Citrus Sinensis ID: 033712

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSVQEEKDEKEKEKEKESKEIKQNPIEWAYCSQFPPPPYHQFVVDANPSSNCFIL
cccHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEccccHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHccccccccccccccccccEEEEEccccccccEEc
cccHHHHHHHHHHHHHccccEEEEEEcccccEEEEEcccccHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccEEEEccccccccEcc
MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSVQEEKDEKEKEKEKESKEikqnpiewaycsqfppppyhqfvvdanpssncfil
mtckkcrkkamkiavkadgvikveikgegkdelvvIGNEVDSVKLTrklqkklgfasllsvqeekdekekekekeskeikqnpiEWAYCSQFPPPPYHQFVVDANPSSNCFIL
MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSVQeekdekekekekeskeikQNPIEWAYCSQFPPPPYHQFVVDANPSSNCFIL
*********AMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASL*************************IEWAYCSQFPPPPYHQFVVD**********
**********MKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLL***********************PIEWAYCSQFPPPPYHQFVVDANPSSNCFIL
**********MKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSV******************KQNPIEWAYCSQFPPPPYHQFVVDANPSSNCFIL
**CKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSVQEEKDEK********KEIKQNPIEWAYCSQFPPPPYHQFVVDANPSSNCFI*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASxxxxxxxxxxxxxxxxxxxxxxxxxPIEWAYCSQFPPPPYHQFVVDANPSSNCFIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
359494352120 PREDICTED: uncharacterized protein LOC10 0.663 0.625 0.573 8e-14
296090016110 unnamed protein product [Vitis vinifera] 0.663 0.681 0.56 5e-13
225454107124 PREDICTED: uncharacterized protein LOC10 0.955 0.870 0.419 2e-12
46806257119 hypothetical protein [Oryza sativa Japon 0.929 0.882 0.401 3e-12
356554580127 PREDICTED: uncharacterized protein LOC10 0.964 0.858 0.394 4e-12
296090011132 unnamed protein product [Vitis vinifera] 0.646 0.553 0.594 4e-12
255584629119 metal ion binding protein, putative [Ric 0.938 0.890 0.392 9e-12
296090013111 unnamed protein product [Vitis vinifera] 0.557 0.567 0.587 2e-11
224056859115 predicted protein [Populus trichocarpa] 0.929 0.913 0.442 5e-11
118489467113 unknown [Populus trichocarpa x Populus d 0.911 0.911 0.460 6e-11
>gi|359494352|ref|XP_003634762.1| PREDICTED: uncharacterized protein LOC100853541 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%)

Query: 1  MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLS 60
          M C KCR KAMKIA  A+GVI V I+G  KD +VVIG+ VDS  LT  L+KKLG+A+L+S
Sbjct: 11 MNCGKCRSKAMKIAAVAEGVISVAIEGAEKDRVVVIGDGVDSASLTHCLRKKLGYATLVS 70

Query: 61 VQEEKDEKEKEKEKE 75
          V+E K++ +K K  E
Sbjct: 71 VEEVKEKVDKGKGDE 85

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090016|emb|CBI39835.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454107|ref|XP_002268731.1| PREDICTED: uncharacterized protein LOC100255094 [Vitis vinifera] Back     alignment and taxonomy information
>gi|46806257|dbj|BAD17465.1| hypothetical protein [Oryza sativa Japonica Group] gi|50253091|dbj|BAD29339.1| hypothetical protein [Oryza sativa Japonica Group] gi|125582662|gb|EAZ23593.1| hypothetical protein OsJ_07292 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|356554580|ref|XP_003545623.1| PREDICTED: uncharacterized protein LOC100811176 [Glycine max] Back     alignment and taxonomy information
>gi|296090011|emb|CBI39830.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255584629|ref|XP_002533038.1| metal ion binding protein, putative [Ricinus communis] gi|223527176|gb|EEF29346.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296090013|emb|CBI39832.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224056859|ref|XP_002299059.1| predicted protein [Populus trichocarpa] gi|222846317|gb|EEE83864.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118489467|gb|ABK96536.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
TAIR|locus:2138376110 AT4G05030 "AT4G05030" [Arabido 0.539 0.554 0.524 1.7e-11
TAIR|locus:2087580118 AT3G20180 "AT3G20180" [Arabido 0.522 0.5 0.508 3.2e-10
TAIR|locus:2091112157 AT3G07600 [Arabidopsis thalian 0.539 0.388 0.491 1.2e-08
TAIR|locus:2156253181 AT5G48290 [Arabidopsis thalian 0.539 0.337 0.491 2e-08
TAIR|locus:2149584118 AT5G52740 "AT5G52740" [Arabido 0.477 0.457 0.389 1.1e-05
TAIR|locus:2082425 473 AT3G06130 [Arabidopsis thalian 0.407 0.097 0.38 0.00073
TAIR|locus:2138376 AT4G05030 "AT4G05030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 1.7e-11, P = 1.7e-11
 Identities = 32/61 (52%), Positives = 43/61 (70%)

Query:     1 MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLS 60
             M C KCR +A+KI  K  GV  V I+GE KD++VVIG  VD+  L  +L+KK+GFA ++S
Sbjct:    44 MRCDKCRSEALKIGAKTTGVTFVGIEGEEKDKVVVIGEGVDAACLVVRLRKKVGFADIIS 103

Query:    61 V 61
             V
Sbjct:   104 V 104
GO:0046872 "metal ion binding" evidence=ISS
TAIR|locus:2087580 AT3G20180 "AT3G20180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091112 AT3G07600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156253 AT5G48290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149584 AT5G52740 "AT5G52740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082425 AT3G06130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026781001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (120 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.004
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information 
 Score = 33.0 bits (76), Expect = 0.004
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 1  MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNE--VDSVKLTRKLQK 51
          MTC  C KK  K   K  GV  V +  E   ++ V G+   +   KL + ++K
Sbjct: 7  MTCAGCAKKVEKALSKLPGVSSVSVDLE-TGKVTVTGDPDPLKLEKLKKAIEK 58

Length = 62

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.59
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.18
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.54
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.17
PLN02957 238 copper, zinc superoxide dismutase 97.62
PRK10671 834 copA copper exporting ATPase; Provisional 96.92
TIGR0000368 copper ion binding protein. This model describes a 94.62
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 93.4
PRK10671 834 copA copper exporting ATPase; Provisional 92.38
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 90.96
COG188897 Uncharacterized protein conserved in archaea [Func 89.75
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 89.14
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 82.4
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 82.03
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.59  E-value=4.3e-15  Score=95.85  Aligned_cols=58  Identities=41%  Similarity=0.606  Sum_probs=53.1

Q ss_pred             CCchhHHHHHHHHHhcCCCeeEEEecCCCCCeEEEEeeccCHHHHHHHHHhhcC-ceeEEe
Q 033712            1 MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLG-FASLLS   60 (113)
Q Consensus         1 m~Ce~C~~kv~k~l~~~~GV~sV~vd~~~k~kvtV~G~~vDp~~l~~~LrKk~~-~aeivs   60 (113)
                      |||+||+++|++.+.+++||.++.+|. .+++|||.|. +||..|+++|+|.++ .+++|.
T Consensus        13 ~~C~gc~~kV~~~l~~~~GV~~v~id~-~~~kvtV~g~-~~p~~vl~~l~k~~~k~~~~~~   71 (73)
T KOG1603|consen   13 MHCEGCARKVKRVLQKLKGVESVDIDI-KKQKVTVKGN-VDPVKLLKKLKKTGGKRAELWK   71 (73)
T ss_pred             cccccHHHHHHHHhhccCCeEEEEecC-CCCEEEEEEe-cCHHHHHHHHHhcCCCceEEec
Confidence            899999999999999999999999999 7799999999 999999999998664 566653

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 8e-04
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
 Score = 36.2 bits (83), Expect = 8e-04
 Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 2/51 (3%)

Query: 1  MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQK 51
          M C+ C            G+  +    E   +++ + + V    +   L+ 
Sbjct: 14 MHCENCVNDIKACLKNVPGINSLNFDIE--QQIMSVESSVAPSTIINTLRN 62

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.22
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.11
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.98
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.92
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.87
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.81
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.78
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.71
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.59
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.57
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.55
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.55
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.53
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.52
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.52
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.51
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.5
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.45
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.43
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.41
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.41
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.39
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.39
2kyz_A67 Heavy metal binding protein; structural genomics, 98.39
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.35
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.33
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.33
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.29
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.27
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.24
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.23
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.19
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.17
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.17
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.16
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.03
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.01
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.72
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 97.53
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.34
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 96.99
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 92.34
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 91.3
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 91.16
2jsx_A95 Protein NAPD; TAT, proofreading, cytoplasm, chaper 83.94
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.22  E-value=5.7e-11  Score=72.55  Aligned_cols=57  Identities=26%  Similarity=0.394  Sum_probs=53.2

Q ss_pred             CCchhHHHHHHHHHhcCCCeeEEEecCCCCCeEEEEeeccCHHHHHHHHHhhcC-ceeEEec
Q 033712            1 MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLG-FASLLSV   61 (113)
Q Consensus         1 m~Ce~C~~kv~k~l~~~~GV~sV~vd~~~k~kvtV~G~~vDp~~l~~~LrKk~~-~aeivsv   61 (113)
                      |+|.+|..+|.++|.+++|| ++.+|. ..++++|.+. +++..|++.|++ .| .+++|+.
T Consensus        10 m~C~~C~~~i~~~l~~~~gV-~v~v~~-~~~~~~v~~~-~~~~~i~~~i~~-~Gy~~~~~~~   67 (68)
T 3iwl_A           10 MTCGGCAEAVSRVLNKLGGV-KYDIDL-PNKKVCIESE-HSMDTLLATLKK-TGKTVSYLGL   67 (68)
T ss_dssp             CCSHHHHHHHHHHHHHHCSE-EEEEET-TTTEEEEEES-SCHHHHHHHHHT-TCSCEEEEEC
T ss_pred             cCcHHHHHHHHHHHHcCCCe-EEEEEc-CCCEEEEEec-CCHHHHHHHHHH-cCCceEecCC
Confidence            89999999999999999999 999999 7899999998 999999999996 77 8998865
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>2jsx_A Protein NAPD; TAT, proofreading, cytoplasm, chaperone; NMR {Escherichia coli K12} PDB: 2pq4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1ffta_501 f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subu 0.003

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.46
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.42
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.35
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.14
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.11
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.1
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 98.97
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 98.91
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 98.88
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.88
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.86
d1p6ta279 Potential copper-translocating P-type ATPase CopA 98.85
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.83
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.77
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 88.96
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 88.24
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.46  E-value=1.2e-13  Score=85.32  Aligned_cols=57  Identities=26%  Similarity=0.394  Sum_probs=53.2

Q ss_pred             CCchhHHHHHHHHHhcCCCeeEEEecCCCCCeEEEEeeccCHHHHHHHHHhhcC-ceeEEec
Q 033712            1 MTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLG-FASLLSV   61 (113)
Q Consensus         1 m~Ce~C~~kv~k~l~~~~GV~sV~vd~~~k~kvtV~G~~vDp~~l~~~LrKk~~-~aeivsv   61 (113)
                      |||.+|.++|.++|.+++|| ++.+|. ..++++|.|+ +++..|+++|++ .| .|+|+.+
T Consensus         9 M~C~~C~~~I~~aL~~~~gv-~v~v~~-~~~~v~V~~~-~~~~~i~~~I~~-~Gy~a~lig~   66 (66)
T d1fe0a_           9 MTCGGCAEAVSRVLNKLGGV-KYDIDL-PNKKVCIESE-HSMDTLLATLKK-TGKTVSYLGL   66 (66)
T ss_dssp             CCSHHHHHHHHHHHHHHCSE-EEEEET-TTTEEEEEES-SCHHHHHHHHHT-TTSCEEEEEC
T ss_pred             cCchHHHHHHHHHHhcCCCc-EEEEEc-CCCEEEEEee-CCHHHHHHHHHH-hCCeEEEeeC
Confidence            89999999999999999998 699999 8899999999 999999999986 77 8999864
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure