Polyketide cyclase which functions in concert with OLS/TKS to form olivetolic acid. Has no intrinsic polyketide synthase activity and requires the presence of OLS to produce olivetolic acid.
Cannabis sativa (taxid: 3483)
EC: 4
EC: .
EC: 4
EC: .
EC: 1
EC: .
EC: 2
EC: 6
>sp|Q9FK81|Y5258_ARATH Uncharacterized protein At5g22580 OS=Arabidopsis thaliana GN=At5g22580 PE=1 SV=1
>gi|159162871|pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 gi|159162872|pdb|1Q53|B Chain B, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081
Score = 84 (34.6 bits), Expect = 0.00093, P = 0.00093
Identities = 21/58 (36%), Positives = 28/58 (48%)
Query: 6 GKNVSIENLHQGFTHIFESTFESTEGVAEYVAH-PAHVEYANLFLANLEKVLVIDYKP 62
GK+ S E G TH F + FES E YV+ P H+E +E L +D+ P
Sbjct: 50 GKDHSPEGAQHGMTHAFVAQFESREDRDYYVSKDPVHLELGPRIAPVVETFLCLDFTP 107
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.321 0.134 0.400 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 67 67 0.00091 102 3 11 22 0.42 28
29 0.49 28
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 6
No. of states in DFA: 472 (50 KB)
Total size of DFA: 87 KB (2066 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 7.67u 0.14s 7.81t Elapsed: 00:00:01
Total cpu time: 7.67u 0.14s 7.81t Elapsed: 00:00:01
Start: Fri May 10 07:44:22 2013 End: Fri May 10 07:44:23 2013
Score = 60.8 bits (148), Expect = 3e-14
Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
Query: 6 GKNVSIENLHQGFTHIFESTFESTEGVAEYVAHPAHVEYANLFLANL-EKVLVIDY 60
G+NVS E G+ H+ S FE E + Y HPAHV + L E +V+D+
Sbjct: 41 GRNVSPEGRSGGYDHVLVSEFEDEEDLDAYQVHPAHVAVVERLVPPLAEDRVVVDF 96
The function of this domain is unknown, but it is upregulated in response to salt stress in Populus balsamifera (balsam poplar). It is also found at the C-terminus of a fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus.It is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an alpha-beta barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. Length = 97
The function of this family is unknown, but it is upregulated in response to salt stress in Populus balsamifera. It is also found at the C-terminus of an fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus. Arthrobacter nicotinovorans ORF106 is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an a/b barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. Length = 96
Uncharacterized conserved protein [Function unknow
83.0
>PF07876 Dabb: Stress responsive A/B Barrel Domain; InterPro: IPR013097 The stress-response A/B barrel domain is found in a class of stress-response proteins in plants
It is also found in some bacterial fructose-bisphosphate aldolase such as at the C terminus of a fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus (Q9ZA13 from SWISSPROT) []. Q93NG5 from SWISSPROT is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The stress-response A/B barrel domain forms a very stable dimer. This dimer belongs to the superfamily of dimeric alpha+beta barrels in which the two beta-sheets form a beta-barrel. The two molecules in the dimer are related by a 2-fold axis parallel to helix H1 and beta-strands B3 and B4. C-terminal residues extending from the beta4 strand of each monomer wrap around and connect with the beta2 strand and alpha1 helix of the opposing monomer to form the dimer interface [, , ].The outer surface of the beta-sheets of the two molecules forms a beta-barrel-like structure defining a central pore. The function of the stress-response A/B barrel domain is unknown [, , ], but it is upregulated in response to salt stress in Populus balsamifera (balsam poplar) []. Some proteins known to contain a stress response A/B barrel domain are listed below: - Arabidopsis thaliana At3g17210 - Arabidopsis thaliana At5g22580 -Populus tremula stable protein 1 (SP-1)(Populus species), a thermostable stress-responsive protein. - Pseudomonas hydrogenothermophila fructose 1,6-bisphosphate aldolase (cbbA). The structure of one of these proteins has been solved (Q9LUV2 from SWISSPROT) and the domain forms an alpha-beta barrel dimer [].; PDB: 3BB5_E 3FMB_A 3BDE_B 2QYC_A 1Q53_B 2Q3P_A 1Q4R_A 3BN7_A 3BGU_B 1RJJ_B ....
>PF07045 DUF1330: Protein of unknown function (DUF1330); InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length
The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
>PF03992 ABM: Antibiotic biosynthesis monooxygenase; InterPro: IPR007138 This domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species, which can carry out oxygenation without the assistance of any of the prosthetic groups, metal ions or cofactors normally associated with activation of molecular oxygen
The structure of ActVA-Orf6 monooxygenase from Streptomyces coelicolor (Q53908 from SWISSPROT), which is involved in actinorhodin biosynthesis, reveals a dimeric alpha+beta barrel topology []. There is also a conserved histidine that is likely to be an active site residue. In S. coelicolor SCO1909 (Q9X9W3 from SWISSPROT) this domain occurs as a repeat. This domain is also found in protein LsrG, involved in the degradation of quorum-sensing molecule autoinducer-2 [], and in several uncharacterised proteins.; PDB: 1X7V_A 3F44_A 4DN9_B 1N5T_B 1LQ9_A 1N5Q_B 1N5V_A 1N5S_A 2GFF_B 3BM7_A ....
>COG5470 Uncharacterized conserved protein [Function unknown]
>PF07110 EthD: EthD domain; InterPro: IPR009799 This family consists of several bacterial sequences which are related to the EthD protein of Rhodococcus ruber (Q93EX2 from SWISSPROT)
R. ruber (formerly Gordonia terrae) IFP 2001 is one of a few bacterial strains able to degrade ethyl tert-butyl ether (ETBE), which is a major pollutant from gasoline. This strain was found to undergo a spontaneous 14.3-kbp chromosomal deletion, which results in the loss of the ability to degrade ETBE. Sequence analysis of the region corresponding to the deletion revealed the presence of a gene cluster, ethABCD, encoding a ferredoxin reductase (EthA), a cytochrome P-450 (EthB), a ferredoxin (EthC), and a 10kDa protein of unknown function (EthD), respectively. Upstream of ethABCD lies ethR, which codes for a putative positive transcriptional regulator of the AraC/XylS family. Transformation of the ETBE-negative mutant by a plasmid carrying the ethRABCD genes restored the ability to degrade ETBE. Complementation was abolished if the plasmid carried ethRABC only demonstrating that EthD is essential for the ETBE degradation system [].; PDB: 3BF4_B 2FTR_A.
>COG3224 Uncharacterized protein conserved in bacteria [Function unknown]
Solution Structure Of A Homodimeric Hypothetical Pr
3e-08
>pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 Length = 112
>pdb|1RJJ|A Chain A, Solution Structure Of A Homodimeric Hypothetical Protein, At5g22580, A Structural Genomics Target From Arabidopsis Thaliana Length = 111
Ferredoxin-like protein of unknown function; ferre
1e-13
3fmb_A
118
Dimeric protein of unknown function and ferredoxi
8e-12
3bn7_A
120
Ferredoxin-like protein; stress responsive A/B bar
7e-11
3bde_A
120
MLL5499 protein; stress responsive A/B barrel doma
2e-10
>1q4r_A Protein AT3G17210; center for eukaryotic structural genom structural genomics, protein structure initiative, CESG, UN function; 1.90A {Arabidopsis thaliana} SCOP: d.58.4.4 PDB: 1q53_A 2q3p_A Length = 112
Hypothetical protein YQJZ; SR435, protein structur
80.01
>1q4r_A Protein AT3G17210; center for eukaryotic structural genom structural genomics, protein structure initiative, CESG, UN function; 1.90A {Arabidopsis thaliana} SCOP: d.58.4.4 PDB: 1q53_A 2q3p_A
>3fmb_A Dimeric protein of unknown function and ferredoxi fold; YP_212648.1, stress responsive A/B barrel domain; HET: MSE; 1.85A {Bacteroides fragilis}
>3bm7_A Protein of unknown function with ferredoxin-like; ferredoxin-like fold, antibiotic biosynthesis monooxygenase, structural genomics; HET: MSE; 1.35A {Caulobacter crescentus}
>2bbe_A Hypothetical protein SO0527; MCSG, structural genomics, PSI, protein structure in midwest center for structural genomics; 1.97A {Shewanella oneidensis}
>4dn9_A Antibiotic biosynthesis monooxygenase; structural genomics,protein structure initiative, NEW YORK S genomix research consortium, nysgrc; 2.05A {Chloroflexus aurantiacus}
>3f44_A Putative monooxygenase; YP_193413.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.55A {Lactobacillus acidophilus ncfm}
