Citrus Sinensis ID: 034117


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MKGAKGKGAARVSQEALKPNDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAVSI
ccccccccccHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccc
ccccccccHHHHHHHHccccHHccccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccc
mkgakgkgaarvsqealkpndrkvgkRKAATAkldsgskrqgkrekkakkdpnkpkrppsaFFVFLEEFRKTFkkenpnvtaVSAVgkaaggkwksmspavsi
mkgakgkgaarvsqealkpndrkvgkrkaatakldsgskrqgkrekkakkdpnkpkrppsAFFVFLEEFRKTfkkenpnvtavsavgkaaggkwksmspavsi
MKGAKGKGAARVSQEALKPNDRKVGKRKAATAKLDSGSkrqgkrekkakkdpnkpkrppSAFFVFLEEFRKTFKKENPNvtavsavgkaaggkwkSMSPAVSI
************************************************************AFFVFLEEFRKTFK*****************************
**********************************************************PSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSM******
********************************************************RPPSAFFVFLEEFRKTFKKENPNVTAVSAVG****************
***************************************************PNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGAKGKGAARVSQEALKPNDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAVSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
O49595178 High mobility group B pro yes no 0.941 0.544 0.712 9e-30
P26585152 HMG1/2-like protein OS=Gl no no 0.524 0.355 0.796 1e-17
Q42344138 High mobility group B pro no no 0.757 0.565 0.479 6e-17
P40619144 HMG1/2-like protein OS=Ip N/A no 0.563 0.402 0.655 3e-16
P27347157 DNA-binding protein MNB1B N/A no 0.776 0.509 0.539 3e-16
O49596144 High mobility group B pro no no 0.533 0.381 0.727 5e-16
P40620149 HMG1/2-like protein OS=Vi N/A no 0.475 0.328 0.673 2e-14
P93047141 High mobility group B pro no no 0.611 0.446 0.619 3e-14
P40621161 HMG1/2-like protein OS=Tr N/A no 0.776 0.496 0.504 5e-13
O49597125 High mobility group B pro no no 0.621 0.512 0.531 2e-12
>sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 81/101 (80%), Gaps = 4/101 (3%)

Query: 1   MKGAKGKGAARVSQEALKP-NDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPP 59
           MK AKGK   + ++EALKP +DRKVGKRKA   K    +KR+ ++EKKAKKDPNKPKR P
Sbjct: 1   MKTAKGKDKVKTTKEALKPVDDRKVGKRKAPAEK---PTKRETRKEKKAKKDPNKPKRAP 57

Query: 60  SAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPA 100
           SAFFVFLE+FR TFKKENPNV AVSAVGKA G KWKSMS A
Sbjct: 58  SAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQA 98




Binds preferentially double-stranded DNA. Modulates general plant growth and stress tolerance. Confers sensitivity to salt and genotoxic (methyl methanesulfonate, MMS) stresses.
Arabidopsis thaliana (taxid: 3702)
>sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 Back     alignment and function description
>sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 Back     alignment and function description
>sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 Back     alignment and function description
>sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 Back     alignment and function description
>sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 Back     alignment and function description
>sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 Back     alignment and function description
>sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
449521910112 PREDICTED: high mobility group B protein 0.990 0.910 0.759 4e-33
449461783169 PREDICTED: high mobility group B protein 0.961 0.585 0.752 7e-32
312281849185 unnamed protein product [Thellungiella h 0.941 0.524 0.702 8e-29
297819892185 hypothetical protein ARALYDRAFT_323737 [ 0.941 0.524 0.712 1e-28
42572635185 high mobility group protein B1 [Arabidop 0.941 0.524 0.712 2e-28
255574381171 DNA-binding protein MNB1B, putative [Ric 0.961 0.578 0.772 3e-28
15231065178 high mobility group protein B1 [Arabidop 0.941 0.544 0.712 4e-28
334185909161 high mobility group protein B1 [Arabidop 0.941 0.602 0.712 4e-28
224112525176 high mobility group family [Populus tric 0.961 0.562 0.686 7e-27
224098541179 high mobility group family [Populus tric 0.961 0.553 0.656 4e-26
>gi|449521910|ref|XP_004167972.1| PREDICTED: high mobility group B protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/104 (75%), Positives = 88/104 (84%), Gaps = 2/104 (1%)

Query: 1   MKGAKGKGAARVSQEALKP-NDRKVGKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPP 59
           MKG+KGKG +RVS+EALKP +DRKVGKRKA   K D G KR  K++ KAKKDPNKPKRPP
Sbjct: 1   MKGSKGKGTSRVSKEALKPVDDRKVGKRKAVV-KADKGIKRPTKKDLKAKKDPNKPKRPP 59

Query: 60  SAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAVSI 103
           SAFFVFLEEFRK +K+ENPNV AVSAVGKA G KWKS+S AVSI
Sbjct: 60  SAFFVFLEEFRKEYKRENPNVKAVSAVGKAGGEKWKSLSHAVSI 103




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449461783|ref|XP_004148621.1| PREDICTED: high mobility group B protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|312281849|dbj|BAJ33790.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|297819892|ref|XP_002877829.1| hypothetical protein ARALYDRAFT_323737 [Arabidopsis lyrata subsp. lyrata] gi|297323667|gb|EFH54088.1| hypothetical protein ARALYDRAFT_323737 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42572635|ref|NP_974413.1| high mobility group protein B1 [Arabidopsis thaliana] gi|222423104|dbj|BAH19531.1| AT3G51880 [Arabidopsis thaliana] gi|332645335|gb|AEE78856.1| high mobility group protein B1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255574381|ref|XP_002528104.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223532493|gb|EEF34283.1| DNA-binding protein MNB1B, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15231065|ref|NP_190756.1| high mobility group protein B1 [Arabidopsis thaliana] gi|145332807|ref|NP_001078269.1| high mobility group protein B1 [Arabidopsis thaliana] gi|75274976|sp|O49595.1|HMGB1_ARATH RecName: Full=High mobility group B protein 1; AltName: Full=High mobility group protein A; Short=AtHMGalpha; Short=HMG alpha; AltName: Full=Nucleosome/chromatin assembly factor group D 01; Short=Nucleosome/chromatin assembly factor group D 1 gi|2832357|emb|CAA74400.1| HMG protein [Arabidopsis thaliana] gi|3068715|gb|AAC14415.1| unknown [Arabidopsis thaliana] gi|15912191|gb|AAL08229.1| At3g51880/ORF13 [Arabidopsis thaliana] gi|21360557|gb|AAM47475.1| At3g51880/ORF13 [Arabidopsis thaliana] gi|332645334|gb|AEE78855.1| high mobility group protein B1 [Arabidopsis thaliana] gi|332645336|gb|AEE78857.1| high mobility group protein B1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185909|ref|NP_001190062.1| high mobility group protein B1 [Arabidopsis thaliana] gi|332645337|gb|AEE78858.1| high mobility group protein B1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224112525|ref|XP_002316220.1| high mobility group family [Populus trichocarpa] gi|222865260|gb|EEF02391.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098541|ref|XP_002311212.1| high mobility group family [Populus trichocarpa] gi|222851032|gb|EEE88579.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
TAIR|locus:505006135144 HMGB2 "high mobility group B2" 0.184 0.131 0.842 6.1e-08
TAIR|locus:2053893138 HMGB4 "high mobility group B4" 0.194 0.144 0.75 1.2e-07
TAIR|locus:2128003125 HMGB5 "high mobility group B5" 0.194 0.16 0.6 0.00017
TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 90 (36.7 bits), Expect = 6.1e-08, Sum P(2) = 6.1e-08
 Identities = 16/19 (84%), Positives = 19/19 (100%)

Query:    60 SAFFVFLEEFRKTFKKENP 78
             SAFFVF+E+FR+TFKKENP
Sbjct:    43 SAFFVFMEDFRETFKKENP 61


GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0000785 "chromatin" evidence=TAS
GO:0003682 "chromatin binding" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA;TAS
GO:0030527 "structural constituent of chromatin" evidence=TAS
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0003677 "DNA binding" evidence=ISS;IDA
TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O49595HMGB1_ARATHNo assigned EC number0.71280.94170.5449yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 9e-10
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 8e-09
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 3e-08
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 2e-07
smart0039870 smart00398, HMG, high mobility group 1e-06
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 2e-05
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 1e-04
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 0.004
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
 Score = 49.9 bits (120), Expect = 9e-10
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 55  PKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAV 101
           PKRP SAFF+F +E R   K ENP +   + + K  G KWK++S   
Sbjct: 1   PKRPLSAFFLFSQEQRAKLKAENPGLK-NAEISKILGEKWKNLSEEE 46


Length = 69

>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
PTZ0019994 high mobility group protein; Provisional 99.8
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.65
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.63
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.62
COG5648211 NHP6B Chromatin-associated proteins containing the 99.59
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.58
smart0039870 HMG high mobility group. 99.57
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.55
KOG038196 consensus HMG box-containing protein [General func 99.47
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.46
KOG0527 331 consensus HMG-box transcription factor [Transcript 99.44
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 99.28
KOG0528 511 consensus HMG-box transcription factor SOX5 [Trans 98.71
KOG3248 421 consensus Transcription factor TCF-4 [Transcriptio 98.66
KOG4715 410 consensus SWI/SNF-related matrix-associated actin- 98.4
KOG2746 683 consensus HMG-box transcription factor Capicua and 97.69
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 97.22
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 96.22
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 95.92
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 95.04
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 92.98
PF04769 201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 92.82
COG5648211 NHP6B Chromatin-associated proteins containing the 87.99
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
Probab=99.80  E-value=1e-19  Score=120.86  Aligned_cols=62  Identities=40%  Similarity=0.670  Sum_probs=55.4

Q ss_pred             ccccccccCCCCCCCCCCCchhHhHHHHHHHHHHHhCCCCC-cHHHHHHHHHHHhhCCCcccc
Q 034117           41 QGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVT-AVSAVGKAAGGKWKSMSPAVS  102 (103)
Q Consensus        41 ~~~k~kkk~kdp~~PKRP~say~lF~~e~R~~ik~e~P~~~-s~~eisK~lge~Wk~Ls~eER  102 (103)
                      .+++++++.+|||.|+||+||||+|++++|..|..+||++. ++.+|+++||++|+.||++||
T Consensus         9 ~~k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~ige~Wk~ls~eeK   71 (94)
T PTZ00199          9 LVRKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKMVGEAWNKLSEEEK   71 (94)
T ss_pred             cccccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHHHHHHHHcCCHHHH
Confidence            34455667789999999999999999999999999999983 389999999999999999886



>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
1hme_A77 High mobility group protein fragment-B; DNA-bindin 7e-14
2lhj_A97 High mobility group protein homolog NHP1; structur 1e-13
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 3e-13
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 3e-13
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 5e-13
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 3e-12
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 3e-12
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 7e-12
1wgf_A90 Upstream binding factor 1; transcription factor, D 2e-11
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 5e-11
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 8e-11
2yrq_A 173 High mobility group protein B1; HMG box domain, DN 4e-10
2yrq_A173 High mobility group protein B1; HMG box domain, DN 3e-08
1ckt_A71 High mobility group 1 protein; high-mobility group 2e-09
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 5e-09
2gzk_A 159 Sex-determining region on Y / HMGB1; protein-DNA c 1e-08
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 7e-06
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 6e-08
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 6e-08
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 1e-07
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 2e-07
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 4e-07
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 6e-07
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 6e-06
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 1e-05
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 2e-05
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 4e-05
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 9e-05
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 2e-04
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 3e-04
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
 Score = 60.3 bits (147), Expect = 7e-14
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 50  KDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPA 100
           KDPN PKRPPSAFF+F  E+R   K E+P ++ +  V K  G  W + +  
Sbjct: 2   KDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLS-IGDVAKKLGEMWNNTAAD 51


>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.83
2lhj_A97 High mobility group protein homolog NHP1; structur 99.81
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.8
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.8
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.79
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.79
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.79
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.79
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.78
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.77
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.77
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.75
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.75
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.74
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.74
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.73
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.72
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.72
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.72
1ckt_A71 High mobility group 1 protein; high-mobility group 99.71
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.71
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.71
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.71
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.71
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.7
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.7
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.68
2yrq_A 173 High mobility group protein B1; HMG box domain, DN 99.66
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.63
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.63
2cto_A93 Novel protein; high mobility group box domain, hel 99.6
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.59
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.58
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 99.56
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 99.56
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.52
2gzk_A 159 Sex-determining region on Y / HMGB1; protein-DNA c 99.48
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.43
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.42
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
Probab=99.83  E-value=7.5e-21  Score=123.70  Aligned_cols=58  Identities=31%  Similarity=0.575  Sum_probs=54.1

Q ss_pred             cccccCCCCCCCCCCCchhHhHHHHHHHHHHHhCCCCCcHHHHHHHHHHHhhCCCcccc
Q 034117           44 REKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAVS  102 (103)
Q Consensus        44 k~kkk~kdp~~PKRP~say~lF~~e~R~~ik~e~P~~~s~~eisK~lge~Wk~Ls~eER  102 (103)
                      +.+++.+||+.|+||+|||||||+++|..|+.+||++ ++.||+++||++|++|+++||
T Consensus        10 k~~k~~kdp~~pKrP~say~lF~~~~r~~~k~~~P~~-~~~eisk~lg~~Wk~ls~eeK   67 (90)
T 1wgf_A           10 SQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPEL-SESELTRLLARMWNDLSEKKK   67 (90)
T ss_dssp             CSCCCSSCCCCCCCCCCHHHHHHHHTHHHHHHHCTTS-CHHHHHHHHHHHHHHSCHHHH
T ss_pred             CcCcCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHHhCCHHHH
Confidence            4456678999999999999999999999999999999 699999999999999999886



>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 6e-09
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-07
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 3e-07
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 9e-07
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-06
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 2e-06
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 3e-06
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 4e-06
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 2e-05
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 2e-04
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 0.001
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 46.8 bits (111), Expect = 6e-09
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 39  KRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMS 98
           +   KR  + KKDPN PKR  SA+  F  E R   + ENP++T    VGK  G KWK+++
Sbjct: 5   REPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDIT-FGQVGKKLGEKWKALT 63

Query: 99  PA 100
           P 
Sbjct: 64  PE 65


>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.77
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.74
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.74
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.73
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.7
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.66
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.65
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.48
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.45
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.77  E-value=3.5e-19  Score=115.05  Aligned_cols=59  Identities=44%  Similarity=0.804  Sum_probs=54.4

Q ss_pred             ccccccCCCCCCCCCCCchhHhHHHHHHHHHHHhCCCCCcHHHHHHHHHHHhhCCCcccc
Q 034117           43 KREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAAGGKWKSMSPAVS  102 (103)
Q Consensus        43 ~k~kkk~kdp~~PKRP~say~lF~~e~R~~ik~e~P~~~s~~eisK~lge~Wk~Ls~eER  102 (103)
                      ++..+..+||+.||||+||||||++++|..|+.+||++ ++.+|++.||++|++||++||
T Consensus         9 k~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~~-~~~ei~k~l~~~W~~ls~~eK   67 (93)
T d1lwma_           9 KRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDI-TFGQVGKKLGEKWKALTPEEK   67 (93)
T ss_dssp             SCCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTTS-CHHHHHHHHHHHHHTSCHHHH
T ss_pred             CccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCCC-cHHHHHHHHHHHHHhCCHHHH
Confidence            45555668999999999999999999999999999999 699999999999999999986



>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure