Citrus Sinensis ID: 034447
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 94 | ||||||
| 255576798 | 672 | pentatricopeptide repeat-containing prot | 0.904 | 0.126 | 0.705 | 9e-28 | |
| 359486048 | 659 | PREDICTED: pentatricopeptide repeat-cont | 0.904 | 0.128 | 0.670 | 2e-26 | |
| 1931651 | 652 | membrane-associated salt-inducible prote | 0.893 | 0.128 | 0.670 | 5e-25 | |
| 145335386 | 664 | pentatricopeptide repeat-containing prot | 0.893 | 0.126 | 0.670 | 6e-25 | |
| 297843920 | 665 | hypothetical protein ARALYDRAFT_888388 [ | 0.893 | 0.126 | 0.658 | 1e-24 | |
| 449446895 | 668 | PREDICTED: pentatricopeptide repeat-cont | 0.904 | 0.127 | 0.623 | 8e-24 | |
| 224058965 | 562 | predicted protein [Populus trichocarpa] | 0.872 | 0.145 | 0.670 | 2e-19 | |
| 357135236 | 644 | PREDICTED: pentatricopeptide repeat-cont | 0.904 | 0.131 | 0.470 | 1e-18 | |
| 218188463 | 647 | hypothetical protein OsI_02428 [Oryza sa | 0.904 | 0.131 | 0.470 | 7e-18 | |
| 297597021 | 690 | Os01g0559500 [Oryza sativa Japonica Grou | 0.904 | 0.123 | 0.458 | 1e-17 |
| >gi|255576798|ref|XP_002529286.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531275|gb|EEF33118.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 127 bits (319), Expect = 9e-28, Method: Compositional matrix adjust.
Identities = 60/85 (70%), Positives = 73/85 (85%)
Query: 1 MQQHGKTSISSYSSYIKFLGKNGNSLKALEIYNSITDESDKVNVFICNLILSCLVRNGKF 60
MQQH K S+SSY+SY+KF+GK+ N KALEIYNSI DES K NVFICN +LSCLVR+GKF
Sbjct: 138 MQQHSKISVSSYTSYMKFMGKSLNPAKALEIYNSIADESVKNNVFICNSVLSCLVRSGKF 197
Query: 61 ESSLKLFDKIKQSGLTPDAVTYNTV 85
+ SLKLF K+KQ+GLTPD +TY+T+
Sbjct: 198 DISLKLFHKMKQNGLTPDTITYSTL 222
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359486048|ref|XP_002270184.2| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Vitis vinifera] gi|298204537|emb|CBI23812.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|1931651|gb|AAB65486.1| membrane-associated salt-inducible protein isolog; 88078-84012 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145335386|ref|NP_172560.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122242678|sp|Q0WVV0.1|PPR31_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g10910, chloroplastic; Flags: Precursor gi|110741600|dbj|BAE98748.1| membrane-associated salt-inducible protein isolog [Arabidopsis thaliana] gi|332190541|gb|AEE28662.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297843920|ref|XP_002889841.1| hypothetical protein ARALYDRAFT_888388 [Arabidopsis lyrata subsp. lyrata] gi|297335683|gb|EFH66100.1| hypothetical protein ARALYDRAFT_888388 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449446895|ref|XP_004141206.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224058965|ref|XP_002299667.1| predicted protein [Populus trichocarpa] gi|222846925|gb|EEE84472.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357135236|ref|XP_003569217.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|218188463|gb|EEC70890.1| hypothetical protein OsI_02428 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|297597021|ref|NP_001043343.2| Os01g0559500 [Oryza sativa Japonica Group] gi|255673364|dbj|BAF05257.2| Os01g0559500 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 94 | ||||||
| TAIR|locus:2197424 | 664 | EMB3103 "EMBRYO DEFECTIVE 3103 | 0.893 | 0.126 | 0.6 | 1.9e-21 | |
| TAIR|locus:2027166 | 862 | PTAC2 "plastid transcriptional | 0.712 | 0.077 | 0.343 | 1.4e-06 | |
| TAIR|locus:504956171 | 650 | ABO5 "ABA Overly-Sensitive 5" | 0.702 | 0.101 | 0.318 | 4.3e-06 | |
| TAIR|locus:2077061 | 619 | AT3G22470 "AT3G22470" [Arabido | 0.712 | 0.108 | 0.298 | 5.2e-06 | |
| TAIR|locus:2174008 | 974 | AT5G61990 "AT5G61990" [Arabido | 0.691 | 0.066 | 0.384 | 5.6e-06 | |
| TAIR|locus:2116772 | 1112 | PGR3 "AT4G31850" [Arabidopsis | 0.702 | 0.059 | 0.348 | 6.6e-06 | |
| TAIR|locus:2082727 | 851 | AT3G54980 [Arabidopsis thalian | 0.617 | 0.068 | 0.372 | 1.3e-05 | |
| TAIR|locus:2049465 | 497 | AT2G36240 "AT2G36240" [Arabido | 0.691 | 0.130 | 0.338 | 2.8e-05 | |
| TAIR|locus:2177028 | 816 | AT5G12100 [Arabidopsis thalian | 0.680 | 0.078 | 0.312 | 3.3e-05 | |
| TAIR|locus:2060226 | 624 | AT2G32630 "AT2G32630" [Arabido | 0.606 | 0.091 | 0.350 | 4.9e-05 |
| TAIR|locus:2197424 EMB3103 "EMBRYO DEFECTIVE 3103" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 260 (96.6 bits), Expect = 1.9e-21, P = 1.9e-21
Identities = 51/85 (60%), Positives = 61/85 (71%)
Query: 1 MQQHGKTXXXXXXXXXKFLGKNGNSLKALEIYNSITDESDKVNVFICNLILSCLVRNGKF 60
MQQHGK KF+G N KALEIY SI DES K+NV+ICN ILSCLV+NGK
Sbjct: 124 MQQHGKISVSTYSSCIKFVGAK-NVSKALEIYQSIPDESTKINVYICNSILSCLVKNGKL 182
Query: 61 ESSLKLFDKIKQSGLTPDAVTYNTV 85
+S +KLFD++K+ GL PD VTYNT+
Sbjct: 183 DSCIKLFDQMKRDGLKPDVVTYNTL 207
|
|
| TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956171 ABO5 "ABA Overly-Sensitive 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082727 AT3G54980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049465 AT2G36240 "AT2G36240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177028 AT5G12100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060226 AT2G32630 "AT2G32630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00026521001 | SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (644 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 94 | |||
| pfam13041 | 50 | pfam13041, PPR_2, PPR repeat family | 1e-10 | |
| TIGR00756 | 35 | TIGR00756, PPR, pentatricopeptide repeat domain (P | 3e-06 | |
| PLN03218 | 1060 | PLN03218, PLN03218, maturation of RBCL 1; Provisio | 5e-05 | |
| pfam13812 | 34 | pfam13812, PPR_3, Pentatricopeptide repeat domain | 6e-04 | |
| pfam01535 | 31 | pfam01535, PPR, PPR repeat | 0.001 |
| >gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family | Back alignment and domain information |
|---|
Score = 51.3 bits (124), Expect = 1e-10
Identities = 14/43 (32%), Positives = 27/43 (62%)
Query: 43 NVFICNLILSCLVRNGKFESSLKLFDKIKQSGLTPDAVTYNTV 85
+V N ++ + GK E +LKLF+++K+ G+ P+ TY+ +
Sbjct: 2 DVVTYNTLIDGYCKKGKVEEALKLFNEMKKRGIKPNVYTYSIL 44
|
This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50 |
| >gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|144943 pfam01535, PPR, PPR repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.88 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.87 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.84 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.84 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.84 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.82 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.82 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.78 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.53 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.4 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 99.21 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 99.17 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 99.17 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 99.14 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 99.02 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 99.01 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 98.96 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 98.95 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 98.79 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 98.64 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 98.62 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 98.44 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 98.35 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 98.25 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.18 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.08 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 97.98 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 97.93 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 97.93 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.91 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 97.81 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.7 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.64 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.48 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.47 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.35 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 97.28 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.17 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.87 | |
| PF13762 | 145 | MNE1: Mitochondrial splicing apparatus component | 96.85 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.74 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 96.7 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.64 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.63 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.58 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.54 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 96.42 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.4 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.29 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.27 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.26 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.23 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.2 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 96.14 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 96.12 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 96.11 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 96.08 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.0 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 95.99 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 95.98 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 95.81 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 95.81 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 95.81 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 95.66 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 95.66 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 95.65 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.55 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 95.48 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 95.42 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 95.36 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 95.36 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 95.34 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 95.24 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 95.24 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.23 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 95.2 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 95.15 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.86 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 94.71 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 94.61 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 94.6 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 94.6 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 94.53 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.47 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.47 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 94.33 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 94.3 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 94.29 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 94.2 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 94.11 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 94.07 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 94.03 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.03 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 93.99 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.93 | |
| PF13929 | 292 | mRNA_stabil: mRNA stabilisation | 93.88 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 93.83 | |
| KOG4570 | 418 | consensus Uncharacterized conserved protein [Funct | 93.77 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.68 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 93.64 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 93.62 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 93.57 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 93.51 | |
| PF09205 | 161 | DUF1955: Domain of unknown function (DUF1955); Int | 93.46 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 93.45 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 93.34 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 93.31 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 93.24 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 93.13 | |
| PF11848 | 48 | DUF3368: Domain of unknown function (DUF3368); Int | 92.97 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 92.95 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 92.85 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 92.8 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 92.76 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 92.74 | |
| cd00923 | 103 | Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. | 92.7 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 92.66 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 92.49 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 92.37 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 92.35 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 92.31 | |
| PF02284 | 108 | COX5A: Cytochrome c oxidase subunit Va; InterPro: | 92.28 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 92.28 | |
| PF11848 | 48 | DUF3368: Domain of unknown function (DUF3368); Int | 92.16 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 92.07 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 92.02 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 91.98 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 91.91 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 91.91 | |
| PF02284 | 108 | COX5A: Cytochrome c oxidase subunit Va; InterPro: | 91.88 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 91.72 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 91.71 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 91.68 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 91.65 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 91.39 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 91.38 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 91.35 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 91.13 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 91.05 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 91.03 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 91.01 | |
| cd00923 | 103 | Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. | 90.95 | |
| TIGR02508 | 115 | type_III_yscG type III secretion protein, YscG fam | 90.92 | |
| PF14689 | 62 | SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do | 90.92 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 90.58 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 90.41 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 90.38 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 90.31 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 90.25 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 90.25 | |
| PRK10564 | 303 | maltose regulon periplasmic protein; Provisional | 90.01 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 89.63 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 89.28 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 89.15 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 89.11 | |
| PF11663 | 140 | Toxin_YhaV: Toxin with endonuclease activity YhaV; | 89.08 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 89.02 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 88.96 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 88.91 | |
| KOG4567 | 370 | consensus GTPase-activating protein [General funct | 88.37 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 88.29 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 88.28 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 88.05 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 87.93 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 87.84 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 87.76 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 87.75 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 87.56 | |
| PF11663 | 140 | Toxin_YhaV: Toxin with endonuclease activity YhaV; | 87.52 | |
| PF13170 | 297 | DUF4003: Protein of unknown function (DUF4003) | 87.43 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 87.32 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 87.02 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 86.84 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 86.59 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 86.42 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 86.36 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 86.3 | |
| PRK10564 | 303 | maltose regulon periplasmic protein; Provisional | 86.29 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 85.56 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 85.54 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 85.14 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 85.13 | |
| PF12926 | 88 | MOZART2: Mitotic-spindle organizing gamma-tubulin | 85.1 | |
| KOG4077 | 149 | consensus Cytochrome c oxidase, subunit Va/COX6 [E | 85.09 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 84.98 | |
| PF14840 | 125 | DNA_pol3_delt_C: Processivity clamp loader gamma c | 84.41 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 84.35 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 84.33 | |
| PF13762 | 145 | MNE1: Mitochondrial splicing apparatus component | 84.31 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 83.83 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 83.33 | |
| COG5108 | 1117 | RPO41 Mitochondrial DNA-directed RNA polymerase [T | 82.67 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 82.61 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 82.48 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 82.02 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 81.92 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 81.68 | |
| PF02847 | 113 | MA3: MA3 domain; InterPro: IPR003891 This entry re | 81.57 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 81.56 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 81.13 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 81.03 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 80.36 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 80.21 | |
| KOG4570 | 418 | consensus Uncharacterized conserved protein [Funct | 80.17 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 80.13 |
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
Probab=99.88 E-value=6.3e-22 Score=140.99 Aligned_cols=89 Identities=18% Similarity=0.382 Sum_probs=66.2
Q ss_pred cccC-CccHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCchHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCccHH
Q 034447 2 QQHG-KTSISSYSSYIKFLGKNGNSLKALEIYNSITDESDKVNVFICNLILSCLVRNGKFESSLKLFDKIKQSGLTPDAV 80 (94)
Q Consensus 2 ~~~~-~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~ 80 (94)
.+.+ .||..+||++|.+|++.|++++|.++|++|.+.|+.||..||+++|.+|++.|++++|.++|++|.+.|+.||.+
T Consensus 464 ~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~v 543 (1060)
T PLN03218 464 QEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRV 543 (1060)
T ss_pred HHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHH
Confidence 3445 677777777777777777777777777777777777777777777777777777777777777777777777777
Q ss_pred HHHHHHHHhh
Q 034447 81 TYNTVYQSDH 90 (94)
Q Consensus 81 ~~~~ll~~~~ 90 (94)
+|++||++|+
T Consensus 544 TYnsLI~a~~ 553 (1060)
T PLN03218 544 VFNALISACG 553 (1060)
T ss_pred HHHHHHHHHH
Confidence 7777777744
|
|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13762 MNE1: Mitochondrial splicing apparatus component | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF13929 mRNA_stabil: mRNA stabilisation | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4570 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va | Back alignment and domain information |
|---|
| >TIGR02508 type_III_yscG type III secretion protein, YscG family | Back alignment and domain information |
|---|
| >PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10564 maltose regulon periplasmic protein; Provisional | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG4567 consensus GTPase-activating protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF | Back alignment and domain information |
|---|
| >PF13170 DUF4003: Protein of unknown function (DUF4003) | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10564 maltose regulon periplasmic protein; Provisional | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12926 MOZART2: Mitotic-spindle organizing gamma-tubulin ring associated; InterPro: IPR024332 The MOZART2 family of proteins (also known as FAM128 and Mitotic-spindle organizing protein 2) operate as part of the gamma-tubulin ring complex, gamma-TuRC, one of the complexes necessary for chromosome segregation | Back alignment and domain information |
|---|
| >KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF14840 DNA_pol3_delt_C: Processivity clamp loader gamma complex DNA pol III C-term; PDB: 3GLG_F 1XXH_A 3GLF_F 1JQJ_C 3GLI_F | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >PF13762 MNE1: Mitochondrial splicing apparatus component | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5108 RPO41 Mitochondrial DNA-directed RNA polymerase [Transcription] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4570 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 94 | |||
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 3e-10 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 2e-05 |
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 | Back alignment and structure |
|---|
Score = 54.1 bits (128), Expect = 3e-10
Identities = 14/85 (16%), Positives = 33/85 (38%), Gaps = 3/85 (3%)
Query: 6 KTSISSYSSYIKFLGKNGN---SLKALEIYNSITDESDKVNVFICNLILSCLVRNGKFES 62
++ K + L +++ + + + + N ++ R G F+
Sbjct: 124 SGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKE 183
Query: 63 SLKLFDKIKQSGLTPDAVTYNTVYQ 87
+ + +K +GLTPD ++Y Q
Sbjct: 184 LVYVLFMVKDAGLTPDLLSYAAALQ 208
|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.94 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.91 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.9 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.89 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.85 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.8 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.02 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.95 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.93 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.9 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.86 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.85 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.82 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.75 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.75 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.75 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.66 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.66 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.65 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.64 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.61 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.6 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.59 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.58 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.57 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.57 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.56 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.51 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.49 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.48 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.47 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.45 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.45 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.39 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.36 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.35 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.35 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.33 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.33 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.33 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.33 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.31 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.31 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.29 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.27 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.25 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.24 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.22 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.21 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.2 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.19 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.17 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.16 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.16 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.16 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.14 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.14 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.11 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.11 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.11 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.1 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.1 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.1 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.09 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.08 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.06 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.06 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.05 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.04 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.03 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.0 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.0 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.99 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 96.97 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.96 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.94 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.93 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.93 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 96.9 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.89 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.89 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 96.88 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.86 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.81 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.8 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.75 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.75 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.74 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.73 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.72 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.71 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.67 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.67 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 96.64 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 96.62 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.62 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 96.62 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.6 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.56 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.51 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.5 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 96.45 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.45 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 96.43 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.42 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 96.4 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 96.36 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 96.32 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.29 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.28 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.26 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.25 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.25 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 96.23 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.22 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.21 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.19 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 96.18 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 96.18 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 96.17 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.15 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.14 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.08 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 96.07 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 96.03 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.0 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.0 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.0 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 95.98 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 95.97 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 95.97 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 95.95 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.89 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.84 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.83 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.76 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 95.74 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 95.74 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 95.73 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 95.64 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 95.64 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 95.63 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 95.62 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.6 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 95.56 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 95.52 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 95.47 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.45 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.44 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 95.38 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 95.37 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.34 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.27 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.25 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 95.24 | |
| 2y69_E | 152 | Cytochrome C oxidase subunit 5A; electron transpor | 95.19 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 95.18 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 95.07 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 95.03 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 94.84 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 94.83 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 94.76 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 94.6 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.59 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 94.56 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 94.52 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 94.49 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 94.47 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 94.44 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 94.43 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 94.41 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 94.32 | |
| 1wy6_A | 172 | Hypothetical protein ST1625; helical repeat protei | 94.3 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 93.93 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 93.89 | |
| 1v54_E | 109 | Cytochrome C oxidase polypeptide VA; oxidoreductas | 93.65 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 93.6 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 93.4 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 93.29 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 92.94 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 92.92 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 92.89 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 92.89 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 92.87 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 92.85 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 92.75 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 92.63 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 92.48 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 92.33 | |
| 1v54_E | 109 | Cytochrome C oxidase polypeptide VA; oxidoreductas | 92.19 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 91.93 | |
| 2uwj_G | 115 | Type III export protein PSCG; virulence, chaperone | 91.36 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 91.32 | |
| 2p58_C | 116 | Putative type III secretion protein YSCG; type III | 91.11 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 90.38 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 90.32 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 88.99 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 88.76 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 88.67 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 88.33 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 88.3 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 88.07 | |
| 2y69_E | 152 | Cytochrome C oxidase subunit 5A; electron transpor | 87.59 | |
| 2ion_A | 152 | PDCD4, programmed cell death 4, PDCD4; alpha-helic | 87.43 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 87.42 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 86.85 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 86.85 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 86.22 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 85.16 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 84.79 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 83.79 | |
| 2nsz_A | 129 | Programmed cell death protein 4; PDCD4, tumor supp | 83.71 | |
| 3eiq_C | 358 | Programmed cell death protein 4; PDCD4, anti-oncog | 82.1 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 81.4 |
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
Probab=99.94 E-value=4.6e-26 Score=151.61 Aligned_cols=91 Identities=8% Similarity=0.096 Sum_probs=85.6
Q ss_pred CcccC-CccHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCchHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCccH
Q 034447 1 MQQHG-KTSISSYSSYIKFLGKNGNSLKALEIYNSITDESDKVNVFICNLILSCLVRNGKFESSLKLFDKIKQSGLTPDA 79 (94)
Q Consensus 1 M~~~~-~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~ 79 (94)
|.+.| .||..|||++|.+|++.|++++|.++|++|.+.|+.||..|||++|.+|++.|++++|.++|++|.+.|+.||.
T Consensus 96 M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~ 175 (501)
T 4g26_A 96 MIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEE 175 (501)
T ss_dssp HHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCH
T ss_pred HHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCH
Confidence 45566 89999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhhc
Q 034447 80 VTYNTVYQSDHI 91 (94)
Q Consensus 80 ~~~~~ll~~~~~ 91 (94)
.||++||++|++
T Consensus 176 ~ty~~Li~~~~~ 187 (501)
T 4g26_A 176 PELAALLKVSMD 187 (501)
T ss_dssp HHHHHHHHHHHH
T ss_pred HHHHHHHHHHhh
Confidence 999999999654
|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} | Back alignment and structure |
|---|
| >2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A | Back alignment and structure |
|---|
| >3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.99 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.19 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.18 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.13 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.07 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.05 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.03 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.03 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.03 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.02 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.8 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.8 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.67 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.67 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.65 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.62 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.6 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.34 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.32 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.17 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 96.06 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.05 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 95.97 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.9 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.61 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 95.4 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 95.27 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.96 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 94.51 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 94.43 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.35 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 94.28 | |
| d1v54e_ | 105 | Cytochrome c oxidase subunit E {Cow (Bos taurus) [ | 93.74 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 93.61 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.44 | |
| d1wy6a1 | 161 | Hypothetical protein ST1625 {Archaeon Sulfolobus t | 93.3 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 92.67 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 92.13 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 91.86 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 91.44 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 91.38 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 90.76 | |
| d1v54e_ | 105 | Cytochrome c oxidase subunit E {Cow (Bos taurus) [ | 90.75 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 89.64 | |
| d1ug3a1 | 193 | Eukaryotic initiation factor eIF4G {Human (Homo sa | 87.59 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 87.44 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 87.08 | |
| d2nsza1 | 129 | Programmed cell death 4, PDCD4 {Mouse (Mus musculu | 86.44 | |
| d1khda1 | 69 | Anthranilate phosphoribosyltransferase (TrpD) {Pec | 85.11 | |
| d1fkma2 | 188 | Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccha | 83.93 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 82.21 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 81.31 |
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: BTAD-like domain: Probable regulatory protein EmbR, middle domain species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=97.99 E-value=7e-05 Score=42.33 Aligned_cols=71 Identities=10% Similarity=0.134 Sum_probs=61.3
Q ss_pred HHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCchHHHHHHHHHHHHhcCCHHHHHHHHHHHHH-----cCCCccHHH
Q 034447 10 SSYSSYIKFLGKNGNSLKALEIYNSITDESDKVNVFICNLILSCLVRNGKFESSLKLFDKIKQ-----SGLTPDAVT 81 (94)
Q Consensus 10 ~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~g~~~~a~~~~~~m~~-----~g~~p~~~~ 81 (94)
..+..+...+.+.|++++|...++...... +-+...|..++.++.+.|+.++|++.|++..+ -|+.|+..+
T Consensus 68 ~a~~~la~~~~~~g~~~~Al~~~~~al~~~-P~~e~~~~~l~~al~~~Gr~~eAl~~y~~~~~~L~~eLG~~P~~~l 143 (179)
T d2ff4a2 68 LAHTAKAEAEIACGRASAVIAELEALTFEH-PYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTL 143 (179)
T ss_dssp HHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHSCCCCHHH
T ss_pred HHHHHHHHHHHHCCCchHHHHHHHHHHHhC-CccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhCCCcCHHH
Confidence 456778889999999999999999997642 23899999999999999999999999999754 499998866
|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|