Citrus Sinensis ID: 034227

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV
cccHHHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHccEEEEEccHHHHHHcccccccEEcccEEEEccccccccHHHHHHHHHHccccccEEc
ccccHHHHHHHHHHHHHHHHHccccccccEccHHHHHHHHHccccEEEEccHHHHHccccccccEEEEcEEEEccccccccHHHHHHHHHHccccccEEc
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLEsgygyldvrtaeefKEGHVDAakifnipymfntpegrvknpdFLKKVRSLCkeedrlvv
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMfntpegrvknpdFLKKVrslckeedrlvv
MGVSRNWVTflrglfllllICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV
****RNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLK**************
********TFLRGLFLLLLICRS******TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV
**VSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEED*LVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
F4IPI4156 Rhodanese-like domain-con no no 0.9 0.576 0.479 2e-21
Q9FKW8136 Thiosulfate sulfurtransfe no no 0.74 0.544 0.608 3e-21
Q8RUD6169 Rhodanese-like domain-con no no 0.72 0.426 0.581 4e-17
Q38853182 Rhodanese-like domain-con no no 0.69 0.379 0.436 5e-12
P27626183 Senescence-associated pro N/A no 0.69 0.377 0.422 1e-11
Q39129120 Thiosulfate sulfurtransfe no no 0.69 0.575 0.464 3e-11
>sp|F4IPI4|STR17_ARATH Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana GN=STR17 PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 64/98 (65%), Gaps = 8/98 (8%)

Query: 11  LRGLFLLLLI--------CRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDA 62
           LR   LL ++           S  +VIT+DV  A+ LL+SGY +LDVRT EEFK+GHVD+
Sbjct: 7   LRSFLLLFIVFNHLPRTTTSMSEPKVITIDVNQAQKLLDSGYTFLDVRTVEEFKKGHVDS 66

Query: 63  AKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV 100
             +FN+PY   TP+G+  NP+FLK V SLC + D L++
Sbjct: 67  ENVFNVPYWLYTPQGQEINPNFLKHVSSLCNQTDHLIL 104

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FKW8|STR18_ARATH Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana GN=STR18 PE=1 SV=1 Back     alignment and function description
>sp|Q8RUD6|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1 Back     alignment and function description
>sp|Q38853|STR15_ARATH Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana GN=STR15 PE=2 SV=1 Back     alignment and function description
>sp|P27626|DIN1_RAPSA Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q39129|STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
224133664134 predicted protein [Populus trichocarpa] 0.79 0.589 0.734 2e-28
255577542 577 zinc finger protein, putative [Ricinus c 0.77 0.133 0.779 2e-27
356559276157 PREDICTED: senescence-associated protein 0.79 0.503 0.683 4e-26
356496631149 PREDICTED: thiosulfate sulfurtransferase 0.9 0.604 0.595 2e-25
357483815145 Thiosulfate sulfurtransferase [Medicago 0.99 0.682 0.58 7e-25
358248854149 uncharacterized protein LOC100803436 pre 0.9 0.604 0.606 2e-24
225431104129 PREDICTED: thiosulfate sulfurtransferase 0.79 0.612 0.632 6e-24
357518001131 Thiosulfate sulfurtransferase [Medicago 0.79 0.603 0.658 1e-23
351722436158 uncharacterized protein LOC100305809 [Gl 0.79 0.5 0.632 3e-23
388521019150 unknown [Lotus japonicus] 1.0 0.666 0.574 6e-23
>gi|224133664|ref|XP_002327650.1| predicted protein [Populus trichocarpa] gi|222836735|gb|EEE75128.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (88%)

Query: 22  RSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKN 81
           +S+GAEV+TVDV+A K LLESGY YLDVRT EE+ +GHVD  KIFNIPY+FNTPEGRVKN
Sbjct: 6   KSTGAEVVTVDVKATKGLLESGYTYLDVRTVEEYNKGHVDGEKIFNIPYLFNTPEGRVKN 65

Query: 82  PDFLKKVRSLCKEEDRLVV 100
           P+FLK+V  +CKEED+L+V
Sbjct: 66  PNFLKEVSGVCKEEDKLLV 84

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577542|ref|XP_002529649.1| zinc finger protein, putative [Ricinus communis] gi|223530875|gb|EEF32736.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356559276|ref|XP_003547926.1| PREDICTED: senescence-associated protein DIN1-like [Glycine max] Back     alignment and taxonomy information
>gi|356496631|ref|XP_003517169.1| PREDICTED: thiosulfate sulfurtransferase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357483815|ref|XP_003612194.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|355513529|gb|AES95152.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|388513883|gb|AFK45003.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248854|ref|NP_001240207.1| uncharacterized protein LOC100803436 precursor [Glycine max] gi|255638114|gb|ACU19371.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225431104|ref|XP_002265009.1| PREDICTED: thiosulfate sulfurtransferase, chloroplastic [Vitis vinifera] gi|297734996|emb|CBI17358.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357518001|ref|XP_003629289.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|355523311|gb|AET03765.1| Thiosulfate sulfurtransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|351722436|ref|NP_001236988.1| uncharacterized protein LOC100305809 [Glycine max] gi|255626667|gb|ACU13678.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388521019|gb|AFK48571.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
TAIR|locus:2827795156 AT2G17850 "AT2G17850" [Arabido 0.77 0.493 0.558 4.4e-20
TAIR|locus:2156882138 STR18 "AT5G66170" [Arabidopsis 0.74 0.536 0.608 5.7e-20
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.72 0.426 0.581 1.2e-17
UNIPROTKB|B2C7Y6185 NRIP1 "Chloroplast N receptor- 0.69 0.372 0.478 7.1e-13
TAIR|locus:2128038182 SEN1 "AT4G35770" [Arabidopsis 0.69 0.379 0.450 1.5e-12
TAIR|locus:2156937120 STR16 "AT5G66040" [Arabidopsis 0.69 0.575 0.464 3.5e-11
TAIR|locus:2059999 234 AT2G42220 "AT2G42220" [Arabido 0.46 0.196 0.34 2.6e-05
TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 4.4e-20, P = 4.4e-20
 Identities = 43/77 (55%), Positives = 58/77 (75%)

Query:    24 SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPD 83
             S  +VIT+DV  A+ LL+SGY +LDVRT EEFK+GHVD+  +FN+PY   TP+G+  NP+
Sbjct:    28 SEPKVITIDVNQAQKLLDSGYTFLDVRTVEEFKKGHVDSENVFNVPYWLYTPQGQEINPN 87

Query:    84 FLKKVRSLCKEEDRLVV 100
             FLK V SLC + D L++
Sbjct:    88 FLKHVSSLCNQTDHLIL 104
GO:0003674 "molecular_function" evidence=ND
GO:0007568 "aging" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0001666 "response to hypoxia" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] Back     alignment and assigned GO terms
TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059999 AT2G42220 "AT2G42220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_570170
hypothetical protein (134 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
PLN02160136 PLN02160, PLN02160, thiosulfate sulfurtransferase 9e-31
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 4e-04
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 0.001
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 0.001
>gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase Back     alignment and domain information 
 Score =  105 bits (263), Expect = 9e-31
 Identities = 45/74 (60%), Positives = 58/74 (78%)

Query: 27  EVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLK 86
           EV++VDV  AK LL+SG+ YLDVRT +EF+ GH +AAKI NIPYM NTP+GRVKN +FL+
Sbjct: 13  EVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLE 72

Query: 87  KVRSLCKEEDRLVV 100
           +V SL    D ++V
Sbjct: 73  QVSSLLNPADDILV 86

Length = 136
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.49
PLN02160136 thiosulfate sulfurtransferase 99.41
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.34
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.31
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.28
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.27
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.25
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.23
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.23
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.22
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.21
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.17
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.14
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.14
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.12
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.12
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.12
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.11
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.11
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.09
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.07
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.06
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.0
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.0
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 98.96
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 98.95
PLN02723320 3-mercaptopyruvate sulfurtransferase 98.93
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 98.92
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 98.91
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 98.87
PRK01415247 hypothetical protein; Validated 98.84
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 98.84
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 98.83
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 98.81
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 98.8
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 98.8
PRK05320257 rhodanese superfamily protein; Provisional 98.8
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 98.8
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 98.76
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 98.76
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 98.76
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 98.75
PRK07411390 hypothetical protein; Validated 98.74
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 98.74
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 98.72
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 98.72
PLN02723 320 3-mercaptopyruvate sulfurtransferase 98.66
PRK05600370 thiamine biosynthesis protein ThiF; Validated 98.55
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 98.51
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 98.49
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 98.46
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 98.44
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 98.43
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 98.08
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 97.72
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 97.35
COG1054 308 Predicted sulfurtransferase [General function pred 97.12
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 96.95
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 96.17
COG5105 427 MIH1 Mitotic inducer, protein phosphatase [Cell di 95.65
COG2603 334 Predicted ATPase [General function prediction only 95.63
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 93.12
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 92.47
KOG1093725 consensus Predicted protein kinase (contains TBC a 88.47
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 82.59
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 81.13
COG1891 235 Uncharacterized protein conserved in archaea [Func 81.01
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.49  E-value=5.8e-14  Score=92.40  Aligned_cols=73  Identities=41%  Similarity=0.653  Sum_probs=64.0

Q ss_pred             CCcceeCHHHHHHHhhC-CCeEEecCChhhHhccCCCCCCeeeeccccCCCCCCCCCHHHHHHHHhhc-CCCCceeC
Q 034227           26 AEVITVDVRAAKNLLES-GYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLC-KEEDRLVV  100 (100)
Q Consensus        26 ~~~~~i~~~e~~~~~~~-~~~lIDvR~~~e~~~ghIp~~gA~~ip~~~~~~~g~~~~~~~~~~~~~~~-~~~~~viv  100 (100)
                      ..+..++.++++.+++. +.++||||+|+||.+||+|  .++|||+....++|.+++++|.+.+.... +.+++||+
T Consensus        20 ~~~~sv~~~qvk~L~~~~~~~llDVRepeEfk~gh~~--~siNiPy~~~~~~~~l~~~eF~kqvg~~kp~~d~eiIf   94 (136)
T KOG1530|consen   20 SNPQSVSVEQVKNLLQHPDVVLLDVREPEEFKQGHIP--ASINIPYMSRPGAGALKNPEFLKQVGSSKPPHDKEIIF   94 (136)
T ss_pred             CCcEEEEHHHHHHHhcCCCEEEEeecCHHHhhccCCc--ceEeccccccccccccCCHHHHHHhcccCCCCCCcEEE
Confidence            56788999999999984 5999999999999999999  99999998888899999999999988754 34668774

>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 2e-11
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 2/71 (2%)
Query: 30  TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
           +V V  A +LL +G+ YLDVRT EEF +GH  A    N+PYM     G  KN DFL++V 
Sbjct: 19  SVSVTVAHDLLLAGHRYLDVRTPEEFSQGH--ACGAINVPYMNRGASGMSKNTDFLEQVS 76
Query: 90  SLCKEEDRLVV 100
           S   + D ++V
Sbjct: 77  SHFGQSDNIIV 87

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1tq1_A129 AT5G66040, senescence-associated family protein; C 3e-18
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 4e-08
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 1e-06
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 1e-05
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 1e-05
2jtq_A85 Phage shock protein E; solution structure rhodanes 1e-05
3foj_A100 Uncharacterized protein; protein SSP1007, structur 1e-05
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 1e-05
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 2e-05
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 2e-05
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-05
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 3e-05
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 4e-05
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 5e-05
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 1e-04
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-04
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 3e-04
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 5e-04
3r2u_A466 Metallo-beta-lactamase family protein; structural 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 8e-04
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 8e-04
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score = 72.8 bits (179), Expect = 3e-18
 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 30  TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
           +V V  A +LL +G+ YLDVRT EEF +GH   A   N+PYM     G  KN DFL++V 
Sbjct: 19  SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAI--NVPYMNRGASGMSKNTDFLEQVS 76

Query: 90  SLCKEEDRLVV 100
           S   + D ++V
Sbjct: 77  SHFGQSDNIIV 87
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.55
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.52
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.49
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.44
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.43
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.41
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.37
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.34
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.26
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.26
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.24
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.24
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.21
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.2
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.2
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.19
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.18
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.17
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.16
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.16
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.16
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.15
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.15
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.14
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.14
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.13
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.13
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.13
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.11
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.09
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.08
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.06
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.05
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.05
1vee_A134 Proline-rich protein family; hypothetical protein, 99.03
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.03
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.02
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.02
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.01
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.01
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.0
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 98.98
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 98.98
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 98.97
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 98.97
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 98.96
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 98.94
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 98.93
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 98.91
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 98.9
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 98.89
3op3_A216 M-phase inducer phosphatase 3; structural genomics 98.89
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 98.88
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 98.87
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 98.86
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.81
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 98.8
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 98.7
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 98.62
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 98.61
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 98.53
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.51
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 98.49
3r2u_A 466 Metallo-beta-lactamase family protein; structural 98.42
1v8c_A168 MOAD related protein; riken structural genomics/pr 94.85
2f46_A156 Hypothetical protein; structural genomics, joint c 94.6
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
Probab=99.55  E-value=6e-15  Score=95.23  Aligned_cols=75  Identities=41%  Similarity=0.625  Sum_probs=62.6

Q ss_pred             cCCCcceeCHHHHHHHhhCCCeEEecCChhhHhccCCCCCCeeeeccccCCCCCCCCCHHHHHHHHhhcCCCCceeC
Q 034227           24 SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV  100 (100)
Q Consensus        24 ~~~~~~~i~~~e~~~~~~~~~~lIDvR~~~e~~~ghIp~~gA~~ip~~~~~~~g~~~~~~~~~~~~~~~~~~~~viv  100 (100)
                      .....+.|+++++.++++++.+|||||+++||+.||||  ||+|+|+..+..+|.+.+.++.++..+.++++++||+
T Consensus        13 ~~~~~~~is~~e~~~~l~~~~~lIDvR~~~e~~~ghIp--gAinip~~~~~~~~~~~~~~~~~~~~~~l~~~~~ivv   87 (129)
T 1tq1_A           13 ESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHAC--GAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIV   87 (129)
T ss_dssp             CSCCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBT--TBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEE
T ss_pred             hcCCCcccCHHHHHHHhcCCCEEEECCCHHHHhcCCCC--CcEECcHhhcccccccCCHHHHHHHHhhCCCCCeEEE
Confidence            44577899999999988767899999999999999999  9999999766666777766777776555788899875
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 7e-12
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 4e-04
d1s0aa_ 429 c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona 0.002
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 54.9 bits (131), Expect = 7e-12
 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 30  TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
           +V V  A +LL +G+ YLDVRT EEF +GH   A   N+PYM     G  KN DFL++V 
Sbjct: 9   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAI--NVPYMNRGASGMSKNTDFLEQVS 66

Query: 90  SLCKEEDRLVV 100
           S   + D ++V
Sbjct: 67  SHFGQSDNIIV 77
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.53
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.46
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.41
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.38
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.33
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.28
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.25
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.23
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.2
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.19
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.17
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.15
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.14
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.14
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.14
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 98.85
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 98.81
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 98.74
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]

Probab=99.53  E-value=5.8e-15  Score=91.48  Aligned_cols=62  Identities=18%  Similarity=0.250  Sum_probs=52.8

Q ss_pred             CCCcceeCHHHHHHHhh-CCCeEEecCChhhHhccCCCCCCeeeeccccCCCCCCCCCHHHHHHHHhhcCCCCceeC
Q 034227           25 GAEVITVDVRAAKNLLE-SGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVV  100 (100)
Q Consensus        25 ~~~~~~i~~~e~~~~~~-~~~~lIDvR~~~e~~~ghIp~~gA~~ip~~~~~~~g~~~~~~~~~~~~~~~~~~~~viv  100 (100)
                      |..++.||++|+.++++ ++.+|||||++.||+.||||  ||+|+|.+           ++.+.+.+ ++++++||+
T Consensus         1 m~~~~~Is~~e~~~~l~~~~~~liDvR~~~e~~~ghI~--gA~~ip~~-----------~l~~~~~~-~~~~~~ivv   63 (108)
T d1gmxa_           1 MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAV--QAFHLTND-----------TLGAFMRD-NDFDTPVMV   63 (108)
T ss_dssp             CCSCEEECHHHHHHHHHTTCCEEEECSCHHHHHHCEET--TCEECCHH-----------HHHHHHHH-SCTTSCEEE
T ss_pred             CCCCCEeCHHHHHHHHHCCCeEEEECCCHHHHHhcCCC--Ccccccch-----------hHHHHhhh-ccccCcccc
Confidence            45789999999999998 57999999999999999999  99999985           55555554 788998875
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure