Citrus Sinensis ID: 033691

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MYLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLEP
ccccHHHHHHHHHHHccccHHHHHHHcccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHcccccEEEEEEcc
ccccHHHHHHHHHHHccccHHHHHHHcccccHHHccccHHHHHHHHHHHHHHHccHcHHHHHHHHHHHHEHHHHccccccccccccccHHHHHHHHHHHHccccEEEEEEccc
MYLSIKDVGLWLEEINLGGYRqifkengvngeylegmsmFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLkgeqkvrrpwwapsclSVVFVKVAKRNRQSRVVSLKLEP
MYLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLkgeqkvrrpwwapscLSVVFvkvakrnrqsrvvslklep
MYLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLEP
**LSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAK**************
*YLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKL**
MYLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRN************
MYLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
P18160 2410 Dual specificity protein yes no 0.283 0.013 0.468 0.0007
>sp|P18160|SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum GN=splA PE=1 SV=3 Back     alignment and function desciption
 Score = 42.7 bits (99), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 24/32 (75%)

Query: 7    DVGLWLEEINLGGYRQIFKENGVNGEYLEGMS 38
            DV +WLE  N G YR+ F++N ++G +LEG++
Sbjct: 1738 DVAIWLESFNYGQYRKNFRDNNISGRHLEGIT 1769
Essential for spore differentiation.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: 0EC: .EC: 2

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
449444486125 PREDICTED: uncharacterized protein LOC10 0.973 0.88 0.954 8e-56
194239472125 downward leaf curling protein [Cucumis m 0.973 0.88 0.945 3e-55
225447590125 PREDICTED: uncharacterized protein LOC10 0.973 0.88 0.945 7e-55
224131826125 predicted protein [Populus trichocarpa] 0.973 0.88 0.918 5e-54
351724953125 uncharacterized protein LOC100499990 [Gl 0.973 0.88 0.918 8e-54
218186951162 hypothetical protein OsI_38513 [Oryza sa 0.973 0.679 0.9 2e-53
115488792125 Os12g0514600 [Oryza sativa Japonica Grou 0.973 0.88 0.9 3e-53
351725355125 uncharacterized protein LOC100527863 [Gl 0.973 0.88 0.909 3e-53
217075492125 unknown [Medicago truncatula] 0.973 0.88 0.909 6e-53
242085676137 hypothetical protein SORBIDRAFT_08g01657 0.973 0.802 0.872 1e-52
>gi|449444486|ref|XP_004140005.1| PREDICTED: uncharacterized protein LOC101220276 isoform 2 [Cucumis sativus] gi|449444488|ref|XP_004140006.1| PREDICTED: uncharacterized protein LOC101220276 isoform 3 [Cucumis sativus] gi|449475624|ref|XP_004154504.1| PREDICTED: uncharacterized protein LOC101230995 isoform 2 [Cucumis sativus] gi|449475628|ref|XP_004154505.1| PREDICTED: uncharacterized protein LOC101230995 isoform 3 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  220 bits (560), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 110/110 (100%)

Query: 4   SIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLC 63
           +++DVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLC
Sbjct: 16  TVEDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLC 75

Query: 64  KELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLEP 113
           KELRRIKVACLKGEQKVRRPWWAPSCLS+VF+KVAKRNRQSRVVSLKLEP
Sbjct: 76  KELRRIKVACLKGEQKVRRPWWAPSCLSMVFLKVAKRNRQSRVVSLKLEP 125

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|194239472|dbj|BAG55245.1| downward leaf curling protein [Cucumis melo] Back     alignment and taxonomy information
>gi|225447590|ref|XP_002272109.1| PREDICTED: uncharacterized protein LOC100244267 isoform 1 [Vitis vinifera] gi|296085001|emb|CBI28416.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131826|ref|XP_002321188.1| predicted protein [Populus trichocarpa] gi|222861961|gb|EEE99503.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351724953|ref|NP_001235284.1| uncharacterized protein LOC100499990 [Glycine max] gi|357495313|ref|XP_003617945.1| Downward leaf curling protein [Medicago truncatula] gi|255628361|gb|ACU14525.1| unknown [Glycine max] gi|355519280|gb|AET00904.1| Downward leaf curling protein [Medicago truncatula] gi|388507138|gb|AFK41635.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|218186951|gb|EEC69378.1| hypothetical protein OsI_38513 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115488792|ref|NP_001066883.1| Os12g0514600 [Oryza sativa Japonica Group] gi|108862741|gb|ABG22031.1| expressed protein [Oryza sativa Japonica Group] gi|113649390|dbj|BAF29902.1| Os12g0514600 [Oryza sativa Japonica Group] gi|215707153|dbj|BAG93613.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|351725355|ref|NP_001238625.1| uncharacterized protein LOC100527863 [Glycine max] gi|255633398|gb|ACU17056.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|217075492|gb|ACJ86106.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|242085676|ref|XP_002443263.1| hypothetical protein SORBIDRAFT_08g016570 [Sorghum bicolor] gi|241943956|gb|EES17101.1| hypothetical protein SORBIDRAFT_08g016570 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
TAIR|locus:2077347125 AT3G07760 "AT3G07760" [Arabido 0.964 0.872 0.908 5.1e-51
TAIR|locus:2077347 AT3G07760 "AT3G07760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 530 (191.6 bits), Expect = 5.1e-51, P = 5.1e-51
 Identities = 99/109 (90%), Positives = 104/109 (95%)

Query:     4 SIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLC 63
             +++DVG WLEEINLGGYRQIFKENGVNGEYLE MS+FTTEQIL FIRR HMKWGDFITLC
Sbjct:    16 TVEDVGSWLEEINLGGYRQIFKENGVNGEYLESMSVFTTEQILHFIRRHHMKWGDFITLC 75

Query:    64 KELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLE 112
             KELRRIKVACLKGEQ+VRRPWWAPSCLSVVFVK AKRNRQSRVVSLKLE
Sbjct:    76 KELRRIKVACLKGEQRVRRPWWAPSCLSVVFVKAAKRNRQSRVVSLKLE 124


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.326   0.140   0.450    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      113       113   0.00091  102 3  11 22  0.40    30
                                                     29  0.44    32


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  572 (61 KB)
  Total size of DFA:  130 KB (2082 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:01
  No. of threads or processors used:  24
  Search cpu time:  10.55u 0.07s 10.62t   Elapsed:  00:00:10
  Total cpu time:  10.55u 0.07s 10.62t   Elapsed:  00:00:11
  Start:  Fri May 10 00:01:20 2013   End:  Fri May 10 00:01:31 2013
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029139001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (125 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
cd0950666 cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 2e-05
cd0953462 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fun 4e-04
smart0045468 smart00454, SAM, Sterile alpha motif 0.001
cd0948756 cd09487, SAM_superfamily, SAM (Sterile alpha motif 0.002
cd0950572 cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins 0.002
cd0954666 cd09546, SAM_EPH-A5, SAM domain of EPH-A5 subfamil 0.002
pfam0764766 pfam07647, SAM_2, SAM domain (Sterile alpha motif) 0.004
>gnl|CDD|188905 cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 family proteins Back     alignment and domain information 
 Score = 38.8 bits (91), Expect = 2e-05
 Identities = 14/31 (45%), Positives = 23/31 (74%)

Query: 4  SIKDVGLWLEEINLGGYRQIFKENGVNGEYL 34
          ++ DVG WLE +NLG +R+ F +N ++G +L
Sbjct: 6  TVDDVGDWLESLNLGEHRERFMDNEIDGSHL 36

SAM (sterile alpha motif) domain of Shank1,2,3 family proteins is a protein-protein interaction domain. Shank1,2,3 proteins are scaffold proteins that are known to interact with a variety of cytoplasmic and membrane proteins. SAM domains of the Shank1,2,3 family are prone to homooligomerization. They are highly enriched in the postsynaptic density, acting as scaffolds to organize assembly of postsynaptic proteins. SAM domains of Shank3 proteins can form large sheets of helical fibers. Shank genes show distinct patterns of expression, in rat Shank1 mRNA is found almost exclusively in brain, Shank2 in brain, kidney and liver, and Shank3 in heart, brain and spleen. Length = 66
>gnl|CDD|188933 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fungal subfamily Back     alignment and domain information
>gnl|CDD|197735 smart00454, SAM, Sterile alpha motif Back     alignment and domain information
>gnl|CDD|188886 cd09487, SAM_superfamily, SAM (Sterile alpha motif ) Back     alignment and domain information
>gnl|CDD|188904 cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins Back     alignment and domain information
>gnl|CDD|188945 cd09546, SAM_EPH-A5, SAM domain of EPH-A5 subfamily of tyrosine kinase receptors Back     alignment and domain information
>gnl|CDD|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
PF0053664 SAM_1: SAM domain (Sterile alpha motif); InterPro: 99.62
PF0764766 SAM_2: SAM domain (Sterile alpha motif); InterPro: 99.56
cd0016663 SAM Sterile alpha motif.; Widespread domain in sig 99.54
smart0045468 SAM Sterile alpha motif. Widespread domain in sign 99.52
KOG4375272 consensus Scaffold protein Shank and related SAM d 98.39
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.23
KOG11701099 consensus Diacylglycerol kinase [Lipid transport a 98.02
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 97.45
PF0219884 SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; 96.95
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 96.64
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 96.05
smart0025182 SAM_PNT SAM / Pointed domain. A subfamily of the S 95.95
cd0875768 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed doma 95.91
cd0820366 SAM_PNT Sterile alpha motif (SAM)/Pointed domain. 95.42
KOG4384361 consensus Uncharacterized SAM domain protein [Gene 95.3
PF0923575 Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: 95.01
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 94.84
KOG0249 916 consensus LAR-interacting protein and related prot 92.92
cd0853568 SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed 92.88
cd0853276 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointe 92.78
cd0854075 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed doma 92.77
KOG1738 638 consensus Membrane-associated guanylate kinase-int 92.23
KOG4374216 consensus RNA-binding protein Bicaudal-C [RNA proc 92.09
cd0853666 SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed doma 91.83
cd0853371 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed 91.62
cd0853175 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointe 90.5
cd0854191 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed do 90.26
cd0853489 SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Point 90.23
cd0853878 SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Point 87.46
cd0854389 SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed do 87.26
cd0854288 SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed do 85.12
PF12979 351 DUF3863: Domain of Unknown Function with PDB struc 84.88
PF1028138 Ish1: Putative stress-responsive nuclear envelope 80.86
KOG3930 389 consensus Uncharacterized conserved protein [Funct 80.28
>PF00536 SAM_1: SAM domain (Sterile alpha motif); InterPro: IPR021129 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes Back     alignment and domain information 
Probab=99.62  E-value=1.5e-15  Score=93.77  Aligned_cols=63  Identities=29%  Similarity=0.481  Sum_probs=56.2

Q ss_pred             CCCHHHHHHHHHhcCcchHHHHhhhcCCchhhhhcccccchHHHHHHHHHhhhcchhHHHHHHHHHHHH
Q 033691            2 YLSIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIK   70 (113)
Q Consensus         2 ~WS~EDVa~WLeeiGLgqYre~Fk~N~IdG~~Li~Ltk~t~e~ilr~i~r~~~k~Gd~itl~~El~~ik   70 (113)
                      +|++++|++||+++||++|.+.|.+|.|+|+.|.+|    +++-|.-++.  .+.||+.++...|+++|
T Consensus         2 ~W~~~~V~~WL~~~~l~~y~~~F~~~~i~g~~L~~l----t~~dL~~lgi--~~~ghr~ki~~~i~~Lk   64 (64)
T PF00536_consen    2 EWSVEDVSEWLKSLGLEQYAENFEKNYIDGEDLLSL----TEEDLEELGI--TKLGHRKKILRAIQKLK   64 (64)
T ss_dssp             GTSHHHHHHHHHHTTGGGGHHHHHHTTSSHHHHTTS----CHHHHHHTT---SSHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHCCCHHHHHHHHcCCchHHHHHhc----CHHHHHHcCC--CCHHHHHHHHHHHHHhC
Confidence            699999999999999999999999999999999999    5555555666  78899999999999987

The SAM domain that spreads over around 70 residues is found in diverse eukaryotic organisms []. SAM domains have been shown to homo- and hetero-oligomerise, forming multiple self-association architectures and also binding to various non-SAM domain-containing proteins [], nevertheless with a low affinity constant []. SAM domains also appear to possess the ability to bind RNA []. Smaug, a protein that helps to establish a morphogen gradient in Drosophila embryos by repressing the translation of nanos (nos) mRNA, binds to the 3' untranslated region (UTR) of nos mRNA via two similar hairpin structures. The 3D crystal structure of the Smaug RNA-binding region shows a cluster of positively charged residues on the Smaug-SAM domain, which could be the RNA-binding surface. This electropositive potential is unique among all previously determined SAM-domain structures and is conserved among Smaug-SAM homologs. These results suggest that the SAM domain might have a primary role in RNA binding. Structural analyses show that the SAM domain is arranged in a small five-helix bundle with two large interfaces []. In the case of the SAM domain of EphB2, each of these interfaces is able to form dimers. The presence of these two distinct intermonomers binding surface suggest that SAM could form extended polymeric structures []. This entry represents type 1 SAM domains. ; PDB: 2KIV_A 3HIL_B 3KKA_A 3K1R_B 3SEN_B 3SEI_B 1V85_A 2KE7_A 2EAM_A 1WWV_A ....
>PF07647 SAM_2: SAM domain (Sterile alpha motif); InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes Back     alignment and domain information
>cd00166 SAM Sterile alpha motif Back     alignment and domain information
>smart00454 SAM Sterile alpha motif Back     alignment and domain information
>KOG4375 consensus Scaffold protein Shank and related SAM domain proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG1170 consensus Diacylglycerol kinase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF02198 SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; InterPro: IPR003118 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>smart00251 SAM_PNT SAM / Pointed domain Back     alignment and domain information
>cd08757 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed domain of ESE-like ETS transcriptional regulators Back     alignment and domain information
>cd08203 SAM_PNT Sterile alpha motif (SAM)/Pointed domain Back     alignment and domain information
>KOG4384 consensus Uncharacterized SAM domain protein [General function prediction only] Back     alignment and domain information
>PF09235 Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: IPR015316 The fungal Ste50p SAM domain consists of five helices, which form a compact, globular fold Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>cd08535 SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed domain of Tel/Yan protein Back     alignment and domain information
>cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor Back     alignment and domain information
>cd08540 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor Back     alignment and domain information
>KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4374 consensus RNA-binding protein Bicaudal-C [RNA processing and modification] Back     alignment and domain information
>cd08536 SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed domain of Mae protein homolog Back     alignment and domain information
>cd08533 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed domain of ETS-1,2 family Back     alignment and domain information
>cd08531 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors Back     alignment and domain information
>cd08541 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed domain of friend leukemia integration 1 transcription activator Back     alignment and domain information
>cd08534 SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Pointed domain of GA-binding protein alpha chain Back     alignment and domain information
>cd08538 SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Pointed domain of ESE-2 like ETS transcriptional regulators Back     alignment and domain information
>cd08543 SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed domain of ETS-2 Back     alignment and domain information
>cd08542 SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed domain of ETS-1 Back     alignment and domain information
>PF12979 DUF3863: Domain of Unknown Function with PDB structure (DUF3863); InterPro: IPR024334 This entry represents a functionally uncharacterised domain found in bacterial sequences Back     alignment and domain information
>PF10281 Ish1: Putative stress-responsive nuclear envelope protein; InterPro: IPR018803 This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues [] Back     alignment and domain information
>KOG3930 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
2f3n_A76 SH3 and multiple ankyrin repeat domains 3; postsyn 1e-06
2gle_A74 Neurabin-1; SAM domain, scaffold, protein protein 2e-06
3bq7_A81 Diacylglycerol kinase delta; SAM domain, polymeriz 3e-06
3tad_C 265 Liprin-beta-1; protein binding; 2.90A {Mus musculu 4e-06
3sei_A149 Caskin-1; SAM domain, protein-protein interaction, 1e-05
2eao_A99 Ephrin type-B receptor 1; cell-free protein synthe 2e-05
2qkq_A83 Ephrin type-B receptor 4; ATP-binding, glycoprotei 4e-05
1b4f_A82 EPHB2; SAM domain, EPH receptor, signal transducti 5e-05
2kg5_A100 ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- 8e-05
3hil_A82 Ephrin type-A receptor 1; ATP-binding, kinase, nuc 9e-05
2eam_A80 Putative 47 kDa protein; cell-free protein synthes 1e-04
3h8m_A90 Ephrin type-A receptor 7; SAM domain, kinase,struc 1e-04
2e8n_A88 Ephrin type-A receptor 2; cell-free protein synthe 1e-04
2ean_A83 Connector enhancer of kinase suppressor of RAS 2; 1e-04
1ucv_A81 Ephrin type-A receptor 8; receptor oligomerization 2e-04
2kso_A82 Ephrin type-A receptor 2; SAM domain, heterodimer, 2e-04
1b0x_A94 Protein (EPHA4 receptor tyrosine kinase); protein 2e-04
1wwv_A91 Connector enhancer of kinase suppressor of RAS 1; 2e-04
3bs5_B80 Connector enhancer of kinase suppressor of RAS 2; 4e-04
3kka_C86 Ephrin type-A receptor 2; ATP-binding, kinase, nuc 4e-04
2ke7_A103 Ankyrin repeat and sterIle alpha motif domain- con 4e-04
2e8o_A103 SAM domain and HD domain-containing protein 1; cel 5e-04
1v85_A91 Similar to ring finger protein 36; apoptosis, neur 5e-04
2kiv_A148 Ankyrin repeat and sterIle alpha motif domain- con 8e-04
>2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Length = 76 Back     alignment and structure
 Score = 41.6 bits (98), Expect = 1e-06
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 4  SIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMS 38
          S  DVG WLE I+LG +R  F+++ + G +L  ++
Sbjct: 6  SKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALT 40
>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Length = 74 Back     alignment and structure
>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81 Back     alignment and structure
>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265 Back     alignment and structure
>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 Back     alignment and structure
>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Length = 83 Back     alignment and structure
>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Length = 82 Back     alignment and structure
>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Length = 82 Back     alignment and structure
>2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Length = 90 Back     alignment and structure
>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 81 Back     alignment and structure
>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Length = 94 Back     alignment and structure
>1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 Back     alignment and structure
>3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} Length = 80 Back     alignment and structure
>3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} Length = 86 Back     alignment and structure
>2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 91 Back     alignment and structure
>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
3bs7_A78 Protein aveugle; sterIle alpha motif (SAM) domain, 99.67
2gle_A74 Neurabin-1; SAM domain, scaffold, protein protein 99.66
2f3n_A76 SH3 and multiple ankyrin repeat domains 3; postsyn 99.64
3bq7_A81 Diacylglycerol kinase delta; SAM domain, polymeriz 99.63
3bs5_A106 Protein aveugle; sterIle alpha motif, SAM domain, 99.62
1v85_A91 Similar to ring finger protein 36; apoptosis, neur 99.62
3bs5_B80 Connector enhancer of kinase suppressor of RAS 2; 99.61
2e8o_A103 SAM domain and HD domain-containing protein 1; cel 99.6
2ean_A83 Connector enhancer of kinase suppressor of RAS 2; 99.58
1pk1_B89 Sex COMB on midleg CG9495-PA; hetero SAM domain, p 99.58
1kw4_A89 Polyhomeotic; SAM domain, polycomb group, polymer, 99.56
2d8c_A97 Phosphatidylcholine:ceramide cholinephosphotransfe 99.55
2ke7_A103 Ankyrin repeat and sterIle alpha motif domain- con 99.38
2e8n_A88 Ephrin type-A receptor 2; cell-free protein synthe 99.36
1wwv_A91 Connector enhancer of kinase suppressor of RAS 1; 99.33
1ow5_A85 Serine/threonine-protein kinase STE11; MAP kinase, 99.31
2kso_A82 Ephrin type-A receptor 2; SAM domain, heterodimer, 99.29
2kg5_A100 ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- 99.22
1ucv_A81 Ephrin type-A receptor 8; receptor oligomerization 99.21
2qkq_A83 Ephrin type-B receptor 4; ATP-binding, glycoprotei 99.21
2eam_A80 Putative 47 kDa protein; cell-free protein synthes 99.2
1b4f_A82 EPHB2; SAM domain, EPH receptor, signal transducti 99.19
2eao_A99 Ephrin type-B receptor 1; cell-free protein synthe 99.18
2k4p_A86 Phosphatidylinositol-3,4,5-trisphosphate 5- phosph 99.16
3h8m_A90 Ephrin type-A receptor 7; SAM domain, kinase,struc 99.15
1b0x_A94 Protein (EPHA4 receptor tyrosine kinase); protein 99.14
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 99.13
2dl0_A97 SAM and SH3 domain-containing protein 1; cell-free 99.1
3tad_C 265 Liprin-beta-1; protein binding; 2.90A {Mus musculu 99.08
3kka_C86 Ephrin type-A receptor 2; ATP-binding, kinase, nuc 99.07
2kiv_A148 Ankyrin repeat and sterIle alpha motif domain- con 99.06
3hil_A82 Ephrin type-A receptor 1; ATP-binding, kinase, nuc 99.04
1x40_A91 ARAP2; ASAP-related protein2, GTPase activity, sig 99.02
2lmr_A101 ODIN, ankyrin repeat and SAM domain-containing pro 98.97
3sei_A149 Caskin-1; SAM domain, protein-protein interaction, 98.96
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 98.95
3k1r_B74 Usher syndrome type-1G protein; protein-protein co 98.92
3sei_A149 Caskin-1; SAM domain, protein-protein interaction, 98.9
1v38_A78 SAM-domain protein samsn-1; structural genomics, h 98.86
3tad_C265 Liprin-beta-1; protein binding; 2.90A {Mus musculu 98.83
2dkz_A84 Hypothetical protein LOC64762; cell-free protein s 98.7
2kiv_A148 Ankyrin repeat and sterIle alpha motif domain- con 98.62
3tac_B 334 Liprin-alpha-2; transferase-protein binding comple 98.46
1uqv_A85 STE50 protein; SAM, sterIle alpha motif, helical, 98.39
2eap_A90 Lymphocyte cytosolic protein 2; cell-free protein 98.26
3tac_B334 Liprin-alpha-2; transferase-protein binding comple 98.23
2d3d_A88 VTS1 protein; RNA binding, SAM domain, SRE hairpin 97.75
2y9t_A82 Tumor protein 63; apoptosis, sterIle alpha motif, 97.75
2y9u_A69 Tumor protein 63; apoptosis, sterIle alpha motif, 97.66
2es6_A101 VTS1P; SAM domain, protein structure, gene regulat 97.65
2b6g_A119 VTS1P; alpha-helix, pentaloop, hairpin, RNA bindin 97.6
2qar_B93 Telsam domain; polymer, crystallization modules, s 97.45
1oxj_A173 RNA-binding protein smaug; SAM domain, PHAT domain 97.14
1sv0_C82 Modulator of the activity of ETS CG15085-PA; alpha 97.14
1ji7_A89 ETS-related protein TEL1; helical polymer, transcr 96.87
1wwu_A99 Hypothetical protein FLJ21935; structural genomics 96.21
2e8m_A99 Epidermal growth factor receptor kinase substrate 96.15
1x66_A98 Friend leukemia integration 1 transcription factor 95.17
1sv0_A85 ETS DNA-binding protein pokkuri; alpha-helix, 3(10 94.34
2h80_A81 STAR-related lipid transfer protein 13; helical bu 93.8
2dky_A91 RHO-GTPase-activating protein 7; cell-free protein 92.99
1sxd_A91 GA repeat binding protein, alpha; alpha helical, t 92.94
2jv3_A110 ETS1 proto-oncogene; ETS-1 pointed (PNT) domain, M 92.58
1sxe_A97 Transcriptional regulator ERG; alpha helical, sign 92.44
1dxs_A80 P53-like transcription factor; P73 SAM-like domain 91.06
2dkx_A96 SAM pointed domain-containing ETS transcription fa 90.38
2ytu_A128 Friend leukemia integration 1 transcription factor 88.78
2qb0_B 241 Telsam domain - lysozyme chimera; helical polymer, 88.51
2e8p_A92 ELF3 protein; cell-free protein synthesis, protein 84.39
>3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} Back     alignment and structure
Probab=99.67  E-value=6.7e-17  Score=103.50  Aligned_cols=66  Identities=18%  Similarity=0.330  Sum_probs=59.6

Q ss_pred             CCCHHHHHHHHHhc--CcchHHHHhhhcCCchhhhhcccccchHHHHHHHHHhhhcchhHHHHHHHHHHHHHHH
Q 033691            2 YLSIKDVGLWLEEI--NLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVAC   73 (113)
Q Consensus         2 ~WS~EDVa~WLeei--GLgqYre~Fk~N~IdG~~Li~Ltk~t~e~ilr~i~r~~~k~Gd~itl~~El~~ikva~   73 (113)
                      .||++||+.||+.+  ||++|.+.|.+|+|+|+.|..|    +++-|+.++.  .+.||+.++..+++.+|...
T Consensus         5 ~Wt~~~V~~WL~~~~~gl~~y~~~F~~~~I~G~~Ll~L----~~~dL~~lGI--~~~g~r~~il~~I~~Lr~~~   72 (78)
T 3bs7_A            5 LWTVSDVLKWYRRHCGEYTQYEQLFAQHDITGRALLRI----TDSSLQRMGV--TDNRDREAIWREIVKQRLKT   72 (78)
T ss_dssp             GCCHHHHHHHHHHHSGGGGGGHHHHHHTTCCHHHHTTC----CHHHHHHHTC--CCHHHHHHHHHHHHHHHHHH
T ss_pred             hCCHHHHHHHHHHHhcCHHHHHHHHHHCCCCHHHHhhC----CHHHHhHcCC--CCHHHHHHHHHHHHHHHhHH
Confidence            69999999999996  9999999999999999999999    5666777766  88999999999999998654
>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Back     alignment and structure
>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Back     alignment and structure
>3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} Back     alignment and structure
>1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} Back     alignment and structure
>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A Back     alignment and structure
>1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A Back     alignment and structure
>2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 Back     alignment and structure
>2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Back     alignment and structure
>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Back     alignment and structure
>1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A Back     alignment and structure
>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Back     alignment and structure
>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Back     alignment and structure
>2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Back     alignment and structure
>2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Back     alignment and structure
>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B Back     alignment and structure
>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Back     alignment and structure
>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Back     alignment and structure
>3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} SCOP: a.60.1.0 Back     alignment and structure
>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Back     alignment and structure
>3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Back     alignment and structure
>1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 Back     alignment and structure
>2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} Back     alignment and structure
>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Back     alignment and structure
>1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 Back     alignment and structure
>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Back     alignment and structure
>2dkz_A Hypothetical protein LOC64762; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Back     alignment and structure
>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Back     alignment and structure
>1uqv_A STE50 protein; SAM, sterIle alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1z1v_A Back     alignment and structure
>2eap_A Lymphocyte cytosolic protein 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Back     alignment and structure
>2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A Back     alignment and structure
>2y9t_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle; NMR {Homo sapiens} Back     alignment and structure
>2y9u_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle, mutations, A syndrome; 1.60A {Homo sapiens} PDB: 1rg6_A Back     alignment and structure
>2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A Back     alignment and structure
>2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qar_B Telsam domain; polymer, crystallization modules, sterIle alpha motif, hydro regulator; 2.40A {Escherichia coli} Back     alignment and structure
>1oxj_A RNA-binding protein smaug; SAM domain, PHAT domain; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 a.118.1.13 Back     alignment and structure
>1sv0_C Modulator of the activity of ETS CG15085-PA; alpha-helix, 3(10) helix, transcription; 2.07A {Drosophila melanogaster} SCOP: a.60.1.1 Back     alignment and structure
>1ji7_A ETS-related protein TEL1; helical polymer, transcription; 1.45A {Homo sapiens} SCOP: a.60.1.1 PDB: 2qar_A 2qb0_A 1lky_A 1lky_B 2qb1_A Back     alignment and structure
>1wwu_A Hypothetical protein FLJ21935; structural genomics, protein regulation, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} Back     alignment and structure
>2e8m_A Epidermal growth factor receptor kinase substrate 8; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x66_A Friend leukemia integration 1 transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sv0_A ETS DNA-binding protein pokkuri; alpha-helix, 3(10) helix, transcription; 2.07A {Drosophila melanogaster} SCOP: a.60.1.1 PDB: 1sv4_A Back     alignment and structure
>2h80_A STAR-related lipid transfer protein 13; helical bundle, lipid binding protein; NMR {Homo sapiens} SCOP: a.60.1.3 PDB: 2jw2_A Back     alignment and structure
>2dky_A RHO-GTPase-activating protein 7; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.3 PDB: 2gyt_A 2kap_A Back     alignment and structure
>1sxd_A GA repeat binding protein, alpha; alpha helical, transcription, signaling protein; NMR {Mus musculus} SCOP: a.60.1.1 Back     alignment and structure
>2jv3_A ETS1 proto-oncogene; ETS-1 pointed (PNT) domain, MAP kinase phosphorylation site, alpha-helical bundle, transcription factor, DNA-binding, nucleus; NMR {Mus musculus} PDB: 2kmd_A* Back     alignment and structure
>1sxe_A Transcriptional regulator ERG; alpha helical, signaling protein; NMR {Homo sapiens} SCOP: a.60.1.1 Back     alignment and structure
>1dxs_A P53-like transcription factor; P73 SAM-like domain, gene regulation, P53 P63 homologue, sterIle alpha motif, tumour supressor; 2.54A {Homo sapiens} SCOP: a.60.1.2 PDB: 1cok_A Back     alignment and structure
>2dkx_A SAM pointed domain-containing ETS transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytu_A Friend leukemia integration 1 transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} Back     alignment and structure
>2e8p_A ELF3 protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d2f3na164 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat 3e-05
d1kw4a_70 a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaste 6e-05
d1v38a_78 a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (M 2e-04
d1b0xa_72 a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou 4e-04
d1ucva_81 a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal 0.001
d1b4fa_74 a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) 0.001
d1x40a178 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human 0.003
>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: SAM domain-like
superfamily: SAM/Pointed domain
family: SAM (sterile alpha motif) domain
domain: Sh3 and multiple ankyrin repeat domains 3 (Shank3)
species: Rat(Rattus norvegicus) [TaxId: 10116]

 Score = 36.8 bits (85), Expect = 3e-05
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 4  SIKDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLC 63
          S  DVG WLE I+LG +R  F+++ + G +L       T++    +     + G    + 
Sbjct: 5  SKFDVGDWLESIHLGEHRDRFEDHEIEGAHL----PALTKEDFVEL--GVTRVGHRENIE 58

Query: 64 KELRRI 69
          + LR++
Sbjct: 59 RALRQL 64
>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Length = 70 Back     information, alignment and structure
>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1pk3a163 Polycomb protein Scm {Fruit fly (Drosophila melano 99.7
d1kw4a_70 Polyhomeotic {Drosophila melanogaster [TaxId: 7227 99.7
d2f3na164 Sh3 and multiple ankyrin repeat domains 3 (Shank3) 99.68
d1wwva178 Connector enhancer of kinase suppressor of Ras 1, 99.61
d1b4fa_74 EphB2 receptor {Human (Homo sapiens) [TaxId: 9606] 99.47
d1ow5a_60 Serine/threonine-protein kinase ste11 {Baker's yea 99.46
d2d8ca185 Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculu 99.45
d1v38a_78 Sam-domain protein samsn-1 {Mouse (Mus musculus) [ 99.42
d1b0xa_72 EphA4 receptor tyrosine kinases {Mouse (Mus muscul 99.33
d1ucva_81 Ephrin type-A receptor 8, C-terminal domain {Human 99.29
d1x40a178 Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta 99.23
d1oxja162 RNA-binding protein Smaug {Drosophila melanogaster 99.18
d1dxsa_57 C-terminal domain of p73 {Human (Homo sapiens) [Ta 98.62
d1z1va170 Ste50p, N-terminal domain {Baker's yeast (Saccharo 96.6
d1rg6a_67 C-terminal domain of p63 {Human (Homo sapiens) [Ta 95.7
d1sv0c_82 Modulator of the activity of Ets (MAE, CG15085-PA) 95.08
d1sxea_97 Transcriptional regulator ERG {Human (Homo sapiens 94.09
d1sxda_91 GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 1 93.89
d2jv3a_110 Ets-1 transcription factor pointed domain {Mouse ( 91.95
d1sv0a_77 Ets DNA-binding protein pokkuri (Yan) {Fruit fly ( 90.95
d1ji7a_77 Etv6 transcription factor pointed domain (Tel SAM) 90.32
d2h80a171 Deleted in Liver Cancer 2, DLC2 {Human (Homo sapie 88.86
d2dkya178 Deleted in liver cancer 1 protein, DLC-1 {Human (H 88.51
>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: SAM domain-like
superfamily: SAM/Pointed domain
family: SAM (sterile alpha motif) domain
domain: Polycomb protein Scm
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.70  E-value=7.9e-18  Score=103.51  Aligned_cols=61  Identities=16%  Similarity=0.400  Sum_probs=54.6

Q ss_pred             CCHHHHHHHHHhc--CcchHHHHhhhcCCchhhhhcccccchHHHHHHHHHhhhcchhHHHHHHHHHHH
Q 033691            3 LSIKDVGLWLEEI--NLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRI   69 (113)
Q Consensus         3 WS~EDVa~WLeei--GLgqYre~Fk~N~IdG~~Li~Ltk~t~e~ilr~i~r~~~k~Gd~itl~~El~~i   69 (113)
                      ||+|||++||+++  |+++|.+.|++|+|||+.|..|    +++-|+-+..  +|.|+++++++.|+++
T Consensus         1 Ws~~dV~~wL~~~~~~~~~y~~~F~~~~IdG~~Ll~L----t~edL~~~~~--~~~G~r~ki~~~I~~L   63 (63)
T d1pk3a1           1 WTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRL----NSEMMMKYMG--LKLGPALKICNLVNKV   63 (63)
T ss_dssp             CCHHHHHHHHHHHCGGGGGGHHHHHHTTCCHHHHTTC----CHHHHHHHHC--CCHHHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHccccHHHHHHHHHHhCcCHHHHHhc----CHHHHHHhcC--CCchHHHHHHHHHHhC
Confidence            9999999999998  8999999999999999999999    6666655554  8999999999998864
>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sv0c_ a.60.1.1 (C:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sv0a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ji7a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h80a1 a.60.1.3 (A:11-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkya1 a.60.1.3 (A:8-85) Deleted in liver cancer 1 protein, DLC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure