Citrus Sinensis ID: 034454

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE
cccccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcc
cccccccccEEEEcccccccccccccHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcc
mpggnvgadhaifeqgasagnvgneklveqkkANPVALLLSSAMMlrhlqfpsFADRLETAVKRVISegkcrtkdlggsstTQEIVDAVIAALE
mpggnvgaDHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISegkcrtkdlggssttqeiVDAVIAALE
MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE
**********************************PVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKC**************VDAV*****
MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE
MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE
**GGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
O81796368 Isocitrate dehydrogenase yes no 1.0 0.255 0.882 3e-43
Q8LFC0367 Isocitrate dehydrogenase no no 1.0 0.256 0.861 4e-43
P93032367 Isocitrate dehydrogenase no no 1.0 0.256 0.829 1e-40
Q9LQK9294 Putative isocitrate dehyd no no 0.829 0.265 0.597 2e-20
O94229361 Isocitrate dehydrogenase yes no 0.957 0.249 0.473 1e-16
O13696356 Isocitrate dehydrogenase yes no 0.968 0.255 0.425 6e-14
O13302388 Isocitrate dehydrogenase N/A no 0.968 0.234 0.436 8e-14
Q93353379 Probable isocitrate dehyd yes no 0.925 0.229 0.422 1e-12
Q945K7374 Isocitrate dehydrogenase no no 0.882 0.221 0.444 1e-12
P28834360 Isocitrate dehydrogenase yes no 0.936 0.244 0.428 2e-12
>sp|O81796|IDH3_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial OS=Arabidopsis thaliana GN=IDH3 PE=1 SV=1 Back     alignment and function desciption
 Score =  173 bits (438), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (95%)

Query: 1   MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLET 60
           MPGGNVGA+HAIFEQGASAGNVGN+K+VEQKKANPVALLLSSAMMLRHL+FP+FADRLET
Sbjct: 275 MPGGNVGAEHAIFEQGASAGNVGNDKMVEQKKANPVALLLSSAMMLRHLRFPTFADRLET 334

Query: 61  AVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE 94
           AVK+VI EGK RTKDLGG  TTQE+VDAVIAALE
Sbjct: 335 AVKQVIKEGKYRTKDLGGDCTTQEVVDAVIAALE 368
Performs an essential role in the oxidative function of the citric acid cycle.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q8LFC0|IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana GN=IDH1 PE=1 SV=2 Back     alignment and function description
>sp|P93032|IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana GN=IDH2 PE=1 SV=2 Back     alignment and function description
>sp|Q9LQK9|IDH4_ARATH Putative isocitrate dehydrogenase [NAD] subunit-like 4 OS=Arabidopsis thaliana GN=IDH4 PE=5 SV=1 Back     alignment and function description
>sp|O94229|IDH1_KLULA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 Back     alignment and function description
>sp|O13696|IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 Back     alignment and function description
>sp|O13302|IDH1_AJECA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 Back     alignment and function description
>sp|Q93353|IDH3B_CAEEL Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C37E2.1 PE=3 SV=1 Back     alignment and function description
>sp|Q945K7|IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana GN=IDH5 PE=1 SV=1 Back     alignment and function description
>sp|P28834|IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
TAIR|locus:2127993368 IDH-III "isocitrate dehydrogen 1.0 0.255 0.882 1.8e-39
TAIR|locus:2122098367 IDH1 "isocitrate dehydrogenase 1.0 0.256 0.861 2.3e-39
TAIR|locus:2827696367 IDH2 "isocitrate dehydrogenase 1.0 0.256 0.829 3.9e-37
ASPGD|ASPL0000029618439 AN5790 [Emericella nidulans (t 0.968 0.207 0.446 2.3e-14
POMBASE|SPAC11G7.03356 idh1 "isocitrate dehydrogenase 0.968 0.255 0.425 2.7e-14
UNIPROTKB|I3L8X0312 LOC100624447 "Uncharacterized 0.957 0.288 0.430 2.1e-13
SGD|S000004982360 IDH1 "Subunit of mitochondrial 0.936 0.244 0.428 2.2e-13
UNIPROTKB|F1PTM3383 IDH3B "Uncharacterized protein 0.957 0.234 0.430 5.5e-13
UNIPROTKB|F1S897383 IDH3B "Isocitrate dehydrogenas 0.957 0.234 0.419 1.2e-12
UNIPROTKB|H9L0K2385 IDH3B "Uncharacterized protein 0.925 0.225 0.444 1.2e-12
TAIR|locus:2127993 IDH-III "isocitrate dehydrogenase III" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 421 (153.3 bits), Expect = 1.8e-39, P = 1.8e-39
 Identities = 83/94 (88%), Positives = 90/94 (95%)

Query:     1 MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLET 60
             MPGGNVGA+HAIFEQGASAGNVGN+K+VEQKKANPVALLLSSAMMLRHL+FP+FADRLET
Sbjct:   275 MPGGNVGAEHAIFEQGASAGNVGNDKMVEQKKANPVALLLSSAMMLRHLRFPTFADRLET 334

Query:    61 AVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE 94
             AVK+VI EGK RTKDLGG  TTQE+VDAVIAALE
Sbjct:   335 AVKQVIKEGKYRTKDLGGDCTTQEVVDAVIAALE 368
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0004449 "isocitrate dehydrogenase (NAD+) activity" evidence=IEA;IGI;ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006099 "tricarboxylic acid cycle" evidence=IEA;TAS
GO:0008152 "metabolic process" evidence=ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006102 "isocitrate metabolic process" evidence=IGI
GO:0048046 "apoplast" evidence=IDA
GO:0009853 "photorespiration" evidence=RCA
TAIR|locus:2122098 IDH1 "isocitrate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827696 IDH2 "isocitrate dehydrogenase subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000029618 AN5790 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC11G7.03 idh1 "isocitrate dehydrogenase (NAD+) subunit 1 Idh1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|I3L8X0 LOC100624447 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
SGD|S000004982 IDH1 "Subunit of mitochondrial NAD(+)-dependent isocitrate dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTM3 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S897 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0K2 IDH3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81796IDH3_ARATH1, ., 1, ., 1, ., 4, 10.88291.00.2554yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_660173
isocitrate dehydrogenase (NAD+) (EC-1.1.1.41) (371 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_VIII0421
hypothetical protein (1021 aa)
   • •• 0.918
estExt_Genewise1_v1.C_LG_X2288
hypothetical protein (1021 aa)
   • •• 0.918
gw1.XIV.3318.1
aconitate hydratase 1 (EC-4.2.1.3) (897 aa)
•    •• 0.903
estExt_fgenesh4_pg.C_LG_II2062
aconitate hydratase 1 (EC-4.2.1.3) (898 aa)
•    •• 0.902
eugene3.00570034
aconitate hydratase 1 (EC-4.2.1.3) (899 aa)
•    •• 0.902
eugene3.01810009
aconitate hydratase 1 (EC-4.2.1.3) (899 aa)
•    •• 0.902
grail3.0038019202
isocitrate dehydrogenase (NADP+) (415 aa)
     •  0.899
fgenesh4_pm.C_LG_VIII000318
isocitrate dehydrogenase (NADP+) (416 aa)
     •  0.899
fgenesh4_pm.C_LG_I000856
isocitrate dehydrogenase (NADP+) (401 aa)
     •  0.899
fgenesh4_pg.C_LG_X001588
isocitrate dehydrogenase (NADP+) (416 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
PLN00123360 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+ 1e-60
TIGR00175333 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, 5e-37
COG0473348 COG0473, LeuB, Isocitrate/isopropylmalate dehydrog 9e-24
PLN00118372 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+ 6e-20
PRK08997334 PRK08997, PRK08997, isocitrate dehydrogenase; Prov 8e-19
pfam00180349 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehy 6e-17
PRK00772358 PRK00772, PRK00772, 3-isopropylmalate dehydrogenas 1e-16
PRK14025330 PRK14025, PRK14025, multifunctional 3-isopropylmal 6e-16
TIGR02088322 TIGR02088, LEU3_arch, isopropylmalate/isohomocitra 3e-13
COG0538407 COG0538, Icd, Isocitrate dehydrogenases [Energy pr 4e-12
TIGR00169346 TIGR00169, leuB, 3-isopropylmalate dehydrogenase 1e-11
PRK03437344 PRK03437, PRK03437, 3-isopropylmalate dehydrogenas 1e-10
PRK09222 482 PRK09222, PRK09222, isocitrate dehydrogenase; Vali 6e-10
TIGR02089352 TIGR02089, TTC, tartrate dehydrogenase 2e-09
PRK08194352 PRK08194, PRK08194, tartrate dehydrogenase; Provis 2e-09
PRK07006409 PRK07006, PRK07006, isocitrate dehydrogenase; Revi 5e-08
TIGR00183416 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase 9e-07
PRK07362474 PRK07362, PRK07362, isocitrate dehydrogenase; Vali 3e-04
TIGR02924 473 TIGR02924, ICDH_alpha, isocitrate dehydrogenase 5e-04
>gnl|CDD|215065 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+) Back     alignment and domain information 
 Score =  188 bits (478), Expect = 1e-60
 Identities = 88/94 (93%), Positives = 92/94 (97%)

Query: 1   MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLET 60
           MPGGNVGADHA+FEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLET
Sbjct: 267 MPGGNVGADHAVFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLET 326

Query: 61  AVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE 94
           AVKRVI+EGK RTKDLGGSSTTQE+VDAVIA L+
Sbjct: 327 AVKRVIAEGKYRTKDLGGSSTTQEVVDAVIANLD 360

Length = 360
>gnl|CDD|232856 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information
>gnl|CDD|223549 COG0473, LeuB, Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215062 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|181606 PRK08997, PRK08997, isocitrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215773 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|234832 PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184462 PRK14025, PRK14025, multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233717 TIGR02088, LEU3_arch, isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>gnl|CDD|223612 COG0538, Icd, Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232853 TIGR00169, leuB, 3-isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|179579 PRK03437, PRK03437, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236416 PRK09222, PRK09222, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233718 TIGR02089, TTC, tartrate dehydrogenase Back     alignment and domain information
>gnl|CDD|181281 PRK08194, PRK08194, tartrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180792 PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|232862 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>gnl|CDD|180944 PRK07362, PRK07362, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|234062 TIGR02924, ICDH_alpha, isocitrate dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
COG0473348 LeuB Isocitrate/isopropylmalate dehydrogenase [Ami 100.0
PRK08997334 isocitrate dehydrogenase; Provisional 100.0
PRK14025330 multifunctional 3-isopropylmalate dehydrogenase/D- 100.0
KOG0785365 consensus Isocitrate dehydrogenase, alpha subunit 100.0
PLN00118372 isocitrate dehydrogenase (NAD+) 100.0
PLN00123360 isocitrate dehydrogenase (NAD+) 100.0
PRK08194352 tartrate dehydrogenase; Provisional 100.0
TIGR02089352 TTC tartrate dehydrogenase. Tartrate dehydrogenase 100.0
TIGR00175333 mito_nad_idh isocitrate dehydrogenase, NAD-depende 100.0
PLN02329409 3-isopropylmalate dehydrogenase 100.0
TIGR02924 473 ICDH_alpha isocitrate dehydrogenase. This family o 100.0
TIGR00169349 leuB 3-isopropylmalate dehydrogenase. This model w 100.0
PRK09222 482 isocitrate dehydrogenase; Validated 100.0
PRK06451412 isocitrate dehydrogenase; Validated 100.0
PRK07362474 isocitrate dehydrogenase; Validated 100.0
PRK07006409 isocitrate dehydrogenase; Reviewed 100.0
TIGR00183416 prok_nadp_idh isocitrate dehydrogenase, NADP-depen 100.0
PRK00772358 3-isopropylmalate dehydrogenase; Provisional 99.98
PF00180348 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; 99.97
PRK03437344 3-isopropylmalate dehydrogenase; Provisional 99.97
PRK08299402 isocitrate dehydrogenase; Validated 99.97
TIGR02088322 LEU3_arch isopropylmalate/isohomocitrate dehydroge 99.97
KOG0784375 consensus Isocitrate dehydrogenase, gamma subunit 99.96
PLN00103410 isocitrate dehydrogenase (NADP+); Provisional 99.96
PTZ00435413 isocitrate dehydrogenase; Provisional 99.95
TIGR00127409 nadp_idh_euk isocitrate dehydrogenase, NADP-depend 99.95
PLN00096393 isocitrate dehydrogenase (NADP+); Provisional 99.94
KOG0786363 consensus 3-isopropylmalate dehydrogenase [Amino a 99.93
PLN03065483 isocitrate dehydrogenase (NADP+); Provisional 99.93
COG0538407 Icd Isocitrate dehydrogenases [Energy production a 99.9
PF04166298 PdxA: Pyridoxal phosphate biosynthetic protein Pdx 97.88
PRK03371326 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 97.84
PRK00232332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 97.84
PRK05312336 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 97.81
PRK01909329 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 97.81
PRK03743332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 97.81
PRK02746345 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 97.77
TIGR00557320 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase. 97.77
PRK03946307 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 97.74
COG1995332 PdxA Pyridoxal phosphate biosynthesis protein [Coe 97.74
KOG1526422 consensus NADP-dependent isocitrate dehydrogenase 94.7
PF03971735 IDH: Monomeric isocitrate dehydrogenase; InterPro: 82.18
TIGR00178741 monomer_idh isocitrate dehydrogenase, NADP-depende 81.79
>COG0473 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3e-36  Score=233.42  Aligned_cols=90  Identities=44%  Similarity=0.649  Sum_probs=85.9

Q ss_pred             CCccccCCC--cceeeccccCCCCCcccccccCCCChHHHHHHHHHHHHhcCchHHHHHHHHHHHHHHHcCcccCCCCCC
Q 034454            1 MPGGNVGAD--HAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGG   78 (94)
Q Consensus         1 ~psanig~~--~a~fEp~~~~~HGsapdiAGk~iANP~a~ils~~mmL~~lg~~~~A~~i~~Av~~~l~~g~~~T~Dlgg   78 (94)
                      +||+|+|++  ++||||+    |||||||||||||||+|+|||++|||+|+|..++|++|++||+++|+++.++|+||||
T Consensus       255 ~PSAnig~~~~~~lfEPv----HGSAPDIAGkgiANPiA~IlS~aMML~~~g~~~~A~~Ie~Av~~vl~~~g~~T~Dlgg  330 (348)
T COG0473         255 APSANLGDERGPALFEPV----HGSAPDIAGKGIANPIATILSAAMMLRHLGEKEAADAIENAVEKVLAEGGIRTPDLGG  330 (348)
T ss_pred             CccCccCCCCCCceeecC----CCCcccccCCCccChHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHcCCCCCcccCC
Confidence            699999997  9999999    9999999999999999999999999999999999999999999999974489999999


Q ss_pred             CCCHHHHHHHHHHHhC
Q 034454           79 SSTTQEIVDAVIAALE   94 (94)
Q Consensus        79 ~~~T~~~~~~v~~~l~   94 (94)
                      +.+|.||+++|++.|.
T Consensus       331 ~~~T~e~~d~I~~~l~  346 (348)
T COG0473         331 NATTSEVGDAIAKALA  346 (348)
T ss_pred             CccHHHHHHHHHHHHh
Confidence            9999999999999873

>PRK08997 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14025 multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>KOG0785 consensus Isocitrate dehydrogenase, alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00118 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>PLN00123 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>PRK08194 tartrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02089 TTC tartrate dehydrogenase Back     alignment and domain information
>TIGR00175 mito_nad_idh isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information
>PLN02329 3-isopropylmalate dehydrogenase Back     alignment and domain information
>TIGR02924 ICDH_alpha isocitrate dehydrogenase Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK06451 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK07362 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK07006 isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00183 prok_nadp_idh isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>PRK00772 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PF00180 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; InterPro: IPR024084 Isocitrate dehydrogenase (IDH) [, ] is an important enzyme of carbohydrate metabolism which catalyses the oxidative decarboxylation of isocitrate into alpha-ketoglutarate Back     alignment and domain information
>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PRK08299 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR02088 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>KOG0784 consensus Isocitrate dehydrogenase, gamma subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00103 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>PTZ00435 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00127 nadp_idh_euk isocitrate dehydrogenase, NADP-dependent, eukaryotic type Back     alignment and domain information
>PLN00096 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>KOG0786 consensus 3-isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03065 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>COG0538 Icd Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PF04166 PdxA: Pyridoxal phosphate biosynthetic protein PdxA; InterPro: IPR005255 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK03371 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05312 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK03743 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02746 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00557 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase Back     alignment and domain information
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>KOG1526 consensus NADP-dependent isocitrate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF03971 IDH: Monomeric isocitrate dehydrogenase; InterPro: IPR004436 This family of enzymes catalyses the NADP(+)-dependent oxidative decarboxylation of isocitrate to form 2-oxoglutarate, CO2, and NADPH within the Krebs cycle (1 Back     alignment and domain information
>TIGR00178 monomer_idh isocitrate dehydrogenase, NADP-dependent, monomeric type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
3blw_A349 Yeast Isocitrate Dehydrogenase With Citrate And Amp 2e-13
3blv_A354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 3e-12
3blw_B354 Yeast Isocitrate Dehydrogenase With Citrate And Amp 3e-11
1x0l_A333 Crystal Structure Of Tetrameric Homoisocitrate Dehy 3e-10
3asj_A334 Crystal Structure Of Homoisocitrate Dehydrogenase I 3e-10
3ah3_A334 Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehyd 1e-09
3ty3_A366 Crystal Structure Of Homoisocitrate Dehydrogenase F 4e-09
1a05_A358 Crystal Structure Of The Complex Of 3-Isopropylmala 9e-08
2d1c_A 496 Crystal Structure Of Tt0538 Protein From Thermus Th 2e-07
1iso_A416 Isocitrate Dehydrogenase: Structure Of An Engineere 5e-06
3blv_B354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 9e-06
2d4v_A429 Crystal Structure Of Nad Dependent Isocitrate Dehyd 1e-05
4iwh_A363 Crystal Structure Of A 3-isopropylmalate Dehydrogen 2e-05
1wpw_A336 Crystal Structure Of Ipmdh From Sulfolobus Tokodaii 2e-05
3u1h_A390 Crystal Structure Of Ipmdh From The Last Common Anc 9e-05
1gro_A416 Regulatory And Catalytic Mechanisms In Escherichia 1e-04
1grp_A416 Regulatory And Catalytic Mechanisms In Escherichia 1e-04
1p8f_A416 A Four Location Model To Explain The Stereospecific 1e-04
1cw1_A416 Crystal Structure Of Isocitrate Dehydrogenase Mutan 1e-04
6icd_A416 Regulation Of An Enzyme By Phosphorylation At The A 1e-04
4ajb_A416 3d Structure Of E. Coli Isocitrate Dehydrogenase K1 1e-04
4icd_A416 Regulation Of Isocitrate Dehydrogenase By Phosphory 1e-04
1bl5_A414 Isocitrate Dehydrogenase From E. Coli Single Turnov 1e-04
1hj6_A416 Isocitrate Dehydrogenase S113e Mutant Complexed Wit 1e-04
1idd_A416 Isocitrate Dehydrogenase Y160f Mutant Apo Enzyme Le 1e-04
3fmx_X364 Crystal Structure Of Tartrate Dehydrogenase From Ps 1e-04
2iv0_A412 Thermal Stability Of Isocitrate Dehydrogenase From 2e-04
1cw7_A416 Low Temperature Structure Of Wild-Type Idh Complexe 3e-04
1vlc_A366 Crystal Structure Of 3-isopropylmalate Dehydrogenas 8e-04
1dr0_A346 Structure Of Modified 3-isopropylmalate Dehydrogena 9e-04
>pdb|3BLW|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/91 (42%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
Query: 3   GGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAV 62
           G N G D+A+FE G+   +VG + +  Q  ANP A++LSS +ML HL    +A R+  AV
Sbjct: 259 GANFGRDYAVFEPGSR--HVGLD-IKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAV 315
Query: 63  KRVISEGKCRTKDLGGSSTTQEIVDAVIAAL 93
              I+EGK  T+D+GGSS+T +  + +I  L
Sbjct: 316 HETIAEGKHTTRDIGGSSSTTDFTNEIINKL 346
>pdb|3BLV|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|3BLW|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|1X0L|A Chain A, Crystal Structure Of Tetrameric Homoisocitrate Dehydrogenase From An Extreme Thermophile, Thermus Thermophilus Length = 333 Back     alignment and structure
>pdb|3ASJ|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase In Complex With A Designed Inhibitor Length = 334 Back     alignment and structure
>pdb|3AH3|A Chain A, Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehydrogenase Created By Directed Evolution Length = 334 Back     alignment and structure
>pdb|3TY3|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase From Schizosaccharomyces Pombe Bound To Glycyl-Glycyl-Glycine Length = 366 Back     alignment and structure
>pdb|1A05|A Chain A, Crystal Structure Of The Complex Of 3-Isopropylmalate Dehydrogenase From Thiobacillus Ferrooxidans With 3- Isopropylmalate Length = 358 Back     alignment and structure
>pdb|2D1C|A Chain A, Crystal Structure Of Tt0538 Protein From Thermus Thermophilus Hb8 Length = 496 Back     alignment and structure
>pdb|1ISO|A Chain A, Isocitrate Dehydrogenase: Structure Of An Engineered Nadp+--> Nad+ Specificity-Reversal Mutant Length = 416 Back     alignment and structure
>pdb|3BLV|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|2D4V|A Chain A, Crystal Structure Of Nad Dependent Isocitrate Dehydrogenase From Acidithiobacillus Thiooxidans Length = 429 Back     alignment and structure
>pdb|4IWH|A Chain A, Crystal Structure Of A 3-isopropylmalate Dehydrogenase From Burkholderia Pseudomallei Length = 363 Back     alignment and structure
>pdb|1WPW|A Chain A, Crystal Structure Of Ipmdh From Sulfolobus Tokodaii Length = 336 Back     alignment and structure
>pdb|3U1H|A Chain A, Crystal Structure Of Ipmdh From The Last Common Ancestor Of Bacillus Length = 390 Back     alignment and structure
>pdb|1GRO|A Chain A, Regulatory And Catalytic Mechanisms In Escherichia Coli Isocitrate Dehydrogenase: Multiple Roles For N115 Length = 416 Back     alignment and structure
>pdb|1GRP|A Chain A, Regulatory And Catalytic Mechanisms In Escherichia Coli Isocitrate Dehydrogenase: Multiple Roles For N115 Length = 416 Back     alignment and structure
>pdb|1P8F|A Chain A, A Four Location Model To Explain The Stereospecificity Of Proteins. Length = 416 Back     alignment and structure
>pdb|1CW1|A Chain A, Crystal Structure Of Isocitrate Dehydrogenase Mutant K230m Bound To Isocitrate And Mn2+ Length = 416 Back     alignment and structure
>pdb|6ICD|A Chain A, Regulation Of An Enzyme By Phosphorylation At The Active Site Length = 416 Back     alignment and structure
>pdb|4AJB|A Chain A, 3d Structure Of E. Coli Isocitrate Dehydrogenase K100m Mutant In Complex With Isocitrate, Magnesium(Ii) And Thionadp Length = 416 Back     alignment and structure
>pdb|4ICD|A Chain A, Regulation Of Isocitrate Dehydrogenase By Phosphorylation Involves No Long-Range Conformational Change In The Free Enzyme Length = 416 Back     alignment and structure
>pdb|1BL5|A Chain A, Isocitrate Dehydrogenase From E. Coli Single Turnover Laue Structure Of Rate-limited Product Complex, 10 Msec Time Resolution Length = 414 Back     alignment and structure
>pdb|1HJ6|A Chain A, Isocitrate Dehydrogenase S113e Mutant Complexed With Isopropylmalate, Nadp+ And Magnesium (Flash-Cooled) Length = 416 Back     alignment and structure
>pdb|1IDD|A Chain A, Isocitrate Dehydrogenase Y160f Mutant Apo Enzyme Length = 416 Back     alignment and structure
>pdb|2IV0|A Chain A, Thermal Stability Of Isocitrate Dehydrogenase From Archaeoglobus Fulgidus Studied By Crystal Structure Analysis And Engineering Of Chimers Length = 412 Back     alignment and structure
>pdb|1CW7|A Chain A, Low Temperature Structure Of Wild-Type Idh Complexed With Mg- Isocitrate Length = 416 Back     alignment and structure
>pdb|1VLC|A Chain A, Crystal Structure Of 3-isopropylmalate Dehydrogenase (tm0556) From Thermotoga Maritima At 1.90 A Resolution Length = 366 Back     alignment and structure
>pdb|1DR0|A Chain A, Structure Of Modified 3-isopropylmalate Dehydrogenase At The C- Terminus, Hd708 Length = 346 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 4e-36
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 9e-32
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 1e-31
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 1e-31
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 2e-31
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 4e-30
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 3e-25
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 4e-24
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 6e-24
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 1e-23
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 2e-23
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 1e-21
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 9e-20
2y3z_A359 3-isopropylmalate dehydrogenase; oxidoreductase, L 3e-18
3udu_A361 3-isopropylmalate dehydrogenase; structural genomi 5e-17
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 4e-16
3r8w_A405 3-isopropylmalate dehydrogenase 2, chloroplastic; 4e-16
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 4e-16
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 7e-16
3vmk_A375 3-isopropylmalate dehydrogenase; oxidoreductase, d 8e-16
3u1h_A390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 1e-15
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 4e-15
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, co 2e-06
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 3e-06
4aoy_A402 Isocitrate dehydrogenase [NADP]; oxidoreductase, t 4e-06
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, ox 7e-05
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Length = 349 Back     alignment and structure
 Score =  123 bits (312), Expect = 4e-36
 Identities = 37/95 (38%), Positives = 53/95 (55%), Gaps = 7/95 (7%)

Query: 2   PGGNVGADHAIFEQGA--SAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLE 59
            G N G D+A+FE G+           +  Q  ANP A++LSS +ML HL    +A R+ 
Sbjct: 258 AGANFGRDYAVFEPGSRHVG-----LDIKGQNVANPTAMILSSTLMLNHLGLNEYATRIS 312

Query: 60  TAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAALE 94
            AV   I+EGK  T+D+GGSS+T +  + +I  L 
Sbjct: 313 KAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLS 347
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Length = 354 Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Length = 333 Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Length = 496 Back     alignment and structure
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} PDB: 3ty3_A Length = 366 Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Length = 336 Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Length = 423 Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Length = 412 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Length = 429 Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A 8icd_A* 6icd_A ... Length = 427 Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Length = 409 Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Length = 435 Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Length = 364 Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Length = 359 Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} PDB: 3udo_A Length = 361 Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Length = 358 Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Length = 405 Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Length = 366 Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Length = 363 Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Length = 375 Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Length = 390 Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Length = 337 Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Length = 402 Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima} Length = 399 Back     alignment and structure
>4aoy_A Isocitrate dehydrogenase [NADP]; oxidoreductase, temperature adaptation, thermophilic, psychr NADP+ selectivity, domain movements; 2.35A {Clostridium thermocellum} PDB: 4aou_A Length = 402 Back     alignment and structure
>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Length = 427 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 100.0
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 100.0
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 100.0
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 100.0
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 100.0
3udu_A361 3-isopropylmalate dehydrogenase; structural genomi 100.0
2y3z_A359 3-isopropylmalate dehydrogenase; oxidoreductase, L 100.0
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 100.0
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 100.0
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 100.0
3vmk_A375 3-isopropylmalate dehydrogenase; oxidoreductase, d 100.0
3r8w_A405 3-isopropylmalate dehydrogenase 2, chloroplastic; 100.0
3u1h_A390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 100.0
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 100.0
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 100.0
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 100.0
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 100.0
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 100.0
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 99.98
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 99.98
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 99.98
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 99.97
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, co 99.97
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 99.96
3us8_A427 Isocitrate dehydrogenase [NADP]; PSI-biology, stru 99.96
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, ox 99.96
1lwd_A413 Isocitrate dehydrogenase; tricarboxylic acid cycle 99.96
4aoy_A402 Isocitrate dehydrogenase [NADP]; oxidoreductase, t 99.95
1yxo_A328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA 97.88
2hi1_A330 4-hydroxythreonine-4-phosphate dehydrogenase 2; py 97.87
3lxy_A334 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA 97.85
4aty_A349 Terephthalate 1,2-CIS-dihydrodiol dehydrogenase; o 97.83
3tsn_A367 4-hydroxythreonine-4-phosphate dehydrogenase; stru 97.66
2b0t_A738 NADP isocitrate dehydrogenase; monomeric, IDH, oxi 81.27
1itw_A741 Isocitrate dehydrogenase; greece KEY motif, oxidor 81.23
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} SCOP: c.77.1.0 PDB: 3ty3_A Back     alignment and structure
Probab=100.00  E-value=3.3e-36  Score=234.19  Aligned_cols=90  Identities=39%  Similarity=0.532  Sum_probs=87.2

Q ss_pred             CCccccCCCcceeeccccCCCCCcccccccCCCChHHHHHHHHHHHHhcCchHHHHHHHHHHHHHHHcCcccCCCCCCCC
Q 034454            1 MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEGKCRTKDLGGSS   80 (94)
Q Consensus         1 ~psanig~~~a~fEp~~~~~HGsapdiAGk~iANP~a~ils~~mmL~~lg~~~~A~~i~~Av~~~l~~g~~~T~Dlgg~~   80 (94)
                      +||+|||++++||||+    |||||||||||+|||+|+|||++|||+|||+.++|++|++||.+++++|+++|+||||++
T Consensus       276 ~pSanig~~~a~fEpv----HGSAPdIaGk~iANP~A~IlS~amML~~lg~~~~A~~Ie~Av~~~l~~G~~~T~Dlgg~~  351 (366)
T 3ty4_A          276 VPSANVGDNFVMSEPV----HGSAPDIAGRGIANPVATFRSVALMLEFMGHQDAAADIYTAVDKVLTEGKVLTPDLGGKS  351 (366)
T ss_dssp             CCCEEECSSCEEECCS----SCCCTTTTTSSCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHCSSCCGGGTSCC
T ss_pred             hcceeeCCCceEEecC----CCChhhcCCCCccCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHcCCccCcccCCCc
Confidence            6999999999999999    999999999999999999999999999999999999999999999999988999999999


Q ss_pred             CHHHHHHHHHHHhC
Q 034454           81 TTQEIVDAVIAALE   94 (94)
Q Consensus        81 ~T~~~~~~v~~~l~   94 (94)
                      +|+||+++|+++|+
T Consensus       352 ~T~e~~daV~~~l~  365 (366)
T 3ty4_A          352 GTNEITDAVLANIH  365 (366)
T ss_dssp             CHHHHHHHHHHHC-
T ss_pred             CHHHHHHHHHHHhh
Confidence            99999999999874
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Back     alignment and structure
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Back     alignment and structure
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} SCOP: c.77.1.1 PDB: 3udo_A Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} SCOP: c.77.1.1 PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4aj3_A* 4aja_A* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A ... Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vml_A* 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima} Back     alignment and structure
>3us8_A Isocitrate dehydrogenase [NADP]; PSI-biology, structural genomics; 2.25A {Sinorhizobium meliloti} Back     alignment and structure
>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Back     alignment and structure
>1lwd_A Isocitrate dehydrogenase; tricarboxylic acid cycle, oxidoreductase, NADP; HET: ICT; 1.85A {Sus scrofa} SCOP: c.77.1.1 PDB: 1t0l_A* 1t09_A* 3mas_B* 3map_A* 3mar_A* 3mas_A* 3inm_A* 2cmj_A* 2cmv_A* Back     alignment and structure
>4aoy_A Isocitrate dehydrogenase [NADP]; oxidoreductase, temperature adaptation, thermophilic, psychr NADP+ selectivity, domain movements; 2.35A {Clostridium thermocellum} PDB: 4aou_A Back     alignment and structure
>1yxo_A 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural GE PSI; 2.01A {Pseudomonas aeruginosa} Back     alignment and structure
>2hi1_A 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural GENO PSI-2, protein structure initiative; 2.30A {Salmonella typhimurium} Back     alignment and structure
>3lxy_A 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD-DEPE dehydrogenase, metal-binding, NAD, NADP, oxidoreductase, PY biosynthesis; HET: SUC; 1.70A {Yersinia pestis} SCOP: c.77.1.3 PDB: 1ps6_A* 1ptm_A 1ps7_A 1r8k_A Back     alignment and structure
>4aty_A Terephthalate 1,2-CIS-dihydrodiol dehydrogenase; oxidoreductase; 1.85A {Burkholderia xenovorans LB400} Back     alignment and structure
>3tsn_A 4-hydroxythreonine-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: UNL; 2.63A {Campylobacter jejuni subsp} Back     alignment and structure
>2b0t_A NADP isocitrate dehydrogenase; monomeric, IDH, oxidoreductase; 1.75A {Corynebacterium glutamicum} PDB: 3mbc_A* Back     alignment and structure
>1itw_A Isocitrate dehydrogenase; greece KEY motif, oxidoreductase; HET: ICT; 1.95A {Azotobacter vinelandii} SCOP: c.77.1.2 PDB: 1j1w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 94
d1g2ua_345 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 6e-26
d1hqsa_423 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Baci 1e-25
d1pb1a_416 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Esch 3e-25
d1a05a_357 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 6e-24
d1wpwa_336 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 7e-23
d1vlca_362 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 4e-22
d1v53a1356 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase 2e-21
d1t0la_414 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 6e-21
d1w0da_337 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 6e-20
d1cnza_363 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 1e-19
d1lwda_413 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 9e-19
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: 3-isopropylmalate dehydrogenase, IPMDH
species: Thermus thermophilus [TaxId: 274]

 Score = 96.0 bits (238), Expect = 6e-26
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 7/94 (7%)

Query: 1   MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRH-LQFPSFADRLE 59
           +P  ++G    +FE      +     +  +  ANP A +LS+AMML H       A ++E
Sbjct: 257 LPSASLGRGTPVFEPV----HGSAPDIAGKGIANPTAAILSAAMMLEHAFGLVELARKVE 312

Query: 60  TAVKRVISEGKCRTKDLGGSSTTQEIVDAVIAAL 93
            AV + + E      DLGGS+ T+     V+  L
Sbjct: 313 DAVAKALLET--PPPDLGGSAGTEAFTATVLRHL 344
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Length = 423 Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Length = 357 Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Length = 336 Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Length = 362 Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Length = 356 Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 414 Back     information, alignment and structure
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Length = 337 Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Length = 363 Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 413 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d1g2ua_345 3-isopropylmalate dehydrogenase, IPMDH {Thermus th 100.0
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d1wpwa_336 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1hqsa_423 Isocitrate dehydrogenase, ICDH {Bacillus subtilis 99.98
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 99.98
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 99.98
d1w0da_337 3-isopropylmalate dehydrogenase, IPMDH {Mycobacter 99.96
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 99.96
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 99.96
d1ptma_329 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 98.11
d1itwa_740 Monomeric isocitrate dehydrogenase {Azotobacter vi 90.71
d1riea_127 ISP subunit of the mitochondrial cytochrome bc1-co 80.54
d3cx5e1129 ISP subunit of the mitochondrial cytochrome bc1-co 80.47
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: 3-isopropylmalate dehydrogenase, IPMDH
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=3.9e-35  Score=223.66  Aligned_cols=88  Identities=32%  Similarity=0.520  Sum_probs=85.0

Q ss_pred             CCccccCCCcceeeccccCCCCCcccccccCCCChHHHHHHHHHHHHh-cCchHHHHHHHHHHHHHHHcCcccCCCCCCC
Q 034454            1 MPGGNVGADHAIFEQGASAGNVGNEKLVEQKKANPVALLLSSAMMLRH-LQFPSFADRLETAVKRVISEGKCRTKDLGGS   79 (94)
Q Consensus         1 ~psanig~~~a~fEp~~~~~HGsapdiAGk~iANP~a~ils~~mmL~~-lg~~~~A~~i~~Av~~~l~~g~~~T~Dlgg~   79 (94)
                      +||+|||++++||||+    |||||||||||+|||+|||||++|||+| ||+.++|++|++||.++++++  +|+||||+
T Consensus       257 ~~s~nig~~~a~fEp~----HGsApdiaGk~iaNP~a~Ils~ammL~~~~g~~~~a~~i~~Av~~~l~~~--~T~DlgG~  330 (345)
T d1g2ua_         257 LPSASLGRGTPVFEPV----HGSAPDIAGKGIANPTAAILSAAMMLEHAFGLVELARKVEDAVAKALLET--PPPDLGGS  330 (345)
T ss_dssp             CEEEEEESSCCEEEES----SCCCGGGTTSSCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHS--CCGGGTCC
T ss_pred             CCcccccCCccccccc----ccchhhhcCCCccCcHHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHhcC--CCcccCCC
Confidence            5899999999999999    9999999999999999999999999999 999999999999999999985  69999999


Q ss_pred             CCHHHHHHHHHHHhC
Q 034454           80 STTQEIVDAVIAALE   94 (94)
Q Consensus        80 ~~T~~~~~~v~~~l~   94 (94)
                      ++|+||+++|+++|.
T Consensus       331 ~~T~e~~~ai~~~la  345 (345)
T d1g2ua_         331 AGTEAFTATVLRHLA  345 (345)
T ss_dssp             CCHHHHHHHHHHHCC
T ss_pred             cCHHHHHHHHHHhhC
Confidence            999999999999984
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ptma_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure