Citrus Sinensis ID: 035556

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MKGTRKKRDKVEGTWISSSLSITKRTRKKRKKLGTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCKEWSF
cccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHccccHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccc
ccccEEccccccccccHHHHccccccccccccccccHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEHHcccHHHcccccccccHHHHHHHHHHHHcccHHHHHHHcHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccEEccccccccccccccccHHccccHHHHHHHHHHHcccccccccc
mkgtrkkrdkvegtwissSLSITKRTRKKRKKLGTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCkksgnpealyrqgmhdyfslgltnsGFRLLKRaadkkhpeatYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNItvdqhgeysaeTCDCLRTRMRGWDDGLDKLIGScesclcvtevNFFCDLlrssscckewsf
mkgtrkkrdkvegtwissslsitkrtrkkrkklgtsieslphalLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKiragvinslWIRNitvdqhgeySAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLrssscckewsf
MKGTRKKRDKVEGTWissslsitkrtrkkrkklgtsIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCKEWSF
***************************************LPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCK****
**************************************SLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCKEWSF
************GTWISSSLSI***********GTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCKEWSF
**********************************TSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCKEW**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGTRKKRDKVEGTWISSSLSITKRTRKKRKKLGTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSLKSTYGIRECRTKIRAGVINSLWIRNITVDQHGEYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSSSCCKEWSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q9FXC7296 Putative F-box protein At yes no 0.781 0.689 0.340 5e-23
Q1PEW8163 F-box protein At2g35280 O no no 0.475 0.760 0.317 4e-09
Q9FYF9 379 F-box protein At1g67340 O no no 0.459 0.316 0.270 5e-05
>sp|Q9FXC7|FB79_ARATH Putative F-box protein At1g67623 OS=Arabidopsis thaliana GN=At1g67623 PE=4 SV=1 Back     alignment and function desciption
 Score =  108 bits (269), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 117/223 (52%), Gaps = 19/223 (8%)

Query: 16  ISSSLSITKRTRKKRKKLGTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAAD 75
           +S SL  +   RK + K    ++SLP  LL E+ +   ++SL  +  L+L  K F +  D
Sbjct: 3   VSLSLHASSSIRKSKTKASLCLDSLPEDLLVEISSCTGASSLSAVRNLRLVSKSFRRICD 62

Query: 76  DDFVFEHASLDKF-YVVWPMTDRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFR 134
           + +VF   SL +  ++ W     +++ F+ RC +S NPEAL+++G  +YF   L + G  
Sbjct: 63  EKYVFYRLSLKEIEFLPW---HENSAKFIERCTESRNPEALFQKGFINYFRDKLQDRGLE 119

Query: 135 LLKRAADKKHPEATYVYTIIMLLCCGSQFKKQGFELLSSL------KSTYGIRECRTKIR 188
            L  AA+K   EA YVY +I L+C G + K++GFE+LSS+       +   + E R KI+
Sbjct: 120 YLAEAAEKGIKEAKYVYGVI-LICLGGKTKQKGFEILSSVIKQLMSTTMNELVEFRYKIQ 178

Query: 189 AGVINSLWIRNITVDQ-HGEYSAETCDC-LRTRM------RGW 223
                  W  N  V+Q    Y +E C C  +TRM      RGW
Sbjct: 179 KIRYGFWWSDNTVVEQLKTAYVSEKCKCDCKTRMLLLVMNRGW 221

Arabidopsis thaliana (taxid: 3702)
>sp|Q1PEW8|FB127_ARATH F-box protein At2g35280 OS=Arabidopsis thaliana GN=At2g35280 PE=2 SV=1 Back     alignment and function description
>sp|Q9FYF9|FB76_ARATH F-box protein At1g67340 OS=Arabidopsis thaliana GN=At1g67340 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
224122932238 predicted protein [Populus trichocarpa] 0.800 0.878 0.440 3e-40
147773103241 hypothetical protein VITISV_039291 [Viti 0.869 0.941 0.406 1e-36
357478767256 F-box protein [Medicago truncatula] gi|3 0.873 0.890 0.354 3e-33
255547876182 conserved hypothetical protein [Ricinus 0.597 0.857 0.496 6e-32
357485797254 F-box protein [Medicago truncatula] gi|3 0.869 0.893 0.364 1e-31
449439561260 PREDICTED: putative F-box protein At1g67 0.927 0.930 0.338 6e-28
358348963250 F-box protein [Medicago truncatula] gi|3 0.816 0.852 0.351 3e-27
449435498255 PREDICTED: putative F-box protein At1g67 0.858 0.878 0.347 3e-26
449517999246 PREDICTED: putative F-box protein At1g67 0.869 0.922 0.338 4e-26
357479085172 F-box protein [Medicago truncatula] gi|3 0.578 0.877 0.368 1e-24
>gi|224122932|ref|XP_002318952.1| predicted protein [Populus trichocarpa] gi|222857328|gb|EEE94875.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 137/220 (62%), Gaps = 11/220 (5%)

Query: 40  LPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVVWPMTDRHA 99
            P  LLTEV+A+VAS S+ DL   KLSCK FL+AA ++++FEH +++K  V+       A
Sbjct: 17  FPKDLLTEVLARVASASISDLFTAKLSCKEFLEAASENYIFEHITIEKLPVIPWRISHGA 76

Query: 100 SLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCC 159
           S FL RCK++GNPEAL+RQGM ++FS     SGF+ LK AA K H EA Y   +I L+C 
Sbjct: 77  SSFLARCKENGNPEALFRQGMVEFFSSNKPESGFQHLKNAARKGHVEAIYTCGVI-LVCH 135

Query: 160 GSQFKKQGFELLSSLKSTYG----IRECRTKIRAGVINSLWI--RNITV-DQHGEYSAET 212
           G QFK++G ELLSSLK+       I+ECR KI+  ++ S+WI  R   +  +  +    T
Sbjct: 136 GGQFKQEGIELLSSLKNYKSRHRTIKECRDKIKE-ILQSMWIDRREAGIGPEEPKSHGRT 194

Query: 213 CDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRS 252
           C+C +   RGW D  ++   +C+ C+   E   FC +LR+
Sbjct: 195 CNCSKFNKRGWID--EEEYTTCDYCVWDHEATLFCKILRA 232

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147773103|emb|CAN71689.1| hypothetical protein VITISV_039291 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357478767|ref|XP_003609669.1| F-box protein [Medicago truncatula] gi|355510724|gb|AES91866.1| F-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255547876|ref|XP_002514995.1| conserved hypothetical protein [Ricinus communis] gi|223546046|gb|EEF47549.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357485797|ref|XP_003613186.1| F-box protein [Medicago truncatula] gi|355514521|gb|AES96144.1| F-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449439561|ref|XP_004137554.1| PREDICTED: putative F-box protein At1g67623-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358348963|ref|XP_003638510.1| F-box protein [Medicago truncatula] gi|355504445|gb|AES85648.1| F-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449435498|ref|XP_004135532.1| PREDICTED: putative F-box protein At1g67623-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449517999|ref|XP_004166031.1| PREDICTED: putative F-box protein At1g67623-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|357479085|ref|XP_003609828.1| F-box protein [Medicago truncatula] gi|355510883|gb|AES92025.1| F-box protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
TAIR|locus:2824055296 AT1G67623 "AT1G67623" [Arabido 0.701 0.618 0.361 2.6e-22
TAIR|locus:5019474674243 AT1G74875 "AT1G74875" [Arabido 0.743 0.798 0.336 4e-19
TAIR|locus:2063454163 AT2G35280 "AT2G35280" [Arabido 0.517 0.828 0.309 1e-10
TAIR|locus:2093325114 AT3G30430 "AT3G30430" [Arabido 0.398 0.912 0.304 1.2e-06
TAIR|locus:2019604 379 AT1G67340 "AT1G67340" [Arabido 0.452 0.311 0.275 0.0002
TAIR|locus:2824055 AT1G67623 "AT1G67623" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 2.6e-22, P = 2.6e-22
 Identities = 73/202 (36%), Positives = 109/202 (53%)

Query:    37 IESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKF-YVVWPMT 95
             ++SLP  LL E+ +   ++SL  +  L+L  K F +  D+ +VF   SL +  ++ W   
Sbjct:    24 LDSLPEDLLVEISSCTGASSLSAVRNLRLVSKSFRRICDEKYVFYRLSLKEIEFLPW--- 80

Query:    96 DRHASLFLMRCKKSGNPEALYRQGMHDYFSLGLTNSGFRLLKRAADKKHPEATYVYTIIM 155
               +++ F+ RC +S NPEAL+++G  +YF   L + G   L  AA+K   EA YVY +I 
Sbjct:    81 HENSAKFIERCTESRNPEALFQKGFINYFRDKLQDRGLEYLAEAAEKGIKEAKYVYGVI- 139

Query:   156 LLCCGSQFKKQGFELLSS----LKSTY--GIRECRTKIRAGVINSLWIRNITVDQ-HGEY 208
             L+C G + K++GFE+LSS    L ST    + E R KI+       W  N  V+Q    Y
Sbjct:   140 LICLGGKTKQKGFEILSSVIKQLMSTTMNELVEFRYKIQKIRYGFWWSDNTVVEQLKTAY 199

Query:   209 SAETCDC-LRTRM------RGW 223
              +E C C  +TRM      RGW
Sbjct:   200 VSEKCKCDCKTRMLLLVMNRGW 221
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:5019474674 AT1G74875 "AT1G74875" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063454 AT2G35280 "AT2G35280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093325 AT3G30430 "AT3G30430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019604 AT1G67340 "AT1G67340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.14
KOG1550552 consensus Extracellular protein SEL-1 and related 97.8
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.76
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.6
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.44
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.44
KOG1550 552 consensus Extracellular protein SEL-1 and related 96.74
KOG2997366 consensus F-box protein FBX9 [General function pre 96.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.79
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 93.71
KOG4014248 consensus Uncharacterized conserved protein (conta 92.24
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.01
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 91.97
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 91.69
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 91.66
PRK10370198 formate-dependent nitrite reductase complex subuni 87.38
PF12688120 TPR_5: Tetratrico peptide repeat 87.2
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 85.95
KOG4014248 consensus Uncharacterized conserved protein (conta 85.64
PRK15359144 type III secretion system chaperone protein SscB; 84.97
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 81.46
PRK11906458 transcriptional regulator; Provisional 81.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 80.5
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information 
Probab=98.14  E-value=1.2e-06  Score=59.52  Aligned_cols=46  Identities=33%  Similarity=0.578  Sum_probs=39.5

Q ss_pred             CCCCChHHHHHHHHHhcccChhhhHHHHHhcHHHHHhhcCHHHHHhcCc
Q 035556           37 IESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASL   85 (261)
Q Consensus        37 ~~~LPdDLlv~I~arVa~~S~~Dl~~l~ltcK~f~~l~~~~~Vl~~~sl   85 (261)
                      ++.||+|++.+|+..+.   +.|+.++.+|||+|++++.++.+++++.+
T Consensus         1 i~~LP~Eil~~If~~L~---~~dl~~~~~vcr~w~~~~~~~~lW~~~~~   46 (47)
T PF12937_consen    1 ISSLPDEILLEIFSYLD---PRDLLRLSLVCRRWRRIANDNSLWRRLCL   46 (47)
T ss_dssp             CCCS-HHHHHHHHTTS----HHHHHHHTTSSHHHHHHHTCCCHHHHHC-
T ss_pred             ChHhHHHHHHHHHhcCC---HHHHHHHHHHHHHHHHHHCChhhhhhhcc
Confidence            46899999999998885   88999999999999999999999887654

>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 41.4 bits (96), Expect = 2e-04
 Identities = 40/287 (13%), Positives = 77/287 (26%), Gaps = 88/287 (30%)

Query: 31  KKLGTSIESLPH----------ALLTEVMAQVASTS----LVDLSRLKLSCKYFLQAADD 76
           K L    + LP           +++ E +    +T      V+  +L    +  L   + 
Sbjct: 309 KYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEP 368

Query: 77  D---------FVFE---HASLDKFYVVWP-MTDRHASLFLMRC-KKS----GNPEALYRQ 118
                      VF    H       ++W  +      + + +  K S       E+    
Sbjct: 369 AEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTIS- 427

Query: 119 GMHD-YFSLGLTNSGFRLL----------KRAADKKH----PEATYVYTIIM--LLCCGS 161
            +   Y  L +       L           +  D           Y Y+ I   L     
Sbjct: 428 -IPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHL----- 481

Query: 162 QFKKQGFELLSSLKSTY-GIRECRTKIR---------AGVINSL-----WIRNITVDQHG 206
               +  E ++  +  +   R    KIR           ++N+L     +   I  D   
Sbjct: 482 -KNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYIC-DNDP 539

Query: 207 EYSAETCDCLRTRMRGWDDGLDKLIGSCESCLCVTEVNFFCDLLRSS 253
           +Y                  +   +   E  L  ++   + DLLR +
Sbjct: 540 KYERLVNA------------ILDFLPKIEENLICSK---YTDLLRIA 571

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.44
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.42
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.33
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.1
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.07
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.04
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.93
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.86
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.56
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.54
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.12
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.47
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.25
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 94.96
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 94.95
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.89
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 93.53
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 93.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 92.86
3k9i_A117 BH0479 protein; putative protein binding protein, 92.66
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 92.17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 91.92
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 91.79
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 91.65
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 90.31
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 89.67
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 89.49
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 89.27
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 88.99
2kat_A115 Uncharacterized protein; NESG, structure, structur 88.64
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 88.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 87.41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 87.37
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 87.29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 86.86
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 86.19
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 86.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 85.51
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 85.44
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 85.35
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 85.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 84.55
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 84.49
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 84.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 84.08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 83.97
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 83.86
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 83.84
1pc2_A152 Mitochondria fission protein; unknown function; NM 83.74
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 83.44
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 83.33
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 83.05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 83.01
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 82.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 82.61
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 82.27
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 81.48
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 81.32
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 81.16
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 81.11
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 81.1
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 81.06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 80.99
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 80.97
3u4t_A272 TPR repeat-containing protein; structural genomics 80.56
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 80.06
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
Probab=98.74  E-value=6.3e-08  Score=76.95  Aligned_cols=83  Identities=7%  Similarity=-0.045  Sum_probs=74.2

Q ss_pred             CcchHHHHHHHHhcCCchHHHHHHHHHHhc---cCCcHHHHHHHHHHhhcCCchhHHHHHHHHHhccCc-chHHHHHHHH
Q 035556           96 DRHASLFLMRCKKSGNPEALYRQGMHDYFS---LGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGS-QFKKQGFELL  171 (261)
Q Consensus        96 ~~ka~~FL~rCleaGNpeA~Y~~Gm~~~~~---~~~~~~Gl~lL~~AA~~G~~~A~Y~lgmL~l~~~G~-e~~~~a~~~f  171 (261)
                      ..++..++.++++.||++|+|.+|++.+..   .+|.++|+.++.+|++.|++.|.|++|+++.+|.|. .+.++|+++|
T Consensus        41 ~~~A~~~~~~Aa~~g~~~a~~~Lg~~y~~G~g~~~d~~~A~~~~~~Aa~~g~~~a~~~Lg~~y~~G~g~~~d~~~A~~~~  120 (138)
T 1klx_A           41 KQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTF  120 (138)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSSSCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCCHHHHHHHHHHHHcCCCCCccHHHHHHHHHHHHcCCCHHHHHHHHHHHHCCCCCCcCHHHHHHHH
Confidence            345889999999999999999999998853   678899999999999999999999999999998886 5699999999


Q ss_pred             HHhhccc
Q 035556          172 SSLKSTY  178 (261)
Q Consensus       172 ~~~~~t~  178 (261)
                      .++-+.-
T Consensus       121 ~~Aa~~g  127 (138)
T 1klx_A          121 EKACRLG  127 (138)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHCC
Confidence            9987544
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.86
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.6
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.36
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.74
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.68
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.12
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 95.88
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.88
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 88.52
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 88.51
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.29
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 86.2
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 83.91
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 83.57
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 83.25
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 82.06
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 81.5
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: HCP-like
family: HCP-like
domain: Cysteine rich protein B (HcpB)
species: Helicobacter pylori [TaxId: 210]

Probab=98.86  E-value=5.8e-09  Score=80.90  Aligned_cols=90  Identities=8%  Similarity=-0.003  Sum_probs=76.9

Q ss_pred             CCCcchHHHHHHHHhcCCchHHHHHHHHHHh---ccCCcHHHHHHHHHHhhcCCchhHHHHHHHHHhccCc-chHHHHHH
Q 035556           94 MTDRHASLFLMRCKKSGNPEALYRQGMHDYF---SLGLTNSGFRLLKRAADKKHPEATYVYTIIMLLCCGS-QFKKQGFE  169 (261)
Q Consensus        94 ~~~~ka~~FL~rCleaGNpeA~Y~~Gm~~~~---~~~~~~~Gl~lL~~AA~~G~~~A~Y~lgmL~l~~~G~-e~~~~a~~  169 (261)
                      .+..++..++.++++.|||+|+|.+|.+.+.   ...|...|++++.+|+..|++.|.|.+|+++.+|.|. .+.++|++
T Consensus        37 ~~~~~a~~~~~~aa~~g~~~a~~~Lg~~y~~g~~~~~d~~~A~~~~~~aa~~g~~~a~~~Lg~~y~~G~gv~~d~~~A~~  116 (133)
T d1klxa_          37 INKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVK  116 (133)
T ss_dssp             SCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSSSCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHH
T ss_pred             cCHHHHHHHHhhhhcccchhhhhhHHHhhhhccccchhhHHHHHHHhhhhccCcchHHHHHHHHHHcCCccCCCHHHHHH
Confidence            3456788999999999999999999998874   3556799999999999999999999999999999886 46999999


Q ss_pred             HHHHhhcccchHHH
Q 035556          170 LLSSLKSTYGIREC  183 (261)
Q Consensus       170 ~f~~~~~t~~~~ec  183 (261)
                      ||.++-+.-....|
T Consensus       117 ~~~~Aa~~G~~~A~  130 (133)
T d1klxa_         117 TFEKACRLGSEDAC  130 (133)
T ss_dssp             HHHHHHHTTCHHHH
T ss_pred             HHHHHHHCCCHHHH
Confidence            99998754444444
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure