6 0.294 0.00093
TAIR|locus:2171102 AT5G22580 "AT5G22580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 4.7e-32, P = 4.7e-32
 Identities = 65/100 (65%), Positives = 78/100 (78%)

Query:    12 FKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFN 71
             FKHLV+VKFKE   V++I+KG++ LVS+ID VKSFEWG+D E  +MLRQGFTHAF MTF 
Sbjct:     6 FKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFE 65

Query:    72 KKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKA 111
              K+ Y  F SHP HVEFSA F+A I+KIVLLDFP    K+
Sbjct:    66 NKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKS 105
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2089055 HS1 "heat stable protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I6WU39 OAC "Olivetolic acid cyclase" [Cannabis sativa (taxid:3483)] Back     alignment and assigned GO terms
ASPGD|ASPL0000077771 AN8584 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MRR7 MGG_13796 "Stress responsive A/B barrel domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000057435 AN1204 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MMF5 MGG_15996 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2008261 DABB1 "dimeric A/B barrel domainS-protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MPY9 MGG_05763 "Stress responsive A/B barrel domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FK81Y5258_ARATHNo assigned EC number0.63460.91220.9369yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
pfam0787696 pfam07876, Dabb, Stress responsive A/B Barrel Doma 8e-21
smart0088697 smart00886, Dabb, Stress responsive A/B Barrel Dom 1e-16
>gnl|CDD|219615 pfam07876, Dabb, Stress responsive A/B Barrel Domain Back     alignment and domain information 
 Score = 79.3 bits (196), Expect = 8e-21
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 5/96 (5%)

Query: 12  FKHLVIVKFKEGV---VVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLM 68
            +H+V+ KFK+ V    + ++++G++ L  EI  +KS E G++V  +    QG+THA + 
Sbjct: 1   IRHIVLFKFKDDVSEEEIAEVLEGLEALKGEIPGIKSIEVGRNVSPEG--NQGYTHALVS 58

Query: 69  TFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDF 104
            F  KED   + +HP+HV F       +EK V++DF
Sbjct: 59  EFESKEDLDAYLTHPAHVAFVERVKPLVEKRVVVDF 94

The function of this family is unknown, but it is upregulated in response to salt stress in Populus balsamifera. It is also found at the C-terminus of an fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus. Arthrobacter nicotinovorans ORF106 is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an a/b barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. Length = 96
>gnl|CDD|214884 smart00886, Dabb, Stress responsive A/B Barrel Domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
PF0787697 Dabb: Stress responsive A/B Barrel Domain; InterPr 99.97
PF0399278 ABM: Antibiotic biosynthesis monooxygenase; InterP 98.52
COG1359100 Uncharacterized conserved protein [Function unknow 97.84
TIGR02118100 conserved hypothetical protein. This model represe 97.79
PRK1048696 autoinducer-2 (AI-2) modifying protein LsrG; Provi 97.34
PF11639104 HapK: REDY-like protein HapK; InterPro: IPR021667 97.12
PF0704565 DUF1330: Protein of unknown function (DUF1330); In 96.8
COG2329105 Uncharacterized enzyme involved in biosynthesis of 96.56
COG3224195 Uncharacterized protein conserved in bacteria [Fun 96.5
PRK13315107 heme-degrading monooxygenase IsdG; Provisional 95.67
PF0711095 EthD: EthD domain; InterPro: IPR009799 This family 95.57
COG547096 Uncharacterized conserved protein [Function unknow 95.39
PRK13314107 heme-degrading monooxygenase IsdG; Provisional 95.23
PRK13316121 heme-degrading monooxygenase IsdG; Provisional 95.22
PF0103774 AsnC_trans_reg: AsnC family; InterPro: IPR019887 T 93.95
PRK13313108 heme-degrading monooxygenase IsdI; Provisional 92.3
PRK13312107 heme-degrading monooxygenase IsdG; Provisional 91.84
PRK09565533 hypothetical protein; Reviewed 84.35
PF13826117 DUF4188: Domain of unknown function (DUF4188) 82.77
>PF07876 Dabb: Stress responsive A/B Barrel Domain; InterPro: IPR013097 The stress-response A/B barrel domain is found in a class of stress-response proteins in plants Back     alignment and domain information 
Probab=99.97  E-value=1.4e-30  Score=165.96  Aligned_cols=94  Identities=29%  Similarity=0.639  Sum_probs=87.0

Q ss_pred             EEEEEEEEecCCCC---HHHHHHHHHHchhcCCcEeEEEeecccCChhhhcCcccEEEEEEECCHHhHHHhhcChhHHHH
Q 033664           12 FKHLVIVKFKEGVV---VEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEF   88 (114)
Q Consensus        12 i~HiVlfk~k~~~~---~~~~~~~l~~L~~~iP~v~~~~~G~~~~s~~~~~~~~~~~l~~~F~s~~al~~Y~~hP~H~~~   88 (114)
                      |+|||+||||++++   ++++.+.+.+|+++||||+++++|+|. ++...++|||++++++|+|.+++++|++||.|+++
T Consensus         1 I~Hivlfklk~~~~~~~~~~~~~~l~~l~~~ip~i~~~~~G~~~-~~~~~~~~~~~~~~~~F~s~~~l~~Y~~hp~H~~~   79 (97)
T PF07876_consen    1 IRHIVLFKLKPDATEEEIEEVLEALRALKDKIPGIVSFEVGRNF-SPEDLAKGYDHALVSTFESEEDLDAYQTHPAHQAF   79 (97)
T ss_dssp             EEEEEEEEESTTTCHHHHHHHHHHHHHHHHHSTTECEEEEEEES-STSSTSTT-SEEEEEEESSHHHHHHHHTSHHHHHH
T ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHhcccCCCceEEEEEEccc-CcccccCCCcEEEEEEECCHHHHHHHHcCHHHHHH
Confidence            79999999999999   566789999999999999999999999 65556789999999999999999999999999999


Q ss_pred             HHHHHhhhhceEEEeeec
Q 033664           89 SATFSAAIEKIVLLDFPT  106 (114)
Q Consensus        89 ~~~~~p~~~~~~v~D~~~  106 (114)
                      ++.++|++++++++||++
T Consensus        80 ~~~~~p~~~~~~~~D~~V   97 (97)
T PF07876_consen   80 VEFLKPILEDRIVFDFEV   97 (97)
T ss_dssp             HHHHHGGEEEEEEEEEEE
T ss_pred             HHHHHHHhCceEEEEEEC
Confidence            999999999999999985

It is also found in some bacterial fructose-bisphosphate aldolase such as at the C terminus of a fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus (Q9ZA13 from SWISSPROT) []. Q93NG5 from SWISSPROT is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The stress-response A/B barrel domain forms a very stable dimer. This dimer belongs to the superfamily of dimeric alpha+beta barrels in which the two beta-sheets form a beta-barrel. The two molecules in the dimer are related by a 2-fold axis parallel to helix H1 and beta-strands B3 and B4. C-terminal residues extending from the beta4 strand of each monomer wrap around and connect with the beta2 strand and alpha1 helix of the opposing monomer to form the dimer interface [, , ].The outer surface of the beta-sheets of the two molecules forms a beta-barrel-like structure defining a central pore. The function of the stress-response A/B barrel domain is unknown [, , ], but it is upregulated in response to salt stress in Populus balsamifera (balsam poplar) []. Some proteins known to contain a stress response A/B barrel domain are listed below: - Arabidopsis thaliana At3g17210 - Arabidopsis thaliana At5g22580 -Populus tremula stable protein 1 (SP-1)(Populus species), a thermostable stress-responsive protein. - Pseudomonas hydrogenothermophila fructose 1,6-bisphosphate aldolase (cbbA). The structure of one of these proteins has been solved (Q9LUV2 from SWISSPROT) and the domain forms an alpha-beta barrel dimer [].; PDB: 3BB5_E 3FMB_A 3BDE_B 2QYC_A 1Q53_B 2Q3P_A 1Q4R_A 3BN7_A 3BGU_B 1RJJ_B ....
>PF03992 ABM: Antibiotic biosynthesis monooxygenase; InterPro: IPR007138 This domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species, which can carry out oxygenation without the assistance of any of the prosthetic groups, metal ions or cofactors normally associated with activation of molecular oxygen Back     alignment and domain information
>COG1359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02118 conserved hypothetical protein Back     alignment and domain information
>PRK10486 autoinducer-2 (AI-2) modifying protein LsrG; Provisional Back     alignment and domain information
>PF11639 HapK: REDY-like protein HapK; InterPro: IPR021667 This family of proteins represents HapK, a protein of unknown function, with two homologues PigK and RedY Back     alignment and domain information
>PF07045 DUF1330: Protein of unknown function (DUF1330); InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length Back     alignment and domain information
>COG2329 Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only] Back     alignment and domain information
>COG3224 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13315 heme-degrading monooxygenase IsdG; Provisional Back     alignment and domain information
>PF07110 EthD: EthD domain; InterPro: IPR009799 This family consists of several bacterial sequences which are related to the EthD protein of Rhodococcus ruber (Q93EX2 from SWISSPROT) Back     alignment and domain information
>COG5470 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13314 heme-degrading monooxygenase IsdG; Provisional Back     alignment and domain information
>PRK13316 heme-degrading monooxygenase IsdG; Provisional Back     alignment and domain information
>PF01037 AsnC_trans_reg: AsnC family; InterPro: IPR019887 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK13313 heme-degrading monooxygenase IsdI; Provisional Back     alignment and domain information
>PRK13312 heme-degrading monooxygenase IsdG; Provisional Back     alignment and domain information
>PRK09565 hypothetical protein; Reviewed Back     alignment and domain information
>PF13826 DUF4188: Domain of unknown function (DUF4188) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1rjj_A111 Solution Structure Of A Homodimeric Hypothetical Pr 1e-33
1q53_A112 Solution Structure Of Hypothetical Arabidopsis Thal 5e-17
1q4r_A112 Gene Product Of At3g17210 From Arabidopsis Thaliana 8e-17
1si9_A108 Boiling Stable Protein Isolated From Populus Tremul 1e-06
>pdb|1RJJ|A Chain A, Solution Structure Of A Homodimeric Hypothetical Protein, At5g22580, A Structural Genomics Target From Arabidopsis Thaliana Length = 111 Back     alignment and structure 
Iteration: 1

 Score =  137 bits (345), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%)
Query: 12  FKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFN 71
           FKHLV+VKFKE   V++I+KG++ LVS+ID VKSFEWG+D E  +MLRQGFTHAF MTF 
Sbjct: 6   FKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFE 65
Query: 72  KKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKA 111
            K+ Y  F SHP HVEFSA F+A I+KIVLLDFP    K+
Sbjct: 66  NKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKS 105
>pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 Length = 112 Back     alignment and structure
>pdb|1Q4R|A Chain A, Gene Product Of At3g17210 From Arabidopsis Thaliana Length = 112 Back     alignment and structure
>pdb|1SI9|A Chain A, Boiling Stable Protein Isolated From Populus Tremula Length = 108 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1rjj_A111 Expressed protein; beta barrel, homodimer, structu 9e-29
2qyc_A103 Ferredoxin-like protein; stress responsive A/B bar 1e-24
1q4r_A112 Protein AT3G17210; center for eukaryotic structura 2e-23
1tr0_A108 Stable protein 1; plant protein; 1.80A {Populus tr 4e-22
3bgu_A116 Ferredoxin-like protein of unknown function; ferre 2e-20
3bb5_A121 Stress responsive alpha-beta protein; dimeric ferr 5e-20
3bn7_A120 Ferredoxin-like protein; stress responsive A/B bar 9e-20
3fmb_A118 Dimeric protein of unknown function and ferredoxi 2e-18
3bde_A120 MLL5499 protein; stress responsive A/B barrel doma 3e-15
>1rjj_A Expressed protein; beta barrel, homodimer, structural genomics, protein structure initiative, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: d.58.4.4 Length = 111 Back     alignment and structure
 Score = 99.6 bits (248), Expect = 9e-29
 Identities = 66/107 (61%), Positives = 79/107 (73%)

Query: 8   AMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFL 67
           A   FKHLV+VKFKE   V++I+KG++ LVS+ID VKSFEWG+D E  +MLRQGFTHAF 
Sbjct: 2   ATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFS 61

Query: 68  MTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA 114
           MTF  K+ Y  F SHP HVEFSA F+A I+KIVLLDFP    K+   
Sbjct: 62  MTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVV 108
>2qyc_A Ferredoxin-like protein; stress responsive A/B barrel domain, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 1.90A {Bordetella bronchiseptica RB50} Length = 103 Back     alignment and structure
>1q4r_A Protein AT3G17210; center for eukaryotic structural genom structural genomics, protein structure initiative, CESG, UN function; 1.90A {Arabidopsis thaliana} SCOP: d.58.4.4 PDB: 1q53_A 2q3p_A Length = 112 Back     alignment and structure
>1tr0_A Stable protein 1; plant protein; 1.80A {Populus tremula} SCOP: d.58.4.4 PDB: 1si9_A Length = 108 Back     alignment and structure
>3bgu_A Ferredoxin-like protein of unknown function; ferredoxin-like fold, stress responsive A/B barrel domain, S genomics; 1.50A {Thermobifida fusca} Length = 116 Back     alignment and structure
>3bb5_A Stress responsive alpha-beta protein; dimeric ferredoxin-like protein, structural genomics, joint for structural genomics, JCSG; HET: CIT; 2.30A {Jannaschia SP} Length = 121 Back     alignment and structure
>3bn7_A Ferredoxin-like protein; stress responsive A/B barre structural genomics, joint center for structural genomics; HET: MSE; 1.64A {Caulobacter crescentus} Length = 120 Back     alignment and structure
>3fmb_A Dimeric protein of unknown function and ferredoxi fold; YP_212648.1, stress responsive A/B barrel domain; HET: MSE; 1.85A {Bacteroides fragilis} Length = 118 Back     alignment and structure
>3bde_A MLL5499 protein; stress responsive A/B barrel domain, structural genomics, JO center for structural genomics, JCSG; 1.79A {Mesorhizobium loti} Length = 120 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
1rjj_A111 Expressed protein; beta barrel, homodimer, structu 100.0
1q4r_A112 Protein AT3G17210; center for eukaryotic structura 100.0
2qyc_A103 Ferredoxin-like protein; stress responsive A/B bar 100.0
1tr0_A108 Stable protein 1; plant protein; 1.80A {Populus tr 100.0
3bb5_A121 Stress responsive alpha-beta protein; dimeric ferr 99.98
3bn7_A120 Ferredoxin-like protein; stress responsive A/B bar 99.98
3bgu_A116 Ferredoxin-like protein of unknown function; ferre 99.97
3fmb_A118 Dimeric protein of unknown function and ferredoxi 99.97
3bde_A120 MLL5499 protein; stress responsive A/B barrel doma 99.97
2ftr_A108 BH0200; structural genomics, joint center for stru 98.68
3hf5_A116 4-methylmuconolactone methylisomerase; ferredoxin, 98.58
1y0h_A102 Hypothetical protein RV0793; ferredoxin-like fold, 98.56
3kkf_A105 Putative antibiotic biosynthesis monooxygenase; st 98.53
2fb0_A94 Conserved hypothetical protein; SAD, bacteroides t 98.52
3gz7_A115 Putative antibiotic biosynthesis monooxygenase; NP 98.41
2pd1_A104 Hypothetical protein; unknown function, NE2512 pro 98.4
2bbe_A108 Hypothetical protein SO0527; MCSG, structural geno 98.34
3e8o_A119 Uncharacterized protein with erredoxin-like fold; 98.34
2gff_A106 LSRG protein; dimeric alpha+beta barrel ferredoxin 98.33
2jdj_A105 HAPK, REDY-like protein; prodigiosin, biosynthesis 98.29
3bm7_A115 Protein of unknown function with ferredoxin-like; 98.27
1iuj_A106 Hypothetical protein TT1380; structural genomics, 98.26
1q8b_A105 Protein YJCS; structural genomics, PSI, protein st 98.26
4dpo_A119 Conserved protein; structural genomics, PSI-biolog 98.25
1x7v_A99 PA3566 protein, APC5058; structural genomics, prot 98.24
3kg0_A128 Snoab; polyketide, anthracycline, oxygenase, cofac 98.24
4dn9_A122 Antibiotic biosynthesis monooxygenase; structural 98.22
2omo_A124 DUF176; structural genomics, APC6266, PSI-2, prote 98.19
3bf4_A127 Ethyl TERT-butyl ether degradation ETHD protein; f 98.14
1tuv_A114 Protein YGIN; menadione oxidase, monooxygenase, CO 98.04
4hl9_A118 Antibiotic biosynthesis monooxygenase; nysgrc, PSI 98.0
2zdo_A109 Heme-degrading monooxygenase ISDG; ruffling, prote 97.93
3f44_A220 Putative monooxygenase; YP_193413.1, structural ge 97.75
1tz0_A114 Hypothetical protein; structural genomics, protein 97.68
1sqe_A109 Hypothetical protein PG130; structural genomics, P 97.55
3hx9_A124 Protein RV3592; DI-heme, beta barrel, dimer, oxido 97.51
2ril_A99 Antibiotic biosynthesis monooxygenase; YP_00109527 97.4
3tvz_A172 Putative uncharacterized protein YHGC; putative mo 97.26
2go8_A122 Hypothetical protein YQJZ; SR435, protein structur 97.23
3fgv_A106 Uncharacterized protein with ferredoxin-like fold; 97.14
3lo3_A94 Uncharacterized conserved protein; structural geno 97.13
3fj2_A186 Monooxygenase-like protein; structural genomics, j 96.84
2fiu_A99 Conserved hypothetical protein; alpha-beta, dimeri 96.82
3f44_A 220 Putative monooxygenase; YP_193413.1, structural ge 96.69
1lq9_A112 Actva-ORF6 monooxygenase; aromatic polyketides, ac 96.6
3hhl_A143 RPA0582; alpha-beta-barrel, structural genomics, P 96.52
3mcs_A219 Putative monooxygenase; structural genomics, joint 96.46
3mcs_A 219 Putative monooxygenase; structural genomics, joint 96.12
4ae5_A167 Signal transduction protein trap; signaling protei 93.56
2cvi_A83 75AA long hypothetical regulatory protein ASNC; st 89.48
2djw_A92 Probable transcriptional regulator, ASNC family; s 89.35
1vq3_A94 Phosphoribosylformylglycinamidine synthase, PURS; 88.11
2zbc_A83 83AA long hypothetical transcriptional regulator; 85.04
1gtd_A85 MTH169; synthetase, FGAM synthetase, purine synthe 81.88
2dgb_A84 Hypothetical protein PURS; purine, structural geno 81.4
2zw2_A92 Putative uncharacterized protein STS178; purine me 80.17
>1rjj_A Expressed protein; beta barrel, homodimer, structural genomics, protein structure initiative, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: d.58.4.4 Back     alignment and structure
Probab=100.00  E-value=3.2e-34  Score=187.04  Aligned_cols=105  Identities=63%  Similarity=1.037  Sum_probs=97.6

Q ss_pred             cCCcEEEEEEEEecCCCCHHHHHHHHHHchhcCCcEeEEEeecccCChhhhcCcccEEEEEEECCHHhHHHhhcChhHHH
Q 033664            8 AMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVE   87 (114)
Q Consensus         8 ~~~mi~HiVlfk~k~~~~~~~~~~~l~~L~~~iP~v~~~~~G~~~~s~~~~~~~~~~~l~~~F~s~~al~~Y~~hP~H~~   87 (114)
                      +++||+||||||||+++.++++.+.+.+|+++||||+++++|+|..++++++++||++++++|+|.++|++|+.||+|++
T Consensus         2 ~~~Mi~HiVlfklk~~~~~~~~~~~l~~L~~~ip~i~~~~~G~~~~~~~~~~~~~~~~l~~~F~s~e~l~~Y~~hP~H~~   81 (111)
T 1rjj_A            2 ATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVE   81 (111)
T ss_dssp             CSSEEEEEEEEECSSCCCHHHHHHHHHHHHGGGGGSCEEEEEEECCSCTTTSTTCCEEEEEEESSHHHHHHHHTSHHHHH
T ss_pred             CCCcEEEEEEEEECCcchHHHHHHHHHHHHhcCCceEEEEEcCCCCCccccCCCccEEEEEEECCHHHHHHHhCCHHHHH
Confidence            56799999999999999889999999999999999999999999734556789999999999999999999999999999


Q ss_pred             HHHHHHhhhhceEEEeeecCCCCCC
Q 033664           88 FSATFSAAIEKIVLLDFPTVLGKAP  112 (114)
Q Consensus        88 ~~~~~~p~~~~~~v~D~~~~~~~~~  112 (114)
                      +++.++|++++++++||+.+.+++|
T Consensus        82 ~~~~~~~~~~~~~v~D~~~~~~~~~  106 (111)
T 1rjj_A           82 FSAAFTAVIDKIVLLDFPVAAVKSS  106 (111)
T ss_dssp             HHHHHHHTCSEEEEEEEEECTTCCC
T ss_pred             HHHHHHHHhcceEEEEeEcceeccC
Confidence            9999999999999999999987553
>1q4r_A Protein AT3G17210; center for eukaryotic structural genom structural genomics, protein structure initiative, CESG, UN function; 1.90A {Arabidopsis thaliana} SCOP: d.58.4.4 PDB: 1q53_A 2q3p_A Back     alignment and structure
>2qyc_A Ferredoxin-like protein; stress responsive A/B barrel domain, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 1.90A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1tr0_A Stable protein 1; plant protein; 1.80A {Populus tremula} SCOP: d.58.4.4 PDB: 1si9_A Back     alignment and structure
>3bb5_A Stress responsive alpha-beta protein; dimeric ferredoxin-like protein, structural genomics, joint for structural genomics, JCSG; HET: CIT; 2.30A {Jannaschia SP} Back     alignment and structure
>3bn7_A Ferredoxin-like protein; stress responsive A/B barre structural genomics, joint center for structural genomics; HET: MSE; 1.64A {Caulobacter crescentus} Back     alignment and structure
>3bgu_A Ferredoxin-like protein of unknown function; ferredoxin-like fold, stress responsive A/B barrel domain, S genomics; 1.50A {Thermobifida fusca} Back     alignment and structure
>3fmb_A Dimeric protein of unknown function and ferredoxi fold; YP_212648.1, stress responsive A/B barrel domain; HET: MSE; 1.85A {Bacteroides fragilis} Back     alignment and structure
>3bde_A MLL5499 protein; stress responsive A/B barrel domain, structural genomics, JO center for structural genomics, JCSG; 1.79A {Mesorhizobium loti} Back     alignment and structure
>2ftr_A BH0200; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.40A {Bacillus halodurans} SCOP: d.58.4.15 Back     alignment and structure
>3hf5_A 4-methylmuconolactone methylisomerase; ferredoxin, ferredoxin-like fold, beta-barrel, biodegradation, ortho- cleavage; HET: 3ML; 1.40A {Pseudomonas reinekei} SCOP: d.58.4.19 PDB: 3hds_A* 3hfk_A* 2ifx_A* Back     alignment and structure
>1y0h_A Hypothetical protein RV0793; ferredoxin-like fold, alpha+beta sandwich with antiparallel sheet, structural genomics, PSI; 1.60A {Mycobacterium tuberculosis} SCOP: d.58.4.11 Back     alignment and structure
>3kkf_A Putative antibiotic biosynthesis monooxygenase; structural genomics, joint center for structural genomics, JCSG; HET: MSE P6G; 1.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fb0_A Conserved hypothetical protein; SAD, bacteroides thetaiotaom structural genomics, PSI, protein structure initiative; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gz7_A Putative antibiotic biosynthesis monooxygenase; NP_888398.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 2.15A {Bordetella bronchiseptica} Back     alignment and structure
>2pd1_A Hypothetical protein; unknown function, NE2512 protein, structural genomics, APC72 2, protein structure initiative; 1.86A {Nitrosomonas europaea} SCOP: d.58.4.11 Back     alignment and structure
>2bbe_A Hypothetical protein SO0527; MCSG, structural genomics, PSI, protein structure in midwest center for structural genomics; 1.97A {Shewanella oneidensis} Back     alignment and structure
>3e8o_A Uncharacterized protein with erredoxin-like fold; putative antibiotic biosynthesis monooxygenase; HET: MSE; 1.40A {Deinococcus radiodurans} Back     alignment and structure
>2gff_A LSRG protein; dimeric alpha+beta barrel ferredoxin fold, sugar binding protein; 1.75A {Yersinia pestis} PDB: 3qmq_A Back     alignment and structure
>2jdj_A HAPK, REDY-like protein; prodigiosin, biosynthesis, biosynthetic protein; 2.00A {Hahella chejuensis} Back     alignment and structure
>3bm7_A Protein of unknown function with ferredoxin-like; ferredoxin-like fold, antibiotic biosynthesis monooxygenase, structural genomics; HET: MSE; 1.35A {Caulobacter crescentus} Back     alignment and structure
>1iuj_A Hypothetical protein TT1380; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.60A {Thermus thermophilus} SCOP: d.58.4.5 Back     alignment and structure
>1q8b_A Protein YJCS; structural genomics, PSI, protein structure initiative, MIDW center for structural genomics, MCSG, unknown function; 1.90A {Bacillus subtilis} SCOP: d.58.4.6 Back     alignment and structure
>4dpo_A Conserved protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.73A {Methanosarcina mazei} Back     alignment and structure
>1x7v_A PA3566 protein, APC5058; structural genomics, protein structure initiative, midwest center for structural genomics, alpha-beta plait, PSI; 1.78A {Pseudomonas aeruginosa} SCOP: d.58.4.11 Back     alignment and structure
>3kg0_A Snoab; polyketide, anthracycline, oxygenase, cofactor-independent, oxidoreductase; 1.70A {Streptomyces nogalater} PDB: 3kg1_A 3kng_A Back     alignment and structure
>4dn9_A Antibiotic biosynthesis monooxygenase; structural genomics,protein structure initiative, NEW YORK S genomix research consortium, nysgrc; 2.05A {Chloroflexus aurantiacus} Back     alignment and structure
>2omo_A DUF176; structural genomics, APC6266, PSI-2, protein structure initi midwest center for structural genomics, MCSG, oxidoreductas; HET: MSE; 1.83A {Nitrosomonas europaea} SCOP: d.58.4.11 Back     alignment and structure
>3bf4_A Ethyl TERT-butyl ether degradation ETHD protein; ferredoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 2.10A {Ralstonia eutropha JMP134} Back     alignment and structure
>1tuv_A Protein YGIN; menadione oxidase, monooxygenase, CO-crystal with natural PR ferredoxin fold, unknown function; HET: VK3; 1.70A {Escherichia coli} SCOP: d.58.4.11 PDB: 1r6y_A Back     alignment and structure
>4hl9_A Antibiotic biosynthesis monooxygenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.93A {Rhodospirillum rubrum} Back     alignment and structure
>2zdo_A Heme-degrading monooxygenase ISDG; ruffling, protein-substrate complex, cytoplasm, iron, metal-binding, oxidoreductase; HET: HEM; 1.80A {Staphylococcus aureus} PDB: 1xbw_A Back     alignment and structure
>3f44_A Putative monooxygenase; YP_193413.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.55A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1tz0_A Hypothetical protein; structural genomics, protein structure initiative, MCSG, HYP protein, PSI; 1.84A {Bacillus cereus atcc 14579} SCOP: d.58.4.5 Back     alignment and structure
>1sqe_A Hypothetical protein PG130; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Staphylococcus aureus} SCOP: d.58.4.5 PDB: 2zdp_A* 3lgm_A* 3lgn_A* 3qgp_A* Back     alignment and structure
>3hx9_A Protein RV3592; DI-heme, beta barrel, dimer, oxidoreductase; HET: HEM; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>2ril_A Antibiotic biosynthesis monooxygenase; YP_001095275.1, putative monooxygenase, antibiotic biosynthe monooxygenase, structural genomics; HET: MSE; 1.26A {Shewanella loihica} Back     alignment and structure
>3tvz_A Putative uncharacterized protein YHGC; putative monooxygenase, ABM family, ferredoxin fold, monooxy oxidoreductase; 2.00A {Bacillus subtilis subsp} Back     alignment and structure
>2go8_A Hypothetical protein YQJZ; SR435, protein structure, structural genomics, PSI, protein initiative, northeast structural genomics consortium; 2.30A {Bacillus subtilis} SCOP: d.58.4.5 Back     alignment and structure
>3fgv_A Uncharacterized protein with ferredoxin-like fold; phosphoserine aminotransferase SERC, structural genomics; HET: MSE; 1.30A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lo3_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.38A {Colwellia psychrerythraea} SCOP: d.58.4.0 Back     alignment and structure
>3fj2_A Monooxygenase-like protein; structural genomics, joint cente structural genomics, JCSG, protein structure initiative, PS unknown function; HET: MSE; 1.85A {Listeria innocua} PDB: 3fez_A* Back     alignment and structure
>2fiu_A Conserved hypothetical protein; alpha-beta, dimeric alpha-beta barrels, structural genomics, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.58.4.16 Back     alignment and structure
>3f44_A Putative monooxygenase; YP_193413.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.55A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1lq9_A Actva-ORF6 monooxygenase; aromatic polyketides, actinorhodin, dihydroka streptomyces coelicolor, oxidoreductase; HET: PG4; 1.30A {Streptomyces coelicolor} SCOP: d.58.4.3 PDB: 1n5q_A* 1n5s_A* 1n5t_A* 1n5v_A* Back     alignment and structure
>3hhl_A RPA0582; alpha-beta-barrel, structural genomics, PSI-2, protein struc initiative, reductive methylation; HET: MLY MLZ PGE 2PE PE8 1PE PG4; 2.65A {Rhodopseudomonas palustris} PDB: 3hhl_B* 3hhl_C* 3dca_A Back     alignment and structure
>3mcs_A Putative monooxygenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.55A {Fusobacterium nucleatum subsp} Back     alignment and structure
>3mcs_A Putative monooxygenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.55A {Fusobacterium nucleatum subsp} Back     alignment and structure
>4ae5_A Signal transduction protein trap; signaling protein, phosphorylation, RNAIII, quorum SENS biofilm, toxin production; 1.85A {Staphylococcus aureus} Back     alignment and structure
>2cvi_A 75AA long hypothetical regulatory protein ASNC; structural genomics, unknown function; 1.50A {Pyrococcus horikoshii} PDB: 2z4p_A 2e1a_A Back     alignment and structure
>2djw_A Probable transcriptional regulator, ASNC family; structural genomics, thermus thermophilus HB8, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1vq3_A Phosphoribosylformylglycinamidine synthase, PURS; TM1244, PURS SUB 6.3.5.3), structural genomics, joint center for structural JCSG; 1.90A {Thermotoga maritima} SCOP: d.284.1.1 PDB: 3d54_B* Back     alignment and structure
>2zbc_A 83AA long hypothetical transcriptional regulator; SARD; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1gtd_A MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum} SCOP: d.284.1.1 Back     alignment and structure
>2dgb_A Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_A Back     alignment and structure
>2zw2_A Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1rjja_111 d.58.4.4 (A:) Hypothetical protein AT5G22580 {Thal 1e-27
d1q4ra_103 d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Th 2e-21
d1tr0a_106 d.58.4.4 (A:) Boiling stable protein 1 {European a 9e-19
>d1rjja_ d.58.4.4 (A:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Dimeric alpha+beta barrel
family: Plant stress-induced protein
domain: Hypothetical protein AT5G22580
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 95.8 bits (238), Expect = 1e-27
 Identities = 66/107 (61%), Positives = 79/107 (73%)

Query: 8   AMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFL 67
           A   FKHLV+VKFKE   V++I+KG++ LVS+ID VKSFEWG+D E  +MLRQGFTHAF 
Sbjct: 2   ATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFS 61

Query: 68  MTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKAPAA 114
           MTF  K+ Y  F SHP HVEFSA F+A I+KIVLLDFP    K+   
Sbjct: 62  MTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVV 108
>d1q4ra_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 103 Back     information, alignment and structure
>d1tr0a_ d.58.4.4 (A:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1rjja_111 Hypothetical protein AT5G22580 {Thale cress (Arabi 100.0
d1tr0a_106 Boiling stable protein 1 {European aspen (Populus 100.0
d1q4ra_103 Hypothetical protein AT3G17210.1 {Thale cress (Ara 100.0
d2ftra1103 Hypothetical protein BH0200 {Bacillus halodurans [ 98.81
d2omoa198 Hypothetical protein NE0621 {Nitrosomonas europaea 98.43
d2pd1a1100 Hypothetical protein NE2512 {Nitrosomonas europaea 98.21
d1x7va_98 Hypothetical protein PA3566 {Pseudomonas aeruginos 97.97
d1tuva_103 Hypothetical protein YgiN {Escherichia coli [TaxId 97.97
d1iuja_102 Hypothetical protein TT1380 {Thermus thermophilus 97.88
d1y0ha_101 Hypothetical protein Rv0793 {Mycobacterium tubercu 97.83
d1q8ba_93 Hypothetical protein YjcS {Bacillus subtilis [TaxI 97.32
d2go8a1108 Hypothetical protein YqjZ {Bacillus subtilis [TaxI 97.12
d1tz0a_108 Hypothetical protein BC2969 {Bacillus cereus [TaxI 97.04
d2zdpa1109 Hypothetical protein PG130 (SAV0165) {Staphylococc 97.0
d2fiua195 Hypothetical protein Atu0297 {Agrobacterium tumefa 96.86
d1xbwa_109 Hypothetical protein IsdG {Staphylococcus aureus [ 95.25
d1vq3a_86 PurS subunit of FGAM synthetase {Thermotoga mariti 90.23
d2cg4a286 Regulatory protein AsnC {Escherichia coli [TaxId: 89.89
d1lq9a_112 Actinorhodin biosynthesis monooxygenase ActVa-Orf6 89.36
d1i1ga280 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.94
d2pgca1206 Uncharacterized protein GOS_2596953 {environmental 87.15
d2cyya286 Putative transcriptional regulator PH1519 {Archaeo 86.66
d2cfxa277 Transcriptional regulator LrpC {Bacillus subtilis 84.74
d1t4aa_80 PurS subunit of FGAM synthetase {Bacillus subtilis 84.07
>d1rjja_ d.58.4.4 (A:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Dimeric alpha+beta barrel
family: Plant stress-induced protein
domain: Hypothetical protein AT5G22580
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=2.4e-33  Score=181.59  Aligned_cols=102  Identities=64%  Similarity=1.052  Sum_probs=96.5

Q ss_pred             cCCcEEEEEEEEecCCCCHHHHHHHHHHchhcCCcEeEEEeecccCChhhhcCcccEEEEEEECCHHhHHHhhcChhHHH
Q 033664            8 AMGEFKHLVIVKFKEGVVVEDIVKGMKKLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVE   87 (114)
Q Consensus         8 ~~~mi~HiVlfk~k~~~~~~~~~~~l~~L~~~iP~v~~~~~G~~~~s~~~~~~~~~~~l~~~F~s~~al~~Y~~hP~H~~   87 (114)
                      |+.+++|||+||||++++.+++.+.+.+|+++||||+++.+|+|..++++++++|||+|+++|+|++++++|+.||.|++
T Consensus         2 ~~~~~~HiVlfklk~~~~~e~i~~~l~~L~~~Ip~i~~~~~G~~~~~~~~~~~~~d~~l~~~F~~~e~l~~Y~~hP~H~~   81 (111)
T d1rjja_           2 ATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVE   81 (111)
T ss_dssp             CSSEEEEEEEEECSSCCCHHHHHHHHHHHHGGGGGSCEEEEEEECCSCTTTSTTCCEEEEEEESSHHHHHHHHTSHHHHH
T ss_pred             CCCceEEEEEEEECCCCCHHHHHHHHHHHHhcCccceEEEEeccCCCcccccCCccEEEEEEEcCHHHHHHHhCCHhHHH
Confidence            56899999999999999999999999999999999999999999855666789999999999999999999999999999


Q ss_pred             HHHHHHhhhhceEEEeeecCCC
Q 033664           88 FSATFSAAIEKIVLLDFPTVLG  109 (114)
Q Consensus        88 ~~~~~~p~~~~~~v~D~~~~~~  109 (114)
                      +++.++|++++++++||+...+
T Consensus        82 ~~~~~~p~~~~~~v~Df~~~~v  103 (111)
T d1rjja_          82 FSAAFTAVIDKIVLLDFPVAAV  103 (111)
T ss_dssp             HHHHHHHTCSEEEEEEEEECTT
T ss_pred             HHHHHHHHhcceEEEeEEcccc
Confidence            9999999999999999999965
>d1tr0a_ d.58.4.4 (A:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]} Back     information, alignment and structure
>d1q4ra_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ftra1 d.58.4.15 (A:4-106) Hypothetical protein BH0200 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2omoa1 d.58.4.11 (A:1-98) Hypothetical protein NE0621 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2pd1a1 d.58.4.11 (A:1-100) Hypothetical protein NE2512 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1x7va_ d.58.4.11 (A:) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tuva_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuja_ d.58.4.5 (A:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y0ha_ d.58.4.11 (A:) Hypothetical protein Rv0793 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q8ba_ d.58.4.6 (A:) Hypothetical protein YjcS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2go8a1 d.58.4.5 (A:3-110) Hypothetical protein YqjZ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tz0a_ d.58.4.5 (A:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2zdpa1 d.58.4.5 (A:0-108) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fiua1 d.58.4.16 (A:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xbwa_ d.58.4.5 (A:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vq3a_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cg4a2 d.58.4.2 (A:67-152) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lq9a_ d.58.4.3 (A:) Actinorhodin biosynthesis monooxygenase ActVa-Orf6 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1i1ga2 d.58.4.2 (A:62-141) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pgca1 d.58.4.23 (A:1-206) Uncharacterized protein GOS_2596953 {environmental samples} Back     information, alignment and structure
>d2cyya2 d.58.4.2 (A:65-150) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cfxa2 d.58.4.2 (A:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t4aa_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure