Citrus Sinensis ID: 033857

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTAQTD
cccHHHHHHHHHHHHcccccEEccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHcccEEcccccHHHHHHHccc
ccccccHHHHHHHHHccccEEEEccccccccccEEEEEccccHHHEcHHHHHHHHHHHHHHHcccccccEEEEccEEHHcccHHHHHHHcccEEEEEcccccEEEEcccc
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEmmqpcssvkdRIAYSMIKdaedkglitpgkcfcfqstlitstkpiLLLKILRVSCVFQDFCSNWVYTAQTD
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTAQTD
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTAQTD
*******KKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYT****
****CEI*KDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTA***
********KDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTAQTD
****CEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTAQ**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLLKILRVSCVFQDFCSNWVYTAQTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
F4K5T2 323 Bifunctional cystathionin no no 0.690 0.235 0.789 1e-30
Q43317 325 Cysteine synthase OS=Citr N/A no 0.663 0.224 0.739 7e-27
O81154 325 Cysteine synthase OS=Sola N/A no 0.672 0.227 0.716 2e-26
Q9XEA6 321 Cysteine synthase OS=Oryz yes no 0.636 0.218 0.728 3e-25
Q9XEA8 325 Cysteine synthase OS=Oryz no no 0.681 0.230 0.693 1e-24
O23733 322 Cysteine synthase OS=Bras N/A no 0.654 0.223 0.680 1e-24
P47998 322 Cysteine synthase OS=Arab no no 0.654 0.223 0.680 1e-24
Q00834 325 Cysteine synthase OS=Spin N/A no 0.690 0.233 0.671 1e-24
P38076 325 Cysteine synthase OS=Trit N/A no 0.636 0.215 0.7 5e-24
O23735 324 Cysteine synthase OS=Bras N/A no 0.690 0.234 0.631 8e-24
>sp|F4K5T2|CGL_ARATH Bifunctional cystathionine gamma-lyase/cysteine synthase OS=Arabidopsis thaliana GN=DES1 PE=1 SV=1 Back     alignment and function desciption
 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/76 (78%), Positives = 67/76 (88%)

Query: 1  MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
          MED+  IK DVTELIG+TPMVYLN +VDGCVA IAAKLEMM+PCSS+KDRIAYSMIKDAE
Sbjct: 1  MEDRVLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAE 60

Query: 61 DKGLITPGKCFCFQST 76
          DKGLITPGK    ++T
Sbjct: 61 DKGLITPGKSTLIEAT 76
Involved in maintaining Cys homeostasis through the desulfuration of L-cysteine. Probably unable to interact with SAT and to form the decameric Cys synthase complex (CSC) and is therefore not an enzymatically true OASTL protein.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 1
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function description
>sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 Back     alignment and function description
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|P47998|CYSK1_ARATH Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 Back     alignment and function description
>sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description
>sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 Back     alignment and function description
>sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
15241111 323 cysteine synthase D2 [Arabidopsis thalia 0.690 0.235 0.828 2e-30
2245144 345 O-acetylserine(thiol) lyase [Brassica ju 0.690 0.220 0.814 2e-30
359487838 323 PREDICTED: cysteine synthase-like [Vitis 0.690 0.235 0.815 3e-30
359487834 323 PREDICTED: cysteine synthase-like [Vitis 0.690 0.235 0.815 3e-30
222424429 323 AT5G28020 [Arabidopsis thaliana] 0.690 0.235 0.815 3e-30
147835129 323 hypothetical protein VITISV_031201 [Viti 0.690 0.235 0.815 3e-30
255542388 332 cysteine synthase, putative [Ricinus com 0.690 0.228 0.828 4e-30
359487913156 PREDICTED: cysteine synthase-like [Vitis 0.690 0.487 0.815 5e-30
298204918128 unnamed protein product [Vitis vinifera] 0.690 0.593 0.815 6e-30
21553635 323 cysteine synthase [Arabidopsis thaliana] 0.690 0.235 0.815 8e-30
>gi|15241111|ref|NP_198154.1| cysteine synthase D2 [Arabidopsis thaliana] gi|30690901|ref|NP_851087.1| cysteine synthase D2 [Arabidopsis thaliana] gi|79328865|ref|NP_001031956.1| cysteine synthase D2 [Arabidopsis thaliana] gi|79328884|ref|NP_001031957.1| cysteine synthase D2 [Arabidopsis thaliana] gi|145334565|ref|NP_001078628.1| cysteine synthase D2 [Arabidopsis thaliana] gi|15983448|gb|AAL11592.1|AF424598_1 AT5g28020/F15F15_90 [Arabidopsis thaliana] gi|4996618|dbj|BAA78561.1| cysteine synthase [Arabidopsis thaliana] gi|21700833|gb|AAM70540.1| AT5g28020/F15F15_90 [Arabidopsis thaliana] gi|332006376|gb|AED93759.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006377|gb|AED93760.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006378|gb|AED93761.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006379|gb|AED93762.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006381|gb|AED93764.1| cysteine synthase D2 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/76 (82%), Positives = 68/76 (89%)

Query: 1  MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
          MED+C IK D+TELIG+TPMVYLNNVVDGCVA IAAKLEMM+PCSSVKDRIAYSMIKDAE
Sbjct: 1  MEDRCLIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAE 60

Query: 61 DKGLITPGKCFCFQST 76
          DKGLITPGK    + T
Sbjct: 61 DKGLITPGKSTLIEPT 76

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|2245144|emb|CAA71799.1| O-acetylserine(thiol) lyase [Brassica juncea] Back     alignment and taxonomy information
>gi|359487838|ref|XP_003633660.1| PREDICTED: cysteine synthase-like [Vitis vinifera] gi|298204917|emb|CBI34224.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487834|ref|XP_003633659.1| PREDICTED: cysteine synthase-like [Vitis vinifera] gi|298204916|emb|CBI34223.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|222424429|dbj|BAH20170.1| AT5G28020 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147835129|emb|CAN76754.1| hypothetical protein VITISV_031201 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542388|ref|XP_002512257.1| cysteine synthase, putative [Ricinus communis] gi|223548218|gb|EEF49709.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359487913|ref|XP_003633675.1| PREDICTED: cysteine synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204918|emb|CBI34225.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|21553635|gb|AAM62728.1| cysteine synthase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
TAIR|locus:2143814 323 CYSD2 "cysteine synthase D2" [ 0.690 0.235 0.827 1e-29
TAIR|locus:2143754 323 DES1 "L-cysteine desulfhydrase 0.690 0.235 0.790 3.9e-28
TAIR|locus:2114804 324 CYSD1 "cysteine synthase D1" [ 0.681 0.231 0.775 5e-28
TAIR|locus:2130419 322 OASA1 "O-acetylserine (thiol) 0.636 0.217 0.7 2.6e-22
TAIR|locus:2043964 392 OASB "O-acetylserine (thiol) l 0.636 0.178 0.7 2.2e-21
TAIR|locus:2080417 433 OASC "O-acetylserine (thiol) l 0.672 0.170 0.608 1.9e-19
TAIR|locus:2096454 404 CS26 "cysteine synthase 26" [A 0.636 0.173 0.642 2.4e-18
UNIPROTKB|Q76MX2 351 PCAS-1 "Bifunctional L-3-cyano 0.636 0.199 0.628 4.3e-18
UNIPROTKB|Q1KLZ2 376 CAS1 "L-3-cyanoalanine synthas 0.645 0.188 0.591 1.8e-17
UNIPROTKB|Q1KLZ1 375 CAS2 "L-3-cyanoalanine synthas 0.645 0.189 0.591 6.6e-17
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 329 (120.9 bits), Expect = 1.0e-29, P = 1.0e-29
 Identities = 67/81 (82%), Positives = 71/81 (87%)

Query:     1 MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
             MED+C IK D+TELIG+TPMVYLNNVVDGCVA IAAKLEMM+PCSSVKDRIAYSMIKDAE
Sbjct:     1 MEDRCLIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAE 60

Query:    61 DKGLITPGKCFCFQSTLITST 81
             DKGLITPGK     STLI  T
Sbjct:    61 DKGLITPGK-----STLIEPT 76
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;ISS;IMP
GO:0005739 "mitochondrion" evidence=ISM
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0019344 "cysteine biosynthetic process" evidence=ISS
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096454 CS26 "cysteine synthase 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XEA6CYSK1_ORYSJ2, ., 5, ., 1, ., 4, 70.72850.63630.2180yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
PLN00011 323 PLN00011, PLN00011, cysteine synthase 2e-45
PLN02565 322 PLN02565, PLN02565, cysteine synthase 1e-40
PLN02556 368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 1e-28
TIGR01136 299 TIGR01136, cysKM, cysteine synthase 5e-27
PLN03013 429 PLN03013, PLN03013, cysteine synthase 8e-27
COG0031 300 COG0031, CysK, Cysteine synthase [Amino acid trans 3e-25
TIGR01139 298 TIGR01139, cysK, cysteine synthase A 4e-25
cd01561 291 cd01561, CBS_like, CBS_like: This subgroup include 8e-23
PRK10717 330 PRK10717, PRK10717, cysteine synthase A; Provision 8e-18
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 1e-16
TIGR03945 304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 3e-16
PRK11761 296 PRK11761, cysM, cysteine synthase B; Provisional 6e-16
cd00640 244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 5e-12
TIGR01138 290 TIGR01138, cysM, cysteine synthase B 4e-11
pfam00291 295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 3e-10
PLN02356 423 PLN02356, PLN02356, phosphateglycerate kinase 6e-08
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information 
 Score =  148 bits (376), Expect = 2e-45
 Identities = 67/81 (82%), Positives = 72/81 (88%), Gaps = 5/81 (6%)

Query: 1  MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
          MED+C IK DVTELIG+TPMVYLNN+VDGCVA IAAKLEMM+PCSSVKDRIAYSMIKDAE
Sbjct: 1  MEDRCLIKNDVTELIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAE 60

Query: 61 DKGLITPGKCFCFQSTLITST 81
          DKGLITPGK     STLI +T
Sbjct: 61 DKGLITPGK-----STLIEAT 76

Length = 323
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
COG0031 300 CysK Cysteine synthase [Amino acid transport and m 99.95
KOG1252 362 consensus Cystathionine beta-synthase and related 99.94
PLN00011 323 cysteine synthase 99.94
PLN03013 429 cysteine synthase 99.93
PRK11761 296 cysM cysteine synthase B; Provisional 99.93
PLN02565 322 cysteine synthase 99.93
PLN02356 423 phosphateglycerate kinase 99.92
PRK10717 330 cysteine synthase A; Provisional 99.92
PLN02556 368 cysteine synthase/L-3-cyanoalanine synthase 99.92
TIGR01138 290 cysM cysteine synthase B. Alternate name: O-acetyl 99.91
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 99.9
TIGR01136 299 cysKM cysteine synthases. This model discriminates 99.9
TIGR01139 298 cysK cysteine synthase A. This model distinguishes 99.9
PRK06110 322 hypothetical protein; Provisional 99.89
PLN02970 328 serine racemase 99.89
PRK08246 310 threonine dehydratase; Provisional 99.89
PRK06608 338 threonine dehydratase; Provisional 99.89
PRK07476 322 eutB threonine dehydratase; Provisional 99.89
cd06447 404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 99.89
PRK08198 404 threonine dehydratase; Provisional 99.88
cd01562 304 Thr-dehyd Threonine dehydratase: The first step in 99.87
PRK07048 321 serine/threonine dehydratase; Validated 99.87
PRK06381 319 threonine synthase; Validated 99.87
PRK08638 333 threonine dehydratase; Validated 99.87
PRK06382 406 threonine dehydratase; Provisional 99.87
TIGR02035 431 D_Ser_am_lyase D-serine ammonia-lyase. This family 99.87
PRK08526 403 threonine dehydratase; Provisional 99.87
PRK08639 420 threonine dehydratase; Validated 99.87
TIGR02991 317 ectoine_eutB ectoine utilization protein EutB. Mem 99.87
PRK02991 441 D-serine dehydratase; Provisional 99.86
cd01561 291 CBS_like CBS_like: This subgroup includes Cystathi 99.86
PRK08813 349 threonine dehydratase; Provisional 99.86
PRK07334 403 threonine dehydratase; Provisional 99.86
PRK06815 317 hypothetical protein; Provisional 99.86
TIGR02079 409 THD1 threonine dehydratase. This model represents 99.85
PRK07409 353 threonine synthase; Validated 99.85
PRK06721 352 threonine synthase; Reviewed 99.85
PRK06352 351 threonine synthase; Validated 99.85
COG1171 347 IlvA Threonine dehydratase [Amino acid transport a 99.85
cd01563 324 Thr-synth_1 Threonine synthase is a pyridoxal phos 99.85
cd06448 316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 99.84
KOG1481 391 consensus Cysteine synthase [Amino acid transport 99.84
TIGR01127 380 ilvA_1Cterm threonine dehydratase, medium form. A 99.84
PRK08197 394 threonine synthase; Validated 99.84
PRK06450 338 threonine synthase; Validated 99.84
PRK12483 521 threonine dehydratase; Reviewed 99.84
PLN02550 591 threonine dehydratase 99.83
PRK06260 397 threonine synthase; Validated 99.83
PRK05638 442 threonine synthase; Validated 99.83
PRK07591 421 threonine synthase; Validated 99.82
PLN02569 484 threonine synthase 99.82
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 99.82
PF00291 306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 99.82
TIGR00260 328 thrC threonine synthase. Involved in threonine bio 99.82
cd00640 244 Trp-synth-beta_II Tryptophan synthase beta superfa 99.81
PRK09224 504 threonine dehydratase; Reviewed 99.81
PRK08329 347 threonine synthase; Validated 99.79
PRK08206 399 diaminopropionate ammonia-lyase; Provisional 99.78
TIGR03844 398 cysteate_syn cysteate synthase. Members of this fa 99.77
TIGR00263 385 trpB tryptophan synthase, beta subunit. Tryptophan 99.76
KOG1251 323 consensus Serine racemase [Signal transduction mec 99.75
TIGR01415 419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 99.74
cd06446 365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 99.74
TIGR01747 376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 99.73
TIGR03528 396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 99.73
PRK04346 397 tryptophan synthase subunit beta; Validated 99.72
PRK12391 427 tryptophan synthase subunit beta; Reviewed 99.72
PRK13028 402 tryptophan synthase subunit beta; Provisional 99.72
TIGR01275 311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 99.71
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 99.71
PRK14045 329 1-aminocyclopropane-1-carboxylate deaminase; Provi 99.71
PLN02618 410 tryptophan synthase, beta chain 99.71
KOG1250 457 consensus Threonine/serine dehydratases [Amino aci 99.71
PRK03910 331 D-cysteine desulfhydrase; Validated 99.7
PRK12390 337 1-aminocyclopropane-1-carboxylate deaminase; Provi 99.66
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 99.66
cd06449 307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 99.64
TIGR01274 337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 99.62
COG0498 411 ThrC Threonine synthase [Amino acid transport and 99.57
cd01560 460 Thr-synth_2 Threonine synthase catalyzes the final 98.99
PRK09225 462 threonine synthase; Validated 98.87
KOG1395 477 consensus Tryptophan synthase beta chain [Amino ac 98.39
COG0133 396 TrpB Tryptophan synthase beta chain [Amino acid tr 98.02
COG1350 432 Predicted alternative tryptophan synthase beta-sub 97.94
COG3048 443 DsdA D-serine dehydratase [Amino acid transport an 96.0
COG2515 323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 89.28
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.95  E-value=3.1e-28  Score=195.15  Aligned_cols=91  Identities=40%  Similarity=0.532  Sum_probs=85.6

Q ss_pred             HHhhhcccCCCceeEcCCccCCCCceEEEEeCCCCCCCCccchHHHHHHHHHHHcCCCCCCCccccccEEEEeCccHHHh
Q 033857            8 KKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPILLL   87 (110)
Q Consensus         8 ~~~i~~~ig~TPLv~~~~l~~~~~~~i~~KlE~~nPtGS~KdR~A~~~i~~a~~~G~~~~g~~~~~~~~vi~~SsGN~g~   87 (110)
                      ++++.+.+|+|||++++++....+++||+|+|++||+||+|||.|++||++|+++|.|+||+      +|||+||||+|+
T Consensus         2 ~~~~~~~iG~TPlvrL~~~~~~~~~~i~~KlE~~NP~gSvKDR~A~~mI~~Ae~~G~l~pG~------tIVE~TSGNTGI   75 (300)
T COG0031           2 YESILDLIGNTPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDRIALYMIEDAEKRGLLKPGG------TIVEATSGNTGI   75 (300)
T ss_pred             ccchHHHhCCCCcEeecccCCCCCceEEEEhhhcCCCCchhHHHHHHHHHHHHHcCCCCCCC------EEEEcCCChHHH
Confidence            46788999999999999998877899999999999999999999999999999999999998      999999999998


Q ss_pred             h--------cCcEEEEecCCCcccc
Q 033857           88 K--------ILRVSCVFQDFCSNWV  104 (110)
Q Consensus        88 a--------g~~~~iv~p~~~~~~~  104 (110)
                      +        |+++++|||++.+.+-
T Consensus        76 ~LA~vaa~~Gy~~iivmP~~~S~er  100 (300)
T COG0031          76 ALAMVAAAKGYRLIIVMPETMSQER  100 (300)
T ss_pred             HHHHHHHHcCCcEEEEeCCCCCHHH
Confidence            5        9999999999988764

>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
1z7w_A 322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-25
2isq_A 320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-25
1z7y_A 322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 5e-25
4aec_A 430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-22
3vbe_A 344 Crystal Structure Of Beta-Cyanoalanine Synthase In 6e-21
3vc3_A 344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 3e-20
2q3d_A 313 2.2 A Resolution Crystal Structure Of O-acetylserin 1e-14
2q3b_A 313 1.8 A Resolution Crystal Structure Of O-Acetylserin 7e-14
3rr2_A 314 Structure Of A Cysteine Synthase (O-Acetylserine Su 8e-13
4i1y_A 314 The Structure Of Cysteine Synthase From Mycobacteri 3e-12
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 3e-12
2egu_A 308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 9e-12
1ve1_A 304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 3e-10
1oas_A 322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 2e-08
4air_A 354 Leishmania Major Cysteine Synthase Length = 354 3e-08
1d6s_A 322 Crystal Structure Of The K41a Mutant Of O-Acetylser 9e-08
3t4p_A 334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 1e-07
2jc3_A 303 Structure Of O-acetylserine Sulfhydrylase B From Sa 2e-07
2bhs_A 303 Crystal Structure Of Cysteine Synthase B Length = 3 6e-07
1jbq_A 435 Structure Of Human Cystathionine Beta-Synthase: A U 7e-07
1m54_A 363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 2e-06
2bht_A 303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 2e-06
3dwg_A 325 Crystal Structure Of A Sulfur Carrier Protein Compl 3e-06
3dwi_A 323 Crystal Structure Of Mycobacterium Tuberculosis Cys 3e-06
2v03_A 303 High Resolution Structure And Catalysis Of An O- Ac 3e-06
3dki_A 326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 1e-05
3fca_A 291 Genetic Incorporation Of A Metal-Ion Chelating Amin 2e-05
1o58_A 303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 3e-05
2pqm_A 343 Crystal Structure Of Cysteine Synthase (Oass) From 5e-05
3bm5_A 338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 5e-05
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%)
Query: 5  CEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGL 64
            I KDVTELIG+TP+VYLNNV +GCV  +AAKLEMM+PCSSVKDRI +SMI DAE KGL
Sbjct: 3  SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGL 62
Query: 65 ITPGKCFCFQST 76
          I PG+    + T
Sbjct: 63 IKPGESVLIEPT 74
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
2q3b_A 313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 2e-40
4aec_A 430 Cysteine synthase, mitochondrial; lyase, cysteine 2e-40
1z7w_A 322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 2e-40
3tbh_A 334 O-acetyl serine sulfhydrylase; cysteine synthase, 2e-38
1ve1_A 304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-37
1y7l_A 316 O-acetylserine sulfhydrylase, O-acetylserine (thio 1e-36
2egu_A 308 Cysteine synthase; O-acetylserine sulfhydrase, str 2e-36
2pqm_A 343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 4e-35
2v03_A 303 Cysteine synthase B; pyridoxal phosphate, cysteine 1e-32
1o58_A 303 O-acetylserine sulfhydrylase; TM0665, structural g 8e-32
3dwg_A 325 Cysteine synthase B; sulfur carrier protein comple 1e-29
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-26
1jbq_A 435 B, cystathionine beta-synthase, serine sulfhydrase 9e-26
1wkv_A 389 Cysteine synthase; homodimer, open alpha/beta fold 5e-22
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
 Score =  135 bits (342), Expect = 2e-40
 Identities = 36/79 (45%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 4  KCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKG 63
             I +D+T+LIG TP+V L  V DG VA I AKLE   P +SVKDRI  +M++ AE  G
Sbjct: 3  HMSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAG 62

Query: 64 LITPGKCFCFQSTLI--TS 80
          LI P       + ++  TS
Sbjct: 63 LIKPD------TIILEPTS 75
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
3vc3_A 344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 99.96
3dwg_A 325 Cysteine synthase B; sulfur carrier protein comple 99.92
2q3b_A 313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 99.91
1y7l_A 316 O-acetylserine sulfhydrylase, O-acetylserine (thio 99.91
2egu_A 308 Cysteine synthase; O-acetylserine sulfhydrase, str 99.91
3tbh_A 334 O-acetyl serine sulfhydrylase; cysteine synthase, 99.91
1z7w_A 322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 99.91
2v03_A 303 Cysteine synthase B; pyridoxal phosphate, cysteine 99.91
4aec_A 430 Cysteine synthase, mitochondrial; lyase, cysteine 99.91
2pqm_A 343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 99.9
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.9
1ve1_A 304 O-acetylserine sulfhydrylase; PLP, transferase, ri 99.89
1jbq_A 435 B, cystathionine beta-synthase, serine sulfhydrase 99.89
3l6b_A 346 Serine racemase; pyridoxal phosphate, PLP, isomera 99.89
1ve5_A 311 Threonine deaminase; riken structural genomics/Pro 99.87
1o58_A 303 O-acetylserine sulfhydrylase; TM0665, structural g 99.85
2gn0_A 342 Threonine dehydratase catabolic; TDCB, biodegradat 99.85
3aey_A 351 Threonine synthase; PLP, pyridoxal phosphate, lyas 99.85
1v71_A 323 Serine racemase, hypothetical protein C320.14 in c 99.85
2d1f_A 360 Threonine synthase; amino acid synthesis, pyridoxa 99.85
2zsj_A 352 Threonine synthase; PLP dependent enzyme, lyase; H 99.84
4h27_A 364 L-serine dehydratase/L-threonine deaminase; PLP de 99.84
2rkb_A 318 Serine dehydratase-like; PLP bound enzyme, enzyme 99.84
1p5j_A 372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 99.83
3ss7_X 442 D-serine dehydratase; type II fold, ALFA,beta-elim 99.83
3iau_A 366 Threonine deaminase; pyridoxal phosphate, amino-ac 99.82
1v8z_A 388 Tryptophan synthase beta chain 1; beta+alpha, rike 99.81
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 99.81
4d9b_A 342 D-cysteine desulfhydrase; fold type II PLP-depende 99.8
1tzj_A 338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 99.8
1f2d_A 341 1-aminocyclopropane-1-carboxylate deaminase; carbo 99.8
4d9i_A 398 Diaminopropionate ammonia-lyase; fold type II PLP- 99.8
1qop_B 396 Tryptophan synthase beta chain; lyase, carbon-oxyg 99.79
1wkv_A 389 Cysteine synthase; homodimer, open alpha/beta fold 99.79
1j0a_A 325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 99.77
2o2e_A 422 Tryptophan synthase beta chain; amino-acid biosynt 99.75
1x1q_A 418 Tryptophan synthase beta chain; structural genomic 99.75
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 99.74
1kl7_A 514 Threonine synthase; threonine synthesis, pyridoxal 99.69
4f4f_A 468 Threonine synthase; structural genomics, niaid, na 99.57
1vb3_A 428 Threonine synthase; PLP-dependent enzyme, lyase; H 99.52
3v7n_A 487 Threonine synthase; ssgcid, structural genomics, s 99.49
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=99.96  E-value=1.4e-29  Score=201.58  Aligned_cols=97  Identities=47%  Similarity=0.688  Sum_probs=89.7

Q ss_pred             hhhhHHhhhcccCCCceeEcCCccCCCCceEEEEeCCCCCCCCccchHHHHHHHHHHHcCCCCCCCccccccEEEEeCcc
Q 033857            4 KCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKP   83 (110)
Q Consensus         4 ~~~~~~~i~~~ig~TPLv~~~~l~~~~~~~i~~KlE~~nPtGS~KdR~A~~~i~~a~~~G~~~~g~~~~~~~~vi~~SsG   83 (110)
                      ..+|+++|.++||+|||+++++|++..+++||+|+|++||+||||||+|+++|.+|+++|.+++|+     .+||++|+|
T Consensus        22 ~~~i~~~i~~lIG~TPLv~~~~Ls~~~G~~IylK~E~lnptGSfK~RgA~~~i~~a~~~g~l~~g~-----~~Vv~aSsG   96 (344)
T 3vc3_A           22 STNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNLITPGK-----TTLIEPTSG   96 (344)
T ss_dssp             CCSCBSSGGGGSCCCCEEECCSTTTTCCSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHTTCCCTTT-----CEEEEECSS
T ss_pred             hhhhhccHhhhcCCCceEECcccchhhCCEEEEEecCCCCCCCcHHHHHHHHHHHHHHcCCCCCCC-----CEEEEeCCc
Confidence            356889999999999999999999988999999999999999999999999999999999999985     379999999


Q ss_pred             HHHhh--------cCcEEEEecCCCccccc
Q 033857           84 ILLLK--------ILRVSCVFQDFCSNWVY  105 (110)
Q Consensus        84 N~g~a--------g~~~~iv~p~~~~~~~~  105 (110)
                      |||++        |++++||||++++...+
T Consensus        97 N~g~alA~~aa~~G~~~~IvmP~~~~~~k~  126 (344)
T 3vc3_A           97 NMGISMAFMAAMKGYKMVLTMPSYTSLERR  126 (344)
T ss_dssp             HHHHHHHHHHHHHTCEEEEEEETTSCHHHH
T ss_pred             HHHHHHHHHHHHcCCcEEEEECCCChHHHH
Confidence            99985        99999999999887654
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1z7wa1 320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 3e-25
d1y7la1 310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 2e-22
d1fcja_ 302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 2e-20
d1ve1a1 302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 1e-19
d2bhsa1 292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 2e-19
d1jbqa_ 355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 2e-18
d1o58a_ 293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 5e-16
d1tdja1 331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 1e-13
d1v71a1 318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 6e-12
d1ve5a1 310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 8e-12
d1wkva1 382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 4e-11
d1j0aa_ 325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-10
d1v7ca_ 351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 3e-10
d1e5xa_ 477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 2e-09
d1f2da_ 341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 7e-09
d1tyza_ 338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-08
d1p5ja_ 319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 1e-08
d1qopb_ 390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 2e-06
d1v8za1 386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 4e-05
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 94.6 bits (234), Expect = 3e-25
 Identities = 49/70 (70%), Positives = 57/70 (81%)

Query: 7  IKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLIT 66
          I KDVTELIG+TP+VYLNNV +GCV  +AAKLEMM+PCSSVKDRI +SMI DAE KGLI 
Sbjct: 3  IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 62

Query: 67 PGKCFCFQST 76
          PG+    + T
Sbjct: 63 PGESVLIEPT 72
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1z7wa1 320 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.95
d2bhsa1 292 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.95
d1y7la1 310 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.94
d1jbqa_ 355 Cystathionine beta-synthase {Human (Homo sapiens) 99.94
d1fcja_ 302 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.93
d1ve1a1 302 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.93
d1ve5a1 310 Threonine deaminase {Thermus thermophilus [TaxId: 99.92
d1o58a_ 293 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.9
d1v71a1 318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 99.89
d1wkva1 382 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.89
d1p5ja_ 319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 99.88
d1tdja1 331 Threonine deaminase {Escherichia coli [TaxId: 562] 99.86
d1v7ca_ 351 Threonine synthase {Thermus thermophilus [TaxId: 2 99.85
d1qopb_ 390 Tryptophan synthase, beta-subunit {Salmonella typh 99.82
d1e5xa_ 477 Threonine synthase {Mouse-ear cress (Arabidopsis t 99.82
d1v8za1 386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 99.82
d1tyza_ 338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 99.78
d1f2da_ 341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.75
d1j0aa_ 325 1-aminocyclopropane-1-carboxylate deaminase {Archa 99.75
d1vb3a1 428 Threonine synthase {Escherichia coli [TaxId: 562]} 98.4
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 95.2
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.95  E-value=1.1e-28  Score=191.77  Aligned_cols=95  Identities=56%  Similarity=0.799  Sum_probs=87.4

Q ss_pred             hhHHhhhcccCCCceeEcCCccCCCCceEEEEeCCCCCCCCccchHHHHHHHHHHHcCCCCCCCccccccEEEEeCccHH
Q 033857            6 EIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKCFCFQSTLITSTKPIL   85 (110)
Q Consensus         6 ~~~~~i~~~ig~TPLv~~~~l~~~~~~~i~~KlE~~nPtGS~KdR~A~~~i~~a~~~G~~~~g~~~~~~~~vi~~SsGN~   85 (110)
                      +|.++|.++||+|||++++++.+..+++||+|+|++|||||||||+|+++|.+|+++|.++++.     .+||++||||+
T Consensus         2 ~i~~~i~~~iG~TPLv~~~~l~~~~g~~i~~K~E~~nptGSfKdRgA~~~i~~a~~~g~~~~~~-----~~vv~aSsGN~   76 (320)
T d1z7wa1           2 RIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGE-----SVLIEPTSGNT   76 (320)
T ss_dssp             CCCSSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTT-----CEEEEECSSHH
T ss_pred             chhhhhhhhcCCCCeEECCCcccccCCEEEEEeCCCCCccCcHHHHHHHHHHHHHHcCCCCCCC-----ceEEeeCCchH
Confidence            5778999999999999999999888899999999999999999999999999999999887764     37999999999


Q ss_pred             Hhh--------cCcEEEEecCCCccccc
Q 033857           86 LLK--------ILRVSCVFQDFCSNWVY  105 (110)
Q Consensus        86 g~a--------g~~~~iv~p~~~~~~~~  105 (110)
                      |++        |+++++|||++++...+
T Consensus        77 g~a~A~~a~~~g~~~~iv~p~~~~~~k~  104 (320)
T d1z7wa1          77 GVGLAFTAAAKGYKLIITMPASMSTERR  104 (320)
T ss_dssp             HHHHHHHHHHHTCEEEEEEETTSCHHHH
T ss_pred             HHHHHHHHHhhccceEEeehhhhhhhhh
Confidence            985        99999999999987654
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure