Citrus Sinensis ID: 035006

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL
cHHHHHHHHHccccEEEccccccHHHHHHHcccccccccccEEEEcccccccccccccHHHHHHcccccccccccc
cHHHHHHHHHcccEEcEcccEEEHHHHHHHcHHHHHHHHccEEEEccEEEEEccccHHHHHHHHcccccEHHHccE
mefikkqywdrgyqevispnmynmKLWEtsghaanykenmFLIDIEkqefglkpmncpghclmfdhkvrsyrvlsl
mefikkqywdrgyqeVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL
MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL
***IKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRV***
MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL
MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL
MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYR*LSL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query76 2.2.26 [Sep-21-2011]
O04630 709 Threonine--tRNA ligase, m yes no 1.0 0.107 0.763 5e-32
P04801 734 Threonine--tRNA ligase, c yes no 0.973 0.100 0.675 3e-26
P87144 703 Threonine--tRNA ligase, c yes no 0.973 0.105 0.635 2e-25
Q9D0R2 722 Threonine--tRNA ligase, c yes no 1.0 0.105 0.618 3e-25
Q5XHY5 695 Threonine--tRNA ligase, c yes no 1.0 0.109 0.618 4e-25
P52709 725 Threonine--tRNA ligase, c yes no 1.0 0.104 0.644 1e-24
Q3ZBV8 723 Threonine--tRNA ligase, c yes no 1.0 0.105 0.618 1e-24
P26639 723 Threonine--tRNA ligase, c yes no 1.0 0.105 0.605 4e-24
Q8BLY2 790 Probable threonine--tRNA no no 1.0 0.096 0.605 1e-23
Q8MP20 698 Probable threonine--tRNA yes no 1.0 0.108 0.592 1e-23
>sp|O04630|SYTM_ARATH Threonine--tRNA ligase, mitochondrial OS=Arabidopsis thaliana GN=THRRS PE=2 SV=3 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%)

Query: 1   MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGH 60
           M+FIK QYW RGY EVI+PNMYNM+LW+TSGHA NYK+NMF  +IEKQEFGLKPMNCPGH
Sbjct: 351 MDFIKNQYWHRGYTEVITPNMYNMELWQTSGHADNYKDNMFTFNIEKQEFGLKPMNCPGH 410

Query: 61  CLMFDHKVRSYRVLSL 76
           CL+F H+VRSYR L +
Sbjct: 411 CLIFQHRVRSYRELPM 426

Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 3
>sp|P04801|SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THS1 PE=1 SV=2 Back     alignment and function description
>sp|P87144|SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ths1 PE=3 SV=1 Back     alignment and function description
>sp|Q9D0R2|SYTC_MOUSE Threonine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Tars PE=1 SV=2 Back     alignment and function description
>sp|Q5XHY5|SYTC_RAT Threonine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Tars PE=2 SV=1 Back     alignment and function description
>sp|P52709|SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=trs-1 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZBV8|SYTC_BOVIN Threonine--tRNA ligase, cytoplasmic OS=Bos taurus GN=TARS PE=2 SV=1 Back     alignment and function description
>sp|P26639|SYTC_HUMAN Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3 Back     alignment and function description
>sp|Q8BLY2|SYTC2_MOUSE Probable threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus GN=Tarsl2 PE=2 SV=1 Back     alignment and function description
>sp|Q8MP20|SYTC2_DICDI Probable threonine--tRNA ligase 2, cytoplasmic OS=Dictyostelium discoideum GN=thrS2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
357145515 736 PREDICTED: threonyl-tRNA synthetase, mit 1.0 0.103 0.815 6e-34
115475758 745 Os08g0295300 [Oryza sativa Japonica Grou 1.0 0.102 0.802 8e-34
218200880 716 hypothetical protein OsI_28676 [Oryza sa 1.0 0.106 0.802 8e-34
258644607 749 putative threonyl-tRNA synthetase [Oryza 1.0 0.101 0.802 1e-33
222640294 701 hypothetical protein OsJ_26793 [Oryza sa 1.0 0.108 0.802 1e-33
20429011 531 threonyl-tRNA synthetase [Oryza sativa J 1.0 0.143 0.802 3e-33
413933500 739 hypothetical protein ZEAMMB73_499676 [Ze 1.0 0.102 0.789 2e-32
326533164 711 predicted protein [Hordeum vulgare subsp 1.0 0.106 0.776 2e-32
242033449 739 hypothetical protein SORBIDRAFT_01g01268 1.0 0.102 0.789 6e-32
449449092 724 PREDICTED: threonine--tRNA ligase, mitoc 1.0 0.104 0.789 2e-31
>gi|357145515|ref|XP_003573669.1| PREDICTED: threonyl-tRNA synthetase, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 62/76 (81%), Positives = 71/76 (93%)

Query: 1   MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGH 60
           M+F++ QY +RGYQEV+SPN+YNM+LWETSGHAANYKENMF+ +IEKQEFGLKPMNCPGH
Sbjct: 378 MDFLRGQYRERGYQEVLSPNIYNMQLWETSGHAANYKENMFVFEIEKQEFGLKPMNCPGH 437

Query: 61  CLMFDHKVRSYRVLSL 76
           CLMFDHKVRSYR L L
Sbjct: 438 CLMFDHKVRSYRELPL 453

Source: Brachypodium distachyon

Species: Brachypodium distachyon

Genus: Brachypodium

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|115475758|ref|NP_001061475.1| Os08g0295300 [Oryza sativa Japonica Group] gi|38175524|dbj|BAD01219.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group] gi|38175707|dbj|BAD01414.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group] gi|113623444|dbj|BAF23389.1| Os08g0295300 [Oryza sativa Japonica Group] gi|215687347|dbj|BAG91912.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218200880|gb|EEC83307.1| hypothetical protein OsI_28676 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|258644607|dbj|BAI39857.1| putative threonyl-tRNA synthetase [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|222640294|gb|EEE68426.1| hypothetical protein OsJ_26793 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|20429011|emb|CAC79651.1| threonyl-tRNA synthetase [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|413933500|gb|AFW68051.1| hypothetical protein ZEAMMB73_499676 [Zea mays] Back     alignment and taxonomy information
>gi|326533164|dbj|BAJ93554.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|242033449|ref|XP_002464119.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor] gi|241917973|gb|EER91117.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|449449092|ref|XP_004142299.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
TAIR|locus:2148538 709 AT5G26830 [Arabidopsis thalian 1.0 0.107 0.763 3.1e-30
SGD|S000001340 734 THS1 "Threonyl-tRNA synthetase 0.973 0.100 0.675 6.6e-25
ZFIN|ZDB-GENE-041010-218 718 tars "threonyl-tRNA synthetase 1.0 0.105 0.631 3.6e-24
RGD|1359527 695 Tars "threonyl-tRNA synthetase 1.0 0.109 0.618 5.5e-24
UNIPROTKB|Q5XHY5 695 Tars "Threonine--tRNA ligase, 1.0 0.109 0.618 5.5e-24
MGI|MGI:106314 722 Tars "threonyl-tRNA synthetase 1.0 0.105 0.618 6e-24
WB|WBGene00006617 725 tars-1 [Caenorhabditis elegans 0.973 0.102 0.662 6e-24
UNIPROTKB|Q3ZBV8 723 TARS "Threonine--tRNA ligase, 1.0 0.105 0.618 2.1e-23
UNIPROTKB|E2RHW7 723 TARS "Uncharacterized protein" 1.0 0.105 0.618 2.1e-23
UNIPROTKB|E1C8M1 712 TARS "Uncharacterized protein" 1.0 0.106 0.618 2.6e-23
TAIR|locus:2148538 AT5G26830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 342 (125.4 bits), Expect = 3.1e-30, P = 3.1e-30
 Identities = 58/76 (76%), Positives = 67/76 (88%)

Query:     1 MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGH 60
             M+FIK QYW RGY EVI+PNMYNM+LW+TSGHA NYK+NMF  +IEKQEFGLKPMNCPGH
Sbjct:   351 MDFIKNQYWHRGYTEVITPNMYNMELWQTSGHADNYKDNMFTFNIEKQEFGLKPMNCPGH 410

Query:    61 CLMFDHKVRSYRVLSL 76
             CL+F H+VRSYR L +
Sbjct:   411 CLIFQHRVRSYRELPM 426
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA
GO:0004829 "threonine-tRNA ligase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006418 "tRNA aminoacylation for protein translation" evidence=IEA
GO:0006435 "threonyl-tRNA aminoacylation" evidence=IEA;ISS
GO:0016876 "ligase activity, forming aminoacyl-tRNA and related compounds" evidence=IEA
GO:0043039 "tRNA aminoacylation" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
SGD|S000001340 THS1 "Threonyl-tRNA synthetase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-218 tars "threonyl-tRNA synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1359527 Tars "threonyl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XHY5 Tars "Threonine--tRNA ligase, cytoplasmic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:106314 Tars "threonyl-tRNA synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00006617 tars-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBV8 TARS "Threonine--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHW7 TARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8M1 TARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O04630SYTM_ARATH6, ., 1, ., 1, ., 30.76311.00.1071yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRADI3G19960.1
annotation not avaliable (736 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
BRADI1G30610.1
annotation not avaliable (1172 aa)
   •  • 0.925
BRADI3G53970.2
annotation not avaliable (321 aa)
•     • 0.883
BRADI3G41550.1
annotation not avaliable (691 aa)
   •  • 0.879
BRADI3G58130.2
annotation not avaliable (498 aa)
•  •  • 0.864
BRADI2G19080.2
annotation not avaliable (121 aa)
•     • 0.845
BRADI2G49030.2
annotation not avaliable (122 aa)
•     • 0.843
BRADI2G49520.1
annotation not avaliable (399 aa)
•     • 0.842
BRADI4G38980.1
annotation not avaliable (472 aa)
•  •  • 0.814
BRADI3G28520.1
annotation not avaliable (512 aa)
•  •  • 0.815
BRADI1G56890.1
annotation not avaliable (962 aa)
•  •  • 0.808

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
PLN02908 686 PLN02908, PLN02908, threonyl-tRNA synthetase 1e-51
cd00771 298 cd00771, ThrRS_core, Threonyl-tRNA synthetase (Thr 3e-39
PRK00413 638 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed 4e-32
COG0441 589 COG0441, ThrS, Threonyl-tRNA synthetase [Translati 1e-30
TIGR00418 563 TIGR00418, thrS, threonyl-tRNA synthetase 4e-29
PRK12305 575 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed 6e-29
PRK12444 639 PRK12444, PRK12444, threonyl-tRNA synthetase; Revi 2e-23
pfam00587171 pfam00587, tRNA-synt_2b, tRNA synthetase class II 1e-19
PRK14799 545 PRK14799, thrS, threonyl-tRNA synthetase; Provisio 4e-19
PLN02837 614 PLN02837, PLN02837, threonine-tRNA ligase 7e-17
cd00670 235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro 1e-05
cd00768 211 cd00768, class_II_aaRS-like_core, Class II tRNA am 4e-04
>gnl|CDD|178496 PLN02908, PLN02908, threonyl-tRNA synthetase Back     alignment and domain information 
 Score =  169 bits (431), Expect = 1e-51
 Identities = 60/76 (78%), Positives = 70/76 (92%)

Query: 1   MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGH 60
           M+FI++QYW+RGY EVI+PN+YNM LWETSGHAA+YKENMF+ +IEKQEFGLKPMNCPGH
Sbjct: 328 MDFIREQYWERGYDEVITPNIYNMDLWETSGHAAHYKENMFVFEIEKQEFGLKPMNCPGH 387

Query: 61  CLMFDHKVRSYRVLSL 76
           CLMF H+VRSYR L L
Sbjct: 388 CLMFAHRVRSYRELPL 403

Length = 686
>gnl|CDD|238394 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|234752 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|223518 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232967 TIGR00418, thrS, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237050 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183530 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|184826 PRK14799, thrS, threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215450 PLN02837, PLN02837, threonine-tRNA ligase Back     alignment and domain information
>gnl|CDD|238359 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
KOG1637 560 consensus Threonyl-tRNA synthetase [Translation, r 99.95
COG0441 589 ThrS Threonyl-tRNA synthetase [Translation, riboso 99.92
PRK12325 439 prolyl-tRNA synthetase; Provisional 99.91
PLN02837 614 threonine-tRNA ligase 99.91
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 99.91
PRK14799 545 thrS threonyl-tRNA synthetase; Provisional 99.9
PLN02908 686 threonyl-tRNA synthetase 99.89
cd00770 297 SerRS_core Seryl-tRNA synthetase (SerRS) class II 99.89
cd00778 261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) 99.88
PRK03991 613 threonyl-tRNA synthetase; Validated 99.86
PF00587173 tRNA-synt_2b: tRNA synthetase class II core domain 99.86
PRK09194 565 prolyl-tRNA synthetase; Provisional 99.85
PRK12444 639 threonyl-tRNA synthetase; Reviewed 99.85
TIGR00409 568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 99.85
KOG2324 457 consensus Prolyl-tRNA synthetase [Translation, rib 99.84
cd00771 298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 99.84
TIGR00414 418 serS seryl-tRNA synthetase. This model represents 99.83
PRK05431 425 seryl-tRNA synthetase; Provisional 99.83
cd00779 255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla 99.83
cd00772 264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II 99.82
PRK12305 575 thrS threonyl-tRNA synthetase; Reviewed 99.81
PRK08661 477 prolyl-tRNA synthetase; Provisional 99.8
TIGR00418 563 thrS threonyl-tRNA synthetase. This model represen 99.8
TIGR00408 472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 99.79
PRK00960 517 seryl-tRNA synthetase; Provisional 99.77
PLN02678 448 seryl-tRNA synthetase 99.76
PRK04173 456 glycyl-tRNA synthetase; Provisional 99.76
PRK00413 638 thrS threonyl-tRNA synthetase; Reviewed 99.76
cd00670 235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 99.73
PLN02320 502 seryl-tRNA synthetase 99.59
COG0172 429 SerS Seryl-tRNA synthetase [Translation, ribosomal 99.5
TIGR00415 520 serS_MJ seryl-tRNA synthetase, Methanococcus janna 99.48
CHL00201 430 syh histidine-tRNA synthetase; Provisional 99.31
cd00773 261 HisRS-like_core Class II Histidinyl-tRNA synthetas 99.2
cd00774 254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik 99.1
PRK00037 412 hisS histidyl-tRNA synthetase; Reviewed 98.98
TIGR00442 397 hisS histidyl-tRNA synthetase. This model finds a 98.77
TIGR00443 314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 98.55
PRK09537 417 pylS pyrolysyl-tRNA synthetase; Reviewed 98.47
cd00768 211 class_II_aaRS-like_core Class II tRNA amino-acyl s 98.41
KOG2509 455 consensus Seryl-tRNA synthetase [Translation, ribo 98.38
PLN02530 487 histidine-tRNA ligase 98.37
PRK12420 423 histidyl-tRNA synthetase; Provisional 98.18
TIGR02367 453 PylS pyrrolysyl-tRNA synthetase. PylS is the archa 97.96
TIGR00389 551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 97.85
KOG4163 551 consensus Prolyl-tRNA synthetase [Translation, rib 97.6
COG0124 429 HisS Histidyl-tRNA synthetase [Translation, riboso 97.43
PRK12292 391 hisZ ATP phosphoribosyltransferase regulatory subu 97.33
PF13393 311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 97.12
PRK12293 281 hisZ ATP phosphoribosyltransferase regulatory subu 96.84
PRK12421 392 ATP phosphoribosyltransferase regulatory subunit; 96.7
PRK12295 373 hisZ ATP phosphoribosyltransferase regulatory subu 96.69
COG0423 558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 96.1
PLN02972 763 Histidyl-tRNA synthetase 95.93
PRK12294 272 hisZ ATP phosphoribosyltransferase regulatory subu 95.82
PLN02734 684 glycyl-tRNA synthetase 95.69
COG3705 390 HisZ ATP phosphoribosyltransferase involved in his 95.22
PRK07080 317 hypothetical protein; Validated 94.08
PRK14894 539 glycyl-tRNA synthetase; Provisional 93.06
PRK09350 306 poxB regulator PoxA; Provisional 92.4
cd00669 269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 92.32
PF00152 335 tRNA-synt_2: tRNA synthetases class II (D, K and N 91.57
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 90.42
PRK06462 335 asparagine synthetase A; Reviewed 87.41
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 86.72
PLN02850 530 aspartate-tRNA ligase 86.65
cd00777 280 AspRS_core Asp tRNA synthetase (aspRS) class II co 86.56
cd00775 329 LysRS_core Lys_tRNA synthetase (LysRS) class II co 85.85
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 85.66
COG1190 502 LysU Lysyl-tRNA synthetase (class II) [Translation 85.64
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 85.26
PTZ00417 585 lysine-tRNA ligase; Provisional 84.94
PTZ00401 550 aspartyl-tRNA synthetase; Provisional 83.93
KOG1885 560 consensus Lysyl-tRNA synthetase (class II) [Transl 83.79
TIGR00462 304 genX lysyl-tRNA synthetase-like protein GenX. Many 83.53
TIGR00499 496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 83.24
KOG2298 599 consensus Glycyl-tRNA synthetase and related class 83.03
PRK12445 505 lysyl-tRNA synthetase; Reviewed 82.76
PRK00484 491 lysS lysyl-tRNA synthetase; Reviewed 81.67
cd00776 322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 80.67
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, riboso 80.44
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 80.42
>KOG1637 consensus Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=99.95  E-value=1.5e-29  Score=182.20  Aligned_cols=75  Identities=67%  Similarity=1.258  Sum_probs=72.8

Q ss_pred             hHHHHHHHHcCCeEeeCCcccchhhhhhhCCcccccccceEEeecCceEEEcCCChHHHHHHHhCcCCCCCCCCC
Q 035006            2 EFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL   76 (76)
Q Consensus         2 ~~ir~e~~~~G~~ev~~P~l~~~~lw~~SG~~~~~~~~mf~~~~~~~~~~L~P~~c~~~~~~~~~~~~SYk~LPl   76 (76)
                      .|||.+..++||+||.||.|.++.||++||||.+|.++||+++...++|.|+|||||+||.+|+++.+|||+||+
T Consensus       200 ~fir~ey~~rGf~EVitPniy~~~LWe~SGHwqnY~enmF~~e~eke~~~LKPMNCPgHcLmf~~r~rS~reLPl  274 (560)
T KOG1637|consen  200 DFIRAEYRKRGFTEVITPNIYNKKLWETSGHWQNYSENMFKFEVEKEEFALKPMNCPGHCLMFAHRDRSYRELPL  274 (560)
T ss_pred             HHHHHHHHhcCCceecCcchhhhhhhhhccchhhhhhhceeeeechhhhccCccCCCccccccccCCccHhhCCc
Confidence            689999999999999999999999999999999999999999877788999999999999999999999999996

>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>KOG2324 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>PLN02320 seryl-tRNA synthetase Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>KOG2509 consensus Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>KOG4163 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PLN02734 glycyl-tRNA synthetase Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07080 hypothetical protein; Validated Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1885 consensus Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>KOG2298 consensus Glycyl-tRNA synthetase and related class II tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
3ugq_A 460 Crystal Structure Of The Apo Form Of The Yeast Mito 9e-18
1qf6_A 642 Structure Of E. Coli Threonyl-Trna Synthetase Compl 4e-14
1evk_A 401 Crystal Structure Of A Truncated Form Of Threonyl-T 4e-14
3a32_A 471 Crystal Structure Of Putative Threonyl-Trna Synthet 6e-13
3a31_A 471 Crystal Structure Of Putative Threonyl-Trna Synthet 2e-11
1nyq_A 645 Structure Of Staphylococcus Aureus Threonyl-Trna Sy 8e-09
>pdb|3UGQ|A Chain A, Crystal Structure Of The Apo Form Of The Yeast Mitochondrial Threonyl- Trna Synthetase Determined At 2.1 Angstrom Resolution Length = 460 Back     alignment and structure 
Iteration: 1

 Score = 85.1 bits (209), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
Query: 1   MEFIK-KQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLI---DIEKQEFGLKPMN 56
           +EF+K +Q +  G+ EV++P +Y   LWE SGH  NY ++MF +   D EK+E+GLKPMN
Sbjct: 71  IEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKEEYGLKPMN 130
Query: 57  CPGHCLMFDHKVRSYRVLSL 76
           CPGHCL+F  K RSY  L L
Sbjct: 131 CPGHCLIFGKKDRSYNELPL 150
>pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna Length = 642 Back     alignment and structure
>pdb|1EVK|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna Synthetase With The Ligand Threonine Length = 401 Back     alignment and structure
>pdb|3A32|A Chain A, Crystal Structure Of Putative Threonyl-Trna Synthetase Thrrs-1 From Aeropyrum Pernix Length = 471 Back     alignment and structure
>pdb|3A31|A Chain A, Crystal Structure Of Putative Threonyl-Trna Synthetase Thrrs-1 From Aeropyrum Pernix (Selenomethionine Derivative) Length = 471 Back     alignment and structure
>pdb|1NYQ|A Chain A, Structure Of Staphylococcus Aureus Threonyl-Trna Synthetase Complexed With An Analogue Of Threonyl Adenylate Length = 645 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
3uh0_A 460 Threonyl-tRNA synthetase, mitochondrial; threonine 1e-40
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, 1e-35
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum per 6e-35
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 2e-34
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 1e-31
3dsq_A 288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 9e-20
2cja_A 522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 7e-14
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Length = 460 Back     alignment and structure
 Score =  137 bits (346), Expect = 1e-40
 Identities = 41/78 (52%), Positives = 54/78 (69%), Gaps = 4/78 (5%)

Query: 1   MEFIKKQY-WDRGYQEVISPNMYNMKLWETSGHAANYKENMFLI---DIEKQEFGLKPMN 56
           +EF+K Q  +  G+ EV++P +Y   LWE SGH  NY ++MF +   D EK+E+GLKPMN
Sbjct: 71  IEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKEEYGLKPMN 130

Query: 57  CPGHCLMFDHKVRSYRVL 74
           CPGHCL+F  K RSY  L
Sbjct: 131 CPGHCLIFGKKDRSYNEL 148
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Length = 401 Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Length = 471 Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Length = 642 Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Length = 645 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Length = 288 Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Length = 522 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
3lss_A 484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.9
3err_A 536 Fusion protein of microtubule binding domain from 99.89
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 99.88
3vbb_A 522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 99.88
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 99.87
3uh0_A 460 Threonyl-tRNA synthetase, mitochondrial; threonine 99.86
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 99.85
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, 99.83
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 99.83
2i4l_A 458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 99.83
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 99.82
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.82
1ses_A 421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 99.81
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.81
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 99.81
2dq3_A 425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.78
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.77
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; cla 99.76
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum per 99.76
1nj1_A 501 PROR, proline-tRNA synthetase, proline--tRNA ligas 99.74
2cja_A 522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 99.74
3mf2_A 346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl- 99.71
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase 99.69
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 99.69
4e51_A 467 Histidine--tRNA ligase; seattle structural genomic 99.64
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase 99.63
1ati_A 505 Glycyl-tRNA synthetase; protein biosynthesis, liga 99.59
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 99.56
1z7m_A 344 ATP phosphoribosyltransferase regulatory subunit; 99.52
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 99.43
1g5h_A 454 Mitochondrial DNA polymerase accessory subunit; in 99.41
3ikl_A 459 DNA polymerase subunit gamma-2, mitochondrial; tra 99.37
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 99.35
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 99.31
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 99.26
3dsq_A 288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 99.19
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 98.93
1usy_A 275 ATP phosphoribosyltransferase regulatory subunit; 98.92
4g84_A 464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 98.9
4g85_A 517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 98.89
3qtc_A 290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 98.23
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 95.08
1nnh_A 294 Asparaginyl-tRNA synthetase-related peptide; struc 94.59
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 94.52
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 94.2
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 93.25
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 92.92
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 91.82
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 91.07
3a5y_A 345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 89.98
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 89.95
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 89.32
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 82.74
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 82.5
3ig2_A 213 Phenylalanyl-tRNA synthetase beta chain; phers, MC 80.6
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 80.42
3fhk_A147 UPF0403 protein YPHP; disulfide isomerase, thiored 80.16
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
Probab=99.90  E-value=9.3e-25  Score=157.85  Aligned_cols=76  Identities=11%  Similarity=0.103  Sum_probs=72.3

Q ss_pred             ChHHHHHHHHcCCeEeeCCcccchhhhhhhCCcccccccceEEeecCceEEEcCCChHHHHHHHhCcCCCCCCCCC
Q 035006            1 MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL   76 (76)
Q Consensus         1 ~~~ir~e~~~~G~~ev~~P~l~~~~lw~~SG~~~~~~~~mf~~~~~~~~~~L~P~~c~~~~~~~~~~~~SYk~LPl   76 (76)
                      ++|+++++.+.||+||.+|.|++.++|++||||++|+++||++..++++|+|+||+|+.++.+++++++|||+||+
T Consensus       215 ~~f~~d~~~~~Gy~eV~~P~lv~~~l~~~sG~~~~f~e~mf~v~~~~~~~~L~PTaE~~l~~l~~~~i~sy~dLPl  290 (484)
T 3lss_A          215 VSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPL  290 (484)
T ss_dssp             HHHHHHHHHTTTCEEEECCSEEEHHHHHHHSCHHHHHHTCCEEESSSSCEEECSSTHHHHHHHTTTCEESCCSSCE
T ss_pred             HHHHHHHHHHcCCEEEecCccccHHHHHhcCCcccccccceEeecCCcceEEeccCcHHHHHHHhccccchhhCCe
Confidence            3799999999999999999999999999999999999999999655678999999999999999999999999996
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.09A {Bacteroides fragilis} Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3fhk_A UPF0403 protein YPHP; disulfide isomerase, thioredoxin superfamily, CXC motif, structural genomics, surface entropy reduction, Ser, PSI-2; 2.30A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 76
d1qf6a4 291 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (Th 3e-14
d1nyra4 291 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (Th 2e-11
d1nj8a3 268 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) 2e-06
d1b76a2 331 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) 9e-04
d1g5ha2 290 d.104.1.1 (A:41-330) The aaRS-like accessory subun 0.001
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Threonyl-tRNA synthetase (ThrRS)
species: Escherichia coli [TaxId: 562]

 Score = 62.8 bits (152), Expect = 3e-14
 Identities = 33/76 (43%), Positives = 47/76 (61%)

Query: 1   MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGH 60
             F++ +  +  YQEV  P M +  LWE +GH  NYK+ MF    E +E+ +KPMNCPGH
Sbjct: 37  EVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGH 96

Query: 61  CLMFDHKVRSYRVLSL 76
             +F+  ++SYR L L
Sbjct: 97  VQIFNQGLKSYRDLPL 112
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Length = 291 Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Length = 268 Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Length = 331 Back     information, alignment and structure
>d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d1qf6a4 291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 99.94
d1nyra4 291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 99.93
d1nj8a3 268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 99.91
d1nj1a3 265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 99.9
d1hc7a2 272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 99.87
d1b76a2 331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 99.74
d1seta2 311 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 99.7
d1g5ha2 290 The aaRS-like accessory subunit of mitochondrial p 98.65
d1z7ma1 318 ATP phosphoribosyltransferase regulatory subunit H 97.95
d1wu7a2 327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 97.29
d1h4vb2 324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 96.88
d1qe0a2 325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 96.49
d1kmma2 322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 96.08
d1usya_ 275 ATP phosphoribosyltransferase regulatory subunit H 95.01
d1atia2 394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 94.42
d1b8aa2 335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 93.32
d1eova2 353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 92.87
d1n9wa2 304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 90.84
d1nnha_ 293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 89.06
d1c0aa3 346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 87.54
d1l0wa3 356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 83.39
d1e1oa2 342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 80.31
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Threonyl-tRNA synthetase (ThrRS)
species: Escherichia coli [TaxId: 562]

Probab=99.94  E-value=9.7e-29  Score=167.51  Aligned_cols=76  Identities=43%  Similarity=0.826  Sum_probs=73.1

Q ss_pred             ChHHHHHHHHcCCeEeeCCcccchhhhhhhCCcccccccceEEeecCceEEEcCCChHHHHHHHhCcCCCCCCCCC
Q 035006            1 MEFIKKQYWDRGYQEVISPNMYNMKLWETSGHAANYKENMFLIDIEKQEFGLKPMNCPGHCLMFDHKVRSYRVLSL   76 (76)
Q Consensus         1 ~~~ir~e~~~~G~~ev~~P~l~~~~lw~~SG~~~~~~~~mf~~~~~~~~~~L~P~~c~~~~~~~~~~~~SYk~LPl   76 (76)
                      ++|+++++.++||+||.||+|+++++|++||||++|+++||.+..++++|+|+|||||.|+.+++++++||||||+
T Consensus        37 ~~~i~e~~~~~G~~eV~~P~L~~~~l~~~sG~~~~~~~~~~~~~~~~~~~~L~Pt~e~~~~~~~~~~~~sy~~LPl  112 (291)
T d1qf6a4          37 EVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPL  112 (291)
T ss_dssp             HHHHHHHHHHTTCEECCCCSEEETHHHHHHSHHHHHGGGCEEEEETTEEEEECSSSHHHHHHHHTTSCEEGGGCSE
T ss_pred             HHHHHHHHHHcCCEEEEcccccchhHHhhhchhhhccchhccccccchhhcccccCcHHHHHHHHccccchhhcCe
Confidence            3799999999999999999999999999999999999999998777889999999999999999999999999996
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure