Citrus Sinensis ID: 035434
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
No hits with e-value below 0.001 by BLAST
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 48 | ||||||
| 359492270 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.645 | 0.140 | 0.843 | 3e-06 | |
| 224065789 | 253 | predicted protein [Populus trichocarpa] | 0.666 | 0.126 | 0.727 | 2e-05 |
| >gi|359492270|ref|XP_003634392.1| PREDICTED: uncharacterized protein LOC100249003 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 55.8 bits (133), Expect = 3e-06, Method: Composition-based stats.
Identities = 27/32 (84%), Positives = 31/32 (96%), Gaps = 1/32 (3%)
Query: 16 EFALRPKLISCNAEAAGVDAGATDNLRRLLRL 47
+F+LRPKL SCNAEAAG+DAGAT+NLRRLLRL
Sbjct: 190 KFSLRPKL-SCNAEAAGIDAGATNNLRRLLRL 220
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224065789|ref|XP_002301962.1| predicted protein [Populus trichocarpa] gi|222843688|gb|EEE81235.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
No confident hit detected by STRING
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 48 | |||
| PF15365 | 58 | PNRC: Proline-rich nuclear receptor coactivator | 98.48 | |
| COG3807 | 171 | Uncharacterized protein conserved in bacteria [Fun | 91.69 |
| >PF15365 PNRC: Proline-rich nuclear receptor coactivator | Back alignment and domain information |
|---|
Probab=98.48 E-value=5.3e-08 Score=55.61 Aligned_cols=40 Identities=28% Similarity=0.321 Sum_probs=32.2
Q ss_pred cCCcccccccccccccc--ccchh-hhccCcchhHHHHHhhhc
Q 035434 8 SGDCYASGEFALRPKLI--SCNAE-AAGVDAGATDNLRRLLRL 47 (48)
Q Consensus 8 ~~~~lPlP~FSlk~K~~--~CnaE-aagvdd~atdnLRRLLRL 47 (48)
+|++||+|.|+.+++.. +|..| ....++.+|++||||||+
T Consensus 15 ~PssLP~P~f~~~~~~~~~~~~~~~~~~~~~~~T~~Lr~LL~v 57 (58)
T PF15365_consen 15 SPSSLPLPPFHWKSSPSSLSSCPESPSSDDESMTRQLRRLLKV 57 (58)
T ss_pred ChhhcCCCCcccccCccccccccccccccHHHHHHHHHHHHcc
Confidence 68899999999998663 33333 557889999999999997
|
|
| >COG3807 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00