Citrus Sinensis ID: 033679


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MTSIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTVDRGSQLFVARATRREVSCEANQT
ccEEcEEEEEEEEcccHHccccccEEEEcccccccccccccHHHHHHHHcccEEEEEccccccEEEEcccccHHHHHHHHccccEEcccHHHHHHHHHccccccccccccccc
cccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHHHccEEccccccccEEEEEccccHHHHHHHHHcccEEccccHHHHHHHHHHccccccEEEEcccc
MTSIGWVLIFFCTengqrevlkgcklvfshafpskfpaHIHYLWKVVEQLGAtcsieldpsvthvvsnkcsnekvslgskggqvfggstvdrGSQLFVARATRREVSCEANQT
MTSIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEkvslgskggqvfggstvdrgsqlfvaratrrevsceanqt
MTSIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTVDRGSQLFVARATRREVSCEANQT
***IGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKC**************F**********LFV***************
**SIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTVDRGSQLFVARATRRE*SC*****
MTSIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTVDRGSQLFVARATR**********
*TSIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTVDRGSQLFVARATRREVSCEA***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSIGWVLIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTVDRGSQLFVARATRREVSCEANQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
Q00IB6440 RNA polymerase II C-termi yes no 0.513 0.131 0.551 2e-13
Q8LL041241 RNA polymerase II C-termi no no 0.530 0.048 0.442 1e-10
>sp|Q00IB6|CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana GN=CPL4 PE=1 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query: 17  QREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEK 74
           ++E+LKGCK+VFS  FP+K     H LWK+ E+LGATC+ E+D SVTHVV+     EK
Sbjct: 338 RKEILKGCKIVFSRVFPTKAKPEDHPLWKMAEELGATCATEVDASVTHVVAMDVGTEK 395




Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q8LL04|CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana GN=CPL3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
255570505 478 RNA polymerase II ctd phosphatase, putat 0.513 0.121 0.637 2e-15
296090640 264 unnamed protein product [Vitis vinifera] 0.513 0.219 0.637 4e-15
359494894 278 PREDICTED: RNA polymerase II C-terminal 0.513 0.208 0.637 5e-15
147774299 641 hypothetical protein VITISV_002430 [Viti 0.513 0.090 0.620 6e-15
296088193 638 unnamed protein product [Vitis vinifera] 0.513 0.090 0.620 6e-15
359497210 278 PREDICTED: RNA polymerase II C-terminal 0.513 0.208 0.620 1e-14
224142399 312 predicted protein [Populus trichocarpa] 0.592 0.214 0.567 1e-14
449532013 340 PREDICTED: LOW QUALITY PROTEIN: RNA poly 0.495 0.164 0.660 4e-14
224142401 266 predicted protein [Populus trichocarpa] 0.513 0.218 0.620 5e-14
449447765 452 PREDICTED: RNA polymerase II C-terminal 0.495 0.123 0.660 1e-13
>gi|255570505|ref|XP_002526210.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] gi|223534449|gb|EEF36151.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/58 (63%), Positives = 47/58 (81%)

Query: 17  QREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEK 74
           +++VLKGCK+VFS  FP++F A  H+LWK+ EQLGATCS E+DPSVTHVVS +   EK
Sbjct: 379 RKDVLKGCKIVFSRVFPTQFQADNHHLWKMAEQLGATCSREVDPSVTHVVSAEAGTEK 436




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296090640|emb|CBI41034.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494894|ref|XP_003634864.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774299|emb|CAN76945.1| hypothetical protein VITISV_002430 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088193|emb|CBI35709.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359497210|ref|XP_003635453.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142399|ref|XP_002324546.1| predicted protein [Populus trichocarpa] gi|222865980|gb|EEF03111.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449532013|ref|XP_004172979.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal domain phosphatase-like 4-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|224142401|ref|XP_002324547.1| predicted protein [Populus trichocarpa] gi|222865981|gb|EEF03112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449447765|ref|XP_004141638.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
TAIR|locus:4010714056440 CPL4 "C-terminal domain phosph 0.513 0.131 0.551 9.9e-13
TAIR|locus:20511641241 CPL3 "C-terminal domain phosph 0.530 0.048 0.442 1.1e-09
TAIR|locus:4010714056 CPL4 "C-terminal domain phosphatase-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 176 (67.0 bits), Expect = 9.9e-13, P = 9.9e-13
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query:    17 QREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEK 74
             ++E+LKGCK+VFS  FP+K     H LWK+ E+LGATC+ E+D SVTHVV+     EK
Sbjct:   338 RKEILKGCKIVFSRVFPTKAKPEDHPLWKMAEELGATCATEVDASVTHVVAMDVGTEK 395




GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0008022 "protein C-terminus binding" evidence=IPI
GO:0009651 "response to salt stress" evidence=IEP
TAIR|locus:2051164 CPL3 "C-terminal domain phosphatase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
smart0029278 smart00292, BRCT, breast cancer carboxy-terminal d 7e-05
pfam1273863 pfam12738, PTCB-BRCT, twin BRCT domain 0.002
>gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain Back     alignment and domain information
 Score = 38.1 bits (89), Expect = 7e-05
 Identities = 13/61 (21%), Positives = 25/61 (40%), Gaps = 4/61 (6%)

Query: 18 REVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELD-PSVTHVVSNKCSNEKVS 76
           ++ KG     + +F  +       L +++E LG   +  L   + THV+       K+ 
Sbjct: 1  PKLFKGKTFYITGSFDKE---ERDELKELIEALGGKVTSSLSSKTTTHVIVGSPEGGKLE 57

Query: 77 L 77
          L
Sbjct: 58 L 58


Length = 78

>gnl|CDD|193214 pfam12738, PTCB-BRCT, twin BRCT domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
PF1273863 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W 99.78
PF0053378 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP 99.72
KOG0323635 consensus TFIIF-interacting CTD phosphatases, incl 99.67
smart0029280 BRCT breast cancer carboxy-terminal domain. 99.65
cd0002772 BRCT Breast Cancer Suppressor Protein (BRCA1), car 99.63
KOG3226 508 consensus DNA repair protein [Replication, recombi 99.61
PLN03123 981 poly [ADP-ribose] polymerase; Provisional 99.23
PLN03122 815 Poly [ADP-ribose] polymerase; Provisional 99.2
KOG1929 811 consensus Nucleotide excision repair factor NEF2, 98.74
KOG1929 811 consensus Nucleotide excision repair factor NEF2, 98.72
PRK14350669 ligA NAD-dependent DNA ligase LigA; Provisional 98.51
PRK06063313 DNA polymerase III subunit epsilon; Provisional 98.48
PRK06195309 DNA polymerase III subunit epsilon; Validated 98.39
COG5275276 BRCT domain type II [General function prediction o 98.32
TIGR00575652 dnlj DNA ligase, NAD-dependent. The member of this 98.3
PRK14351689 ligA NAD-dependent DNA ligase LigA; Provisional 98.27
PRK07956665 ligA NAD-dependent DNA ligase LigA; Validated 98.21
KOG3524 850 consensus Predicted guanine nucleotide exchange fa 98.18
COG0272667 Lig NAD-dependent DNA ligase (contains BRCT domain 98.07
KOG0966 881 consensus ATP-dependent DNA ligase IV [Replication 97.96
KOG3548 1176 consensus DNA damage checkpoint protein RHP9/CRB2/ 97.94
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 97.75
KOG2043 896 consensus Signaling protein SWIFT and related BRCT 97.69
KOG2481 570 consensus Protein required for normal rRNA process 97.38
COG5163 591 NOP7 Protein required for biogenesis of the 60S ri 97.25
KOG3524 850 consensus Predicted guanine nucleotide exchange fa 96.76
PRK05601377 DNA polymerase III subunit epsilon; Validated 92.57
KOG0966881 consensus ATP-dependent DNA ligase IV [Replication 90.99
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 85.6
COG1105310 FruK Fructose-1-phosphate kinase and related fruct 81.32
>PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A Back     alignment and domain information
Probab=99.78  E-value=4.2e-19  Score=109.22  Aligned_cols=63  Identities=21%  Similarity=0.203  Sum_probs=54.1

Q ss_pred             cEEEEccccCCCCCccchHHHHHHHhcCCEEEeeeCCCccEEEecCCCcHHHHHHHhCCCeecCcch
Q 033679           24 CKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKGGQVFGGSTV   90 (113)
Q Consensus        24 c~I~fSg~~p~~~~~~~~~l~~~a~~lGA~~~~~l~~~vTHlV~~~~~t~K~~~A~k~gi~IV~p~W   90 (113)
                      |+|+|||+.|.    ++..++++++++||++..+++.++||||+.+..++||+.|.++||+||+|+|
T Consensus         1 ~~i~~sg~~~~----~~~~l~~~i~~~Gg~~~~~lt~~~THLI~~~~~~~K~~~A~~~gi~vV~~~W   63 (63)
T PF12738_consen    1 VVICFSGFSGK----ERSQLRKLIEALGGKYSKDLTKKTTHLICSSPEGKKYRKAKEWGIPVVSPDW   63 (63)
T ss_dssp             -EEEEEEB-TT----TCCHHHHHHHCTT-EEESSSSTT-SEEEEES--HHHHHHHHHCTSEEEEHHH
T ss_pred             CEEEECCCCHH----HHHHHHHHHHHCCCEEeccccCCceEEEEeCCCcHHHHHHHHCCCcEECCCC
Confidence            68999998764    4669999999999999999999999999999999999999999999999999



>PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>smart00292 BRCT breast cancer carboxy-terminal domain Back     alignment and domain information
>cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain Back     alignment and domain information
>KOG3226 consensus DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PLN03123 poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>PLN03122 Poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] Back     alignment and domain information
>KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] Back     alignment and domain information
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG5275 BRCT domain type II [General function prediction only] Back     alignment and domain information
>TIGR00575 dnlj DNA ligase, NAD-dependent Back     alignment and domain information
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated Back     alignment and domain information
>KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] Back     alignment and domain information
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] Back     alignment and domain information
>KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 3e-16
3ef1_A442 RNA polymerase II subunit A C-terminal domain phos 3e-15
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 6e-08
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 5e-07
3olc_X 298 DNA topoisomerase 2-binding protein 1; BRCT domain 6e-06
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 8e-06
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 1e-05
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 4e-05
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 1e-04
1l0b_A 229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 4e-04
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
 Score = 71.8 bits (175), Expect = 3e-16
 Identities = 19/68 (27%), Positives = 31/68 (45%)

Query: 17  QREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVS 76
           +++VLKGC+L+FS   P         + K     GA   ++     TH+++ K   EKV 
Sbjct: 279 KQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVK 338

Query: 77  LGSKGGQV 84
                G +
Sbjct: 339 KAVSMGNI 346


>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
3ef1_A442 RNA polymerase II subunit A C-terminal domain phos 99.96
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 99.95
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 99.94
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 99.92
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 99.92
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 99.92
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 99.91
4id3_A92 DNA repair protein REV1; BRCT domain, protein bind 99.89
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 99.86
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 99.85
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 99.83
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 99.82
1l0b_A 229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 99.81
2nte_A 210 BARD-1, BRCA1-associated ring domain protein 1; BR 99.79
1t15_A 214 Breast cancer type 1 susceptibility protein; prote 99.78
3sqd_A 219 PAX-interacting protein 1; tandem BRCT domains, ce 99.77
2etx_A 209 Mediator of DNA damage checkpoint protein 1; tande 99.76
3al2_A 235 DNA topoisomerase 2-binding protein 1; BRCT domain 99.71
3olc_X 298 DNA topoisomerase 2-binding protein 1; BRCT domain 99.7
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 99.68
2jw5_A106 DNA polymerase lambda; BRCT domain, family X polym 99.66
3l41_A 220 BRCT-containing protein 1; BRC1, BRCT domain, tand 99.64
1kzy_C 259 Tumor suppressor P53-binding protein 1; tandem-BRC 99.59
2vxb_A 241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 99.56
3ii6_X 263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 99.54
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 99.52
1l7b_A92 DNA ligase; BRCT, autostructure, structural genomi 99.48
2k6g_A109 Replication factor C subunit 1; protein, BRCT, DNA 99.44
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 99.39
2ebu_A112 Replication factor C subunit 1; A/B/A 3 layers, pa 99.39
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 99.36
2coe_A120 Deoxynucleotidyltransferase, terminal variant; BRC 99.35
2cok_A113 Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r 99.32
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 99.28
1t15_A214 Breast cancer type 1 susceptibility protein; prote 99.26
1z56_C 264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 99.22
3pc7_A88 DNA ligase 3; DNA repair, BRCT domain, protein:pro 99.13
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 99.03
2dun_A133 POL MU, DNA polymerase MU; layers A/B/A, parallel 99.02
2etx_A209 Mediator of DNA damage checkpoint protein 1; tande 99.01
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 98.95
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 98.86
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 98.51
1dgs_A667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 98.49
2owo_A671 DNA ligase; protein-DNA complex, ligase-DNA comple 98.47
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 98.42
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 98.12
3t7k_A 256 RTT107, regulator of TY1 transposition protein 107 97.99
3huf_A 325 DNA repair and telomere maintenance protein NBS1; 97.94
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 97.86
2l42_A106 DNA-binding protein RAP1; BRCT domain, protein bin 97.32
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 96.96
3qbz_A160 DDK kinase regulatory subunit DBF4; FHA domain,RAD 96.95
3oq0_A151 DBF4, protein DNA52; DDK, BRCT, RAD53, replication 96.88
3oq4_A134 DBF4, protein DNA52; DDK, BRCT, RAD53, replication 96.64
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=99.96  E-value=1.7e-29  Score=205.42  Aligned_cols=102  Identities=20%  Similarity=0.161  Sum_probs=98.3

Q ss_pred             hHHHHHHhhhhcCCCCcEEEEccccCCCCCccchHHHHHHHhcCCEEEeeeCCCccEEEecCCCcHHHHHHHhC-CCeec
Q 033679            8 LIFFCTENGQREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSKG-GQVFG   86 (113)
Q Consensus         8 ~~~~il~~~k~~vL~Gc~I~fSg~~p~~~~~~~~~l~~~a~~lGA~~~~~l~~~vTHlV~~~~~t~K~~~A~k~-gi~IV   86 (113)
                      =|+.|||++|+++|+||+|||||++|.+.++++..++++++++||+++.+++++||||||.+.+|.|+++|+++ ||+||
T Consensus       340 Dv~~il~~~k~~~L~G~~IvfSG~~p~~~~~~r~~l~~~~~~lGa~~~~~vs~~vTHLVa~~~~t~K~~~A~~~g~IkIV  419 (442)
T 3ef1_A          340 NVGLIIPKMKQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVV  419 (442)
T ss_dssp             CHHHHHHHHHHTTSTTCEEEEESSSCTTSCSTTSHHHHHHHTTTCEECSSSSSCCSEEEECSCCCHHHHHHHHHSSSEEE
T ss_pred             cHHHHHHHHhhcccCCcEEEEecccCCCCCccHHHHHHHHHHcCCEEeCCCCCCceEEEeCCCCCHHHHHHHhcCCCEEE
Confidence            48899999999999999999999999988889999999999999999999999999999999999999999998 59999


Q ss_pred             CcchHHHHHHhhCCCCCCceecc
Q 033679           87 GSTVDRGSQLFVARATRREVSCE  109 (113)
Q Consensus        87 ~p~WL~~c~~~w~r~dE~~y~~~  109 (113)
                      +|+||++|..+|+|+||++|++.
T Consensus       420 s~~WL~dcl~~~krldE~~YlLy  442 (442)
T 3ef1_A          420 KLNWLTESLSQWKRLPESDYLLY  442 (442)
T ss_dssp             EHHHHHHHHHHTSCCCGGGTBCC
T ss_pred             eHHHHHHHHHcCCcCChhccccC
Confidence            99999999999999999999974



>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 Back     alignment and structure
>2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} Back     alignment and structure
>3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1t15a1109 c.15.1.3 (A:1649-1757) Breast cancer associated pr 0.002
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: BRCT domain
superfamily: BRCT domain
family: BRCT domain
domain: Breast cancer associated protein, BRCA1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 33.1 bits (75), Expect = 0.002
 Identities = 8/44 (18%), Positives = 14/44 (31%)

Query: 37 PAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSK 80
          P     ++K   +   T +  +    THVV    +        K
Sbjct: 11 PEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLK 54


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1wf6a_132 DNA topoisomerase II binding protein 1, TopBP1 {Hu 99.86
d1cdza_96 DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta 99.86
d1t15a1109 Breast cancer associated protein, BRCA1 {Human (Ho 99.84
d1t15a2102 Breast cancer associated protein, BRCA1 {Human (Ho 99.84
d1l7ba_92 NAD+-dependent DNA ligase, domain 4 {Thermus therm 99.55
d1in1a_88 DNA ligase III alpha {Human (Homo sapiens) [TaxId: 99.49
d1kzyc1153 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1l0ba297 Breast cancer associated protein, BRCA1 {Rat (Ratt 98.22
d1kzyc2106 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1li4a2 267 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.13
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: BRCT domain
superfamily: BRCT domain
family: DNA topoisomerase II binding protein 1, TopBP1
domain: DNA topoisomerase II binding protein 1, TopBP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=4.2e-22  Score=136.03  Aligned_cols=90  Identities=14%  Similarity=0.146  Sum_probs=79.8

Q ss_pred             hhcCCCCcEEEEccccCCCCCccchHHHHHHHhcCCEEEeeeCCCccEEEecCCCcHHHHHHHh--CCCeecCcchHHHH
Q 033679           17 QREVLKGCKLVFSHAFPSKFPAHIHYLWKVVEQLGATCSIELDPSVTHVVSNKCSNEKVSLGSK--GGQVFGGSTVDRGS   94 (113)
Q Consensus        17 k~~vL~Gc~I~fSg~~p~~~~~~~~~l~~~a~~lGA~~~~~l~~~vTHlV~~~~~t~K~~~A~k--~gi~IV~p~WL~~c   94 (113)
                      ...+|+||+|+|||. +   ..++..|.+++..+||++...++++|||||+.+..+.+++.+.+  .+++||+|+||++|
T Consensus        37 ~~~~f~G~~i~isGf-~---~~~~~~l~~~i~~~GG~~~~~~~~~vTHvIv~~~~~~~~~~~~~~~~~i~iV~~~Wl~~c  112 (132)
T d1wf6a_          37 PEDLLDGCRIYLCGF-S---GRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVVGAKWLLEC  112 (132)
T ss_dssp             CTTTTTTCEEEEESC-C---SHHHHHHHHHHHHTTCEEESSCCSSCCEEEESSCCSHHHHHHHHSCCCCCEEEHHHHHHH
T ss_pred             chhhhCCeEEEEeeC-C---CHHHHHHHHHHHHcCCEEecccCCCceEEEecCCCccHHHHHHHhcCCCCcCCHHHHHHH
Confidence            356799999999995 3   25788999999999999999999999999999998888776544  47999999999999


Q ss_pred             HHhhCCCCCCceeccC
Q 033679           95 QLFVARATRREVSCEA  110 (113)
Q Consensus        95 ~~~w~r~dE~~y~~~~  110 (113)
                      ..+++++||++|.+..
T Consensus       113 ~~~~~~l~~~~Y~~~~  128 (132)
T d1wf6a_         113 FSKGYMLSEEPYIHSG  128 (132)
T ss_dssp             HHHSSCCCSGGGBCCC
T ss_pred             HHcCCcCCHHhCcCCC
Confidence            9999999999999854



>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure