Citrus Sinensis ID: 034563


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIYP
ccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccc
cccccccccccHcHHHHcccHHHHHHHHHHHHHccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEEcc
mkvtrgkgavkkdknevvkpvedraAGKRKAVLKASrssnkrtknvksakkdpnkpkrppsaFFVFLEEFRKVYKqehpnvkaVSAVSIYP
mkvtrgkgavkkdknevvkpvedraagkrkavlkasrssnkrtknvksakkdpnkpkrppSAFFVFLEEFRKVYKqehpnvkavsavsiyp
MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIYP
*************************************************************AFFVFLEEFRKVYKQE**************
************************************************************SAFFVFLEEFRK*********KAVSAVSIYP
**************NEVVKPVED**********************************RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIYP
***************************************************DPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIYP
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIYP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
O49595178 High mobility group B pro yes no 0.934 0.477 0.602 7e-19
P40619144 HMG1/2-like protein OS=Ip N/A no 0.505 0.319 0.695 2e-12
P26585152 HMG1/2-like protein OS=Gl no no 0.439 0.263 0.8 3e-12
P93047141 High mobility group B pro no no 0.483 0.312 0.681 8e-11
P40620149 HMG1/2-like protein OS=Vi N/A no 0.417 0.255 0.710 2e-10
P27347157 DNA-binding protein MNB1B N/A no 0.791 0.458 0.449 2e-09
Q42344138 High mobility group B pro no no 0.450 0.297 0.658 3e-09
O49596144 High mobility group B pro no no 0.450 0.284 0.634 7e-09
P40621161 HMG1/2-like protein OS=Tr N/A no 0.406 0.229 0.648 2e-07
O49597125 High mobility group B pro no no 0.582 0.424 0.473 1e-06
>sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (72%), Gaps = 3/88 (3%)

Query: 1  MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP 60
          MK  +GK  VK  K E +KPV+DR  GKRKA   A + + + T+  K AKKDPNKPKR P
Sbjct: 1  MKTAKGKDKVKTTK-EALKPVDDRKVGKRKAP--AEKPTKRETRKEKKAKKDPNKPKRAP 57

Query: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAVS 88
          SAFFVFLE+FR  +K+E+PNVKAVSAV 
Sbjct: 58 SAFFVFLEDFRVTFKKENPNVKAVSAVG 85




Binds preferentially double-stranded DNA. Modulates general plant growth and stress tolerance. Confers sensitivity to salt and genotoxic (methyl methanesulfonate, MMS) stresses.
Arabidopsis thaliana (taxid: 3702)
>sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 Back     alignment and function description
>sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 Back     alignment and function description
>sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 Back     alignment and function description
>sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 Back     alignment and function description
>sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 Back     alignment and function description
>sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 Back     alignment and function description
>sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
359386154165 group B HMG-box protein [Citrus sinensis 0.956 0.527 1.0 2e-41
224112525176 high mobility group family [Populus tric 0.967 0.5 0.738 3e-28
225448398166 PREDICTED: high mobility group B protein 0.956 0.524 0.781 5e-27
225448400156 PREDICTED: high mobility group B protein 0.967 0.564 0.772 6e-27
118484946171 unknown [Populus trichocarpa] 0.956 0.508 0.701 1e-26
224098541179 high mobility group family [Populus tric 0.956 0.486 0.701 1e-26
297736623128 unnamed protein product [Vitis vinifera] 0.967 0.687 0.772 2e-26
359486418151 PREDICTED: high mobility group B protein 0.945 0.569 0.779 2e-26
255571919190 DNA-binding protein MNB1B, putative [Ric 0.967 0.463 0.727 1e-22
449461783169 PREDICTED: high mobility group B protein 0.956 0.514 0.659 4e-21
>gi|359386154|gb|AEV43366.1| group B HMG-box protein [Citrus sinensis] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/87 (100%), Positives = 87/87 (100%)

Query: 1  MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP 60
          MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP
Sbjct: 1  MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP 60

Query: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAV 87
          SAFFVFLEEFRKVYKQEHPNVKAVSAV
Sbjct: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAV 87




Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224112525|ref|XP_002316220.1| high mobility group family [Populus trichocarpa] gi|222865260|gb|EEF02391.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448398|ref|XP_002269398.1| PREDICTED: high mobility group B protein 1 isoform 1 [Vitis vinifera] gi|147854340|emb|CAN83423.1| hypothetical protein VITISV_023376 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225448400|ref|XP_002270185.1| PREDICTED: high mobility group B protein 1 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118484946|gb|ABK94338.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098541|ref|XP_002311212.1| high mobility group family [Populus trichocarpa] gi|222851032|gb|EEE88579.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297736623|emb|CBI25494.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486418|ref|XP_003633441.1| PREDICTED: high mobility group B protein 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255571919|ref|XP_002526902.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223533801|gb|EEF35533.1| DNA-binding protein MNB1B, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449461783|ref|XP_004148621.1| PREDICTED: high mobility group B protein 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:2053893138 HMGB4 "high mobility group B4" 0.659 0.434 0.516 4.5e-11
TAIR|locus:505006135144 HMGB2 "high mobility group B2" 0.648 0.409 0.491 5.8e-11
TAIR|locus:2128003125 HMGB5 "high mobility group B5" 0.571 0.416 0.482 2.6e-08
RGD|1561694209 RGD1561694 "similar to High mo 0.406 0.177 0.621 6.4e-08
TAIR|locus:2154433241 HMGB6 "high-mobility group box 0.758 0.286 0.407 6.9e-08
UNIPROTKB|F1N927214 HMGB1 "High mobility group pro 0.769 0.327 0.410 9.6e-08
UNIPROTKB|Q9YH06215 HMG1 "High mobility group 1 pr 0.769 0.325 0.410 9.8e-08
UNIPROTKB|F1MF42196 LOC618297 "Uncharacterized pro 0.384 0.178 0.628 1.4e-07
UNIPROTKB|D6R9A6134 HMGB2 "High mobility group pro 0.384 0.261 0.628 1.4e-07
UNIPROTKB|P40673209 HMGB2 "High mobility group pro 0.384 0.167 0.628 2e-07
TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 153 (58.9 bits), Expect = 4.5e-11, P = 4.5e-11
 Identities = 31/60 (51%), Positives = 39/60 (65%)

Query:    28 KRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAV 87
             K +A     R   +  K  K  KKDPN+PKRPPSAFFVFLE+FRK +   +PN K+V+ V
Sbjct:     7 KAEATSTDQRLKTRGRKAGKKTKKDPNQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATV 66




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0000785 "chromatin" evidence=TAS
GO:0003682 "chromatin binding" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA;TAS
GO:0030527 "structural constituent of chromatin" evidence=TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0006084 "acetyl-CoA metabolic process" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0016572 "histone phosphorylation" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0003677 "DNA binding" evidence=ISS;IDA
TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1561694 RGD1561694 "similar to High mobility group protein 2 (HMG-2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2154433 HMGB6 "high-mobility group box 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1N927 HMGB1 "High mobility group protein B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YH06 HMG1 "High mobility group 1 protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF42 LOC618297 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D6R9A6 HMGB2 "High mobility group protein B2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P40673 HMGB2 "High mobility group protein B2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 2e-04
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 3e-04
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 4e-04
smart0039870 smart00398, HMG, high mobility group 0.003
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
 Score = 35.7 bits (83), Expect = 2e-04
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 56 PKRPPSAFFVFLEEFRKVYKQEHPNVK 82
          PKRP SA+F+F +E R   K E+P + 
Sbjct: 1  PKRPLSAYFLFSQEHRAEVKAENPGLS 27


HMGs bind to the minor groove of DNA and have been classified by DNA binding preferences. Two phylogenically distinct groups of Class I proteins bind DNA in a sequence specific fashion and contain a single HMG box. One group (SOX-TCF) includes transcription factors, TCF-1, -3, -4; and also SRY and LEF-1, which bind four-way DNA junctions and duplex DNA targets. The second group (MATA) includes fungal mating type gene products MC, MATA1 and Ste11. Class II and III proteins (HMGB-UBF) bind DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions. Length = 66

>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PTZ0019994 high mobility group protein; Provisional 99.55
COG5648 211 NHP6B Chromatin-associated proteins containing the 99.2
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.1
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.06
KOG038196 consensus HMG box-containing protein [General func 99.06
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.02
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.02
smart0039870 HMG high mobility group. 98.98
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 98.92
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 98.76
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 98.62
KOG0527 331 consensus HMG-box transcription factor [Transcript 97.91
KOG0528 511 consensus HMG-box transcription factor SOX5 [Trans 95.57
KOG3248 421 consensus Transcription factor TCF-4 [Transcriptio 95.12
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 95.08
KOG4715 410 consensus SWI/SNF-related matrix-associated actin- 94.47
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 88.13
KOG2746 683 consensus HMG-box transcription factor Capicua and 87.73
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 85.64
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
Probab=99.55  E-value=2.7e-15  Score=99.50  Aligned_cols=47  Identities=40%  Similarity=0.571  Sum_probs=41.2

Q ss_pred             cccccCCCCCCCCCCCCchHHhHHHHHHHHHHHhCCCCC-cccccccC
Q 034563           44 KNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVK-AVSAVSIY   90 (91)
Q Consensus        44 kk~kKk~KDpn~PKRP~SAY~lF~~e~R~~iK~enP~ls-~v~eIsK~   90 (91)
                      ++++++.+|||+||||+||||+||+++|..|..+||+++ +|+||+++
T Consensus        11 k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~   58 (94)
T PTZ00199         11 RKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKM   58 (94)
T ss_pred             cccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHH
Confidence            445567899999999999999999999999999999985 47888764



>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
1j3c_A79 Solution Structure Of The C-Terminal Domain Of The 4e-07
1j3d_A78 Solution Structure Of The C-Terminal Domain Of The 1e-06
2yrq_A173 Solution Structure Of The Tandem Hmg Box Domain Fro 2e-06
1hme_A77 Structure Of The Hmg Box Motif In The B-Domain Of H 2e-06
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 2e-06
1nhm_A81 The Structure Of The Hmg Box And Its Interaction Wi 7e-05
1hsm_A79 The Structure Of The Hmg Box And Its Interaction Wi 3e-04
>pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 50 KKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNV 81 KKDPN PKRPPSAFF+F E+R K EHP + Sbjct: 3 KKDPNAPKRPPSAFFLFCSEYRPKIKSEHPGL 34
>pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 Back     alignment and structure
>pdb|2YRQ|A Chain A, Solution Structure Of The Tandem Hmg Box Domain From Human High Mobility Group Protein B1 Length = 173 Back     alignment and structure
>pdb|1HME|A Chain A, Structure Of The Hmg Box Motif In The B-Domain Of Hmg1 Length = 77 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 Back     alignment and structure
>pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
1hme_A77 High mobility group protein fragment-B; DNA-bindin 5e-09
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 6e-09
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 1e-08
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 4e-08
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 4e-08
2lhj_A97 High mobility group protein homolog NHP1; structur 4e-08
1wgf_A90 Upstream binding factor 1; transcription factor, D 5e-08
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 5e-08
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 6e-08
2yrq_A 173 High mobility group protein B1; HMG box domain, DN 1e-06
2yrq_A173 High mobility group protein B1; HMG box domain, DN 6e-05
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 1e-06
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 2e-06
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 1e-05
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 1e-05
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 5e-05
1ckt_A71 High mobility group 1 protein; high-mobility group 6e-05
2gzk_A 159 Sex-determining region on Y / HMGB1; protein-DNA c 1e-04
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 3e-04
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 3e-04
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 3e-04
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 4e-04
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
 Score = 47.6 bits (114), Expect = 5e-09
 Identities = 20/32 (62%), Positives = 23/32 (71%)

Query: 51 KDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVK 82
          KDPN PKRPPSAFF+F  E+R   K EHP + 
Sbjct: 2  KDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLS 33


>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.59
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.55
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.54
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.5
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.5
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.49
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.48
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.48
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.46
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.46
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.45
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.45
2lhj_A97 High mobility group protein homolog NHP1; structur 99.44
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.43
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.43
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.41
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.39
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.38
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.37
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.32
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.31
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.29
2yrq_A 173 High mobility group protein B1; HMG box domain, DN 99.28
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.28
1ckt_A71 High mobility group 1 protein; high-mobility group 99.24
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.23
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.22
2cto_A93 Novel protein; high mobility group box domain, hel 99.2
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.19
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.18
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.13
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 99.05
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 99.03
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 98.97
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 98.87
2gzk_A 159 Sex-determining region on Y / HMGB1; protein-DNA c 98.84
3tq6_A214 Transcription factor A, mitochondrial; transcripti 98.8
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 98.69
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 98.69
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
Probab=99.59  E-value=5.2e-16  Score=100.17  Aligned_cols=45  Identities=36%  Similarity=0.589  Sum_probs=41.1

Q ss_pred             ccccCCCCCCCCCCCCchHHhHHHHHHHHHHHhCCCCCcccccccC
Q 034563           45 NVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIY   90 (91)
Q Consensus        45 k~kKk~KDpn~PKRP~SAY~lF~~e~R~~iK~enP~ls~v~eIsK~   90 (91)
                      +.+++.+|||+||||+|||||||+++|..|+.+||+++ ++||+++
T Consensus        10 k~~k~~kdp~~pKrP~say~lF~~~~r~~~k~~~P~~~-~~eisk~   54 (90)
T 1wgf_A           10 SQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELS-ESELTRL   54 (90)
T ss_dssp             CSCCCSSCCCCCCCCCCHHHHHHHHTHHHHHHHCTTSC-HHHHHHH
T ss_pred             CcCcCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC-HHHHHHH
Confidence            35566799999999999999999999999999999998 9999874



>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 8e-06
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 9e-06
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-05
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 4e-05
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-04
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 3e-04
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 6e-04
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 0.002
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 0.003
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 38.4 bits (89), Expect = 8e-06
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 38 SSNKRTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVK 82
          S +    + +  K    KPKRP SA F+F EE R+  ++E P + 
Sbjct: 3  SGSSGKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELS 47


>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.43
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.43
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.42
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.42
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.4
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.11
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.05
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 98.65
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 98.62
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.43  E-value=3.2e-14  Score=90.97  Aligned_cols=45  Identities=36%  Similarity=0.606  Sum_probs=40.5

Q ss_pred             ccccCCCCCCCCCCCCchHHhHHHHHHHHHHHhCCCCCcccccccC
Q 034563           45 NVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVSIY   90 (91)
Q Consensus        45 k~kKk~KDpn~PKRP~SAY~lF~~e~R~~iK~enP~ls~v~eIsK~   90 (91)
                      +..+..+||+.||||+|||||||+++|.+|+.+||+++ +.||+++
T Consensus        10 ~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~~~-~~ei~k~   54 (93)
T d1lwma_          10 RTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDIT-FGQVGKK   54 (93)
T ss_dssp             CCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTTSC-HHHHHHH
T ss_pred             ccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCCCc-HHHHHHH
Confidence            45556789999999999999999999999999999998 9999863



>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure