Citrus Sinensis ID: 035699

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630---
MDSEDNLKTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEIFARVPRKESESKTNTILDAAHYDADDDVIRITASTNKKRFRKRIGSEDDDDEGIASVEEERRVVRRRIPREEEDDGSDSEEERLRDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDDGIENLREVSRQKYLPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVGQEGLQRCSHESDKQQRKKADLKYGSKNKKQQYDDYQYVFEIEDKIVDFFRESVELPDKSAVKSALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT
ccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccHHcccHHHHHHHHHccccccccHHHHHHHcccccccEEEEcccccHHHHHHHHccccEEEEccccccccEEEccccHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHccccccccccEEEEEccccccccccccEEEEEcccccccccccccccccccccccccHHHHHccc
cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHccccHHHccccccccccccccccHccccHHHHcccccccccccccccccHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHcccccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEcccHHHHHHHHccccHHccEEEEEccccccccEEEEEcccccHHHHHHHHccccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEccccccccccEEEEEEccHHHHHccc
mdsednlkTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEIFArvprkesesktntildaahydadddviRITASTNKKRfrkrigseddddegiaSVEEERRVVRrripreeeddgsdseEERLRDQRGKEELERRIRERDVAATrkltgpkltwkEEYDAIQRSrkddgienlrevsrqkylPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVgqeglqrcshesdKQQRKKADLKygsknkkqqyddYQYVFEIEDKIVDFFResvelpdkSAVKSALEMLQEErktlpiypfREELLQAVSEYPVLVIVGetgsgkttqipqylyeagytkqgkigCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSatldaenfsdyfgsapifkiprrrYHVELFytkapeadYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIicpiygnlptelqakifeptpegaRKVVLATNIaetsltidgikyvidpgfakvksynpktgmesllvnpiskasanqrt
MDSEDNLKTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEifarvprkesesktntildaahydadddviritastnkkrfrkrigseddddegiasveeerrvvrrripreeeddgsdseeerlrdqrgkeelerrirerdvaatrkltgpkltwkeeydaiqrsrkddgienlrevsrqkylpkraqkkleeikdrtkdkenlfegqkltgaelcELDYEKKILDLVGQEGlqrcshesdkqqrkkadlkygsknkkqqyddyQYVFEIEDKIVDFFRESVELPDKSAVKSALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGetgsgkttqIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVgysirfedctsdKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATniaetsltidgikyviDPGFAKVKSYNpktgmesllvnpiskasanqrt
MDSEDNLKTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEIFARVPRKESESKTNTILDAAHYDADDDVIRITASTNKKRFRKRIGSEDDDDEGIASveeerrvvrrripreeeddgsdseeeRLRDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDDGIENLREVSRQKYLPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVGQEGLQRCSHESDKQQRKKADLKYGSKNKKQQYDDYQYVFEIEDKIVDFFRESVELPDKSAVKSALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLrrvaamsvaarvsQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT
*******KTWVSDKLISLLGYSQPAVVQYVIGLSKQAL**********************FAQEIF**************ILDAAHYDADDDVIRI*****************************************************************************************************************************************KLTGAELCELDYEKKILDLVGQ******************************YDDYQYVFEIEDKIVDFFRESVEL************L**ERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYN**********************
*****NL**WVSDKLISLLGYSQPAVVQYVIGLS*********************T******************************************************************************************************************************************************************IKDRTKDKE**************************************************************************************************RKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRT****TKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQR*
********TWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEIFAR*********TNTILDAAHYDADDDVIRITASTNK****************IASVEEERRVVRRRIP************************ERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDDGIENLREVSRQKYLPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVGQE*******************KYGSKNKKQQYDDYQYVFEIEDKIVDFFRESVELPDKSAVKSALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT
****DNLKTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEIFARVPRKE***************************************************************************LRDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDDGIENLREVSRQKYLPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVGQEGLQRCSHESDKQQRKK*************YDDYQYVFEIEDKIVDFFRESVE***********EMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKA******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSEDNLKTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRAFAQEIFARVPRKESESKTNTILDAAHYDADDDVIRITASTNKKRFRKRIGSEDDDDEGIASVEEERRVVRRRIPREEEDDGSDSEEERLRDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDDGIENLREVSRQKYLPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVGQEGLQRCSHESDKQQRKKADLKYGSKNKKQQYDDYQYVFEIEDKIVDFFRESVELPDKSAVKSALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query633 2.2.26 [Sep-21-2011]
Q54MH3 1106 Putative pre-mRNA-splicin yes no 0.758 0.433 0.502 1e-143
O45244 1008 Probable pre-mRNA-splicin yes no 0.957 0.601 0.429 1e-142
Q7YR39 1044 Putative pre-mRNA-splicin yes no 0.785 0.476 0.485 1e-141
O60231 1041 Putative pre-mRNA-splicin yes no 0.785 0.477 0.485 1e-141
Q10752 1055 Pre-mRNA-splicing factor yes no 0.984 0.590 0.432 1e-140
Q767K6 1045 Putative pre-mRNA-splicin yes no 0.785 0.475 0.484 1e-139
Q54F05 1160 ATP-dependent RNA helicas no no 0.502 0.274 0.575 1e-114
Q14562 1220 ATP-dependent RNA helicas no no 0.499 0.259 0.580 1e-112
Q38953 1168 Probable pre-mRNA-splicin no no 0.491 0.266 0.590 1e-112
A2A4P0 1244 ATP-dependent RNA helicas no no 0.499 0.254 0.580 1e-112
>sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 Back     alignment and function desciption
 Score =  508 bits (1309), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 282/561 (50%), Positives = 361/561 (64%), Gaps = 81/561 (14%)

Query: 150 RDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDDGIENLREVSRQKYLP 209
           R+QR  +EL  RI++RD  +T+K        KE  +   R  +++ +E  R  SR+KYL 
Sbjct: 232 REQREVKELSDRIKKRDEKSTKKKIVDDSETKESIERKNRLEQNEQLETERTKSRRKYLV 291

Query: 210 KRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLVGQ-------------- 255
              QK+L  +K   +++  LF+ QKLT  E+ + + +KK+ +L  Q              
Sbjct: 292 GEEQKRLILLKREIEEEYELFKDQKLTEQEIKDFEKKKKLYELASQRINESQQSDDYYQL 351

Query: 256 -------EGLQRCSHESDKQQRKKADLK----YGSKNKKQQYD----------------- 287
                  + L + S+ +D + +K  D      Y  + K+ + +                 
Sbjct: 352 PSEIKDKDSLLKSSYINDNKNKKGNDSSSSSSYNPEQKEWEQNRMKSAISENRGLSTANI 411

Query: 288 -----DYQYVFEIEDKIVDFFRESVEL------------PDKSAVKSALEMLQEERKTLP 330
                +Y+YVFE +   ++F +E V              P       A   +QE RK+LP
Sbjct: 412 GGGNEEYEYVFEDQ---IEFIKEEVLKQGQKGDGVMILKPGDDGSAQAKMTIQEVRKSLP 468

Query: 331 IYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSV 390
           +YP+RE+L+ AV EY VL+IVGETGSGKTTQIPQYL+EAG++K GKIGCTQ RRVAAMSV
Sbjct: 469 VYPYREQLIDAVREYQVLIIVGETGSGKTTQIPQYLHEAGFSKTGKIGCTQPRRVAAMSV 528

Query: 391 AARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLI--- 447
           AARV++E+G KLG+EVGYSIRFEDCTS KTVL+YMTDGML+RE +  P L SYSVLI   
Sbjct: 529 AARVAEEVGCKLGNEVGYSIRFEDCTSQKTVLQYMTDGMLVREFLTAPDLASYSVLIIDE 588

Query: 448 ----------------DLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVEL 491
                           D+  +RPDLKLLISSAT+DAE FSDYF  AP F IP R+Y V  
Sbjct: 589 AHERTLHTDILFGLLKDITRFRPDLKLLISSATMDAERFSDYFDGAPTFNIPGRKYEVTT 648

Query: 492 FYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAE 551
            YT+APEADY++AA+VT LQIH+ EP+GDILVFLTGQ++ + A E+L+ RTRGLGTKI E
Sbjct: 649 HYTQAPEADYLDAAVVTVLQIHITEPLGDILVFLTGQEEVDQAAEMLQTRTRGLGTKIKE 708

Query: 552 LIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYN 611
           LII  IY  LPT+LQAKIFEPTP  ARKVVLATNIAETSLTIDGI YVIDPGF K K +N
Sbjct: 709 LIITRIYSTLPTDLQAKIFEPTPPNARKVVLATNIAETSLTIDGIIYVIDPGFCKQKMFN 768

Query: 612 PKTGMESLLVNPISKASANQR 632
           P+TGMESL++ P+S+ASANQR
Sbjct: 769 PRTGMESLVITPVSRASANQR 789
Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
Dictyostelium discoideum (taxid: 44689)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 Back     alignment and function description
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function description
>sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query633
297733904 954 unnamed protein product [Vitis vinifera] 0.988 0.656 0.601 0.0
225457283 1056 PREDICTED: putative pre-mRNA-splicing fa 0.988 0.592 0.6 0.0
356516851 1035 PREDICTED: putative pre-mRNA-splicing fa 0.985 0.602 0.618 0.0
356516849 1044 PREDICTED: putative pre-mRNA-splicing fa 0.985 0.597 0.612 0.0
449440832 1055 PREDICTED: putative pre-mRNA-splicing fa 0.993 0.596 0.598 0.0
449477532 1049 PREDICTED: LOW QUALITY PROTEIN: putative 0.985 0.594 0.598 0.0
145360634 1044 helicase domain-containing protein [Arab 0.985 0.597 0.541 0.0
110741835 1044 putative pre-mRNA splicing factor RNA he 0.985 0.597 0.540 0.0
334182986 1034 pre-mRNA-splicing factor ATP-dependent R 0.982 0.601 0.565 0.0
22329903 1044 pre-mRNA-splicing factor ATP-dependent R 0.982 0.595 0.559 0.0
>gi|297733904|emb|CBI15151.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/743 (60%), Positives = 523/743 (70%), Gaps = 117/743 (15%)

Query: 1   MDSEDNLKTWVSDKLISLLGYSQPAVVQYVIGLSKQALSSADLETKLQEFEFSSTTETRA 60
           M SE NLK WVSDKL+SLLGYSQP +VQYV+GL+KQA S AD+  KL EF  S+++ETR+
Sbjct: 1   MGSESNLKVWVSDKLMSLLGYSQPTLVQYVVGLAKQASSPADVVGKLVEFGLSASSETRS 60

Query: 61  FAQEIFARVPRKES-----------------ESKTNTILDAAHYDADDDVIRIT------ 97
           FA+EIF++VP K S                 + KT  ILDA   D+D+D   I       
Sbjct: 61  FAEEIFSKVPHKASGLNVYQKQEREAAMLVRKQKTYAILDAD--DSDEDGGGIVDNRSST 118

Query: 98  ----------ASTNKKRFRKRI-GSEDD-DDEGIASVEEERRVVRRRIPREEEDDGSDSE 145
                     A T+KKRFRK+    EDD DDE IA  EE R+V RR    ++EDD S+ E
Sbjct: 119 AAPAASQSEKADTHKKRFRKKTENVEDDADDEVIARAEESRQVKRR--TSQDEDDDSELE 176

Query: 146 EERLRDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSR--KDDGIENLREVS 203
           EE LRD+R +E+LE+ IR+RD A TRKLT  KL+ KEE +AI+RS   ++D I  LR+VS
Sbjct: 177 EESLRDRREREQLEQNIRQRDAAGTRKLTEQKLSRKEEEEAIRRSNAMEEDDISALRKVS 236

Query: 204 RQKYLPKRAQKKLEEIKDRTKDKENLFEGQKLTGAELCELDYEKKILDLV---------- 253
           RQ+YL KR QKKLEE++D  +D++ LF+G KLT AE  EL Y+++I DLV          
Sbjct: 237 RQEYLKKREQKKLEELRDDIEDEQYLFDGVKLTEAEQRELRYKREIYDLVKKRSEETDDI 296

Query: 254 ---------GQEG-----------LQRC--SHESDK------------QQRKKADLKYGS 279
                     QEG           LQR   S  +DK             Q  KA LK+GS
Sbjct: 297 NEYRMPDAYDQEGGVNQEKRFSVALQRYRDSSANDKMNPFAEQEAWEEHQIGKATLKFGS 356

Query: 280 KNKKQQYDDYQYVFEIEDKIVDFFRESV------------ELPDKSAVKSALEMLQEERK 327
           K+K Q+ DDYQ VFE +   ++F + SV            E  D S  KS LE LQE+RK
Sbjct: 357 KDKNQKSDDYQLVFEDQ---IEFIKASVMDGDKFEDGLFAESHDDSVAKSELEKLQEDRK 413

Query: 328 TLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAA 387
            LPIYP+R+ELL+AV ++ +LVIVGETGSGKTTQIPQYL+E+GYTK+GK+GCTQ RRVAA
Sbjct: 414 MLPIYPYRDELLKAVDDHQILVIVGETGSGKTTQIPQYLHESGYTKRGKVGCTQPRRVAA 473

Query: 388 MSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVL- 446
           MSVAARVSQEMGVKLGHEVGYSIRFEDCTS+KTVLKYMTDGMLLRE + EP L SYSV+ 
Sbjct: 474 MSVAARVSQEMGVKLGHEVGYSIRFEDCTSEKTVLKYMTDGMLLREFLGEPDLASYSVVM 533

Query: 447 ----------------IDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVE 490
                           +D+  +RPDLKLLISSATLDAE FSDYF SAPIFKIP RRY VE
Sbjct: 534 VDEAHERTLSTDILFGLDIARFRPDLKLLISSATLDAEKFSDYFDSAPIFKIPGRRYPVE 593

Query: 491 LFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIA 550
           + YTKAPEADY++AAIVTALQIHV +P GDILVFLTGQ++ ETAEEI+K RTRGLGTKIA
Sbjct: 594 IHYTKAPEADYLDAAIVTALQIHVTQPPGDILVFLTGQEEIETAEEIMKHRTRGLGTKIA 653

Query: 551 ELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSY 610
           ELIICPIY NLPTELQA IFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGF K+KSY
Sbjct: 654 ELIICPIYANLPTELQANIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFCKMKSY 713

Query: 611 NPKTGMESLLVNPISKASANQRT 633
           NP+TGMESLLVNPISKASA QR 
Sbjct: 714 NPRTGMESLLVNPISKASAMQRA 736

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225457283|ref|XP_002284415.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356516851|ref|XP_003527106.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356516849|ref|XP_003527105.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|449440832|ref|XP_004138188.1| PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449477532|ref|XP_004155050.1| PREDICTED: LOW QUALITY PROTEIN: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|145360634|ref|NP_181077.3| helicase domain-containing protein [Arabidopsis thaliana] gi|330254002|gb|AEC09096.1| helicase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110741835|dbj|BAE98860.1| putative pre-mRNA splicing factor RNA helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182986|ref|NP_001185127.1| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] gi|332193372|gb|AEE31493.1| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22329903|ref|NP_174527.2| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] gi|18377729|gb|AAL67014.1| putative RNA helicase [Arabidopsis thaliana] gi|22136924|gb|AAM91806.1| putative RNA helicase [Arabidopsis thaliana] gi|332193371|gb|AEE31492.1| pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query633
TAIR|locus:2062492 1044 MEE29 "maternal effect embryo 0.301 0.182 0.738 1.5e-174
TAIR|locus:2033723 1044 ESP3 "ENHANCED SILENCING PHENO 0.300 0.181 0.778 2.5e-134
WB|WBGene00003392 1008 mog-4 [Caenorhabditis elegans 0.300 0.188 0.638 5.7e-127
UNIPROTKB|O45244 1008 mog-4 "Probable pre-mRNA-splic 0.300 0.188 0.638 5.7e-127
ZFIN|ZDB-GENE-030131-8589 1054 dhx16 "DEAH (Asp-Glu-Ala-His) 0.300 0.180 0.647 4.4e-122
UNIPROTKB|F1PGL2 1042 DHX16 "Uncharacterized protein 0.300 0.182 0.647 2e-121
UNIPROTKB|E1BF68 1045 DHX16 "Uncharacterized protein 0.300 0.181 0.652 9.1e-121
UNIPROTKB|Q767K6 1045 DHX16 "Putative pre-mRNA-splic 0.300 0.181 0.647 1.5e-120
POMBASE|SPBC19C2.01 1055 cdc28 "ATP-dependent RNA helic 0.300 0.180 0.631 2.4e-115
DICTYBASE|DDB_G0285937 1106 dhx16 "putative RNA splicing f 0.300 0.171 0.705 2.7e-114
TAIR|locus:2062492 MEE29 "maternal effect embryo arrest 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 737 (264.5 bits), Expect = 1.5e-174, Sum P(4) = 1.5e-174
 Identities = 141/191 (73%), Positives = 163/191 (85%)

Query:   443 YSVLIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYI 502
             + ++ D+   RPDLKLLISSAT+DAE FSD+F  APIF+ P RRY V++ +T APEADY+
Sbjct:   537 FGLVKDIARARPDLKLLISSATMDAEKFSDFFDQAPIFRFPGRRYPVDICFTTAPEADYM 596

Query:   503 EAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLP 562
             +AAI T L IHV EP+GD+LVFL GQ++ E  EE LK + RGLGTKI ELIICPIY NLP
Sbjct:   597 DAAITTVLTIHVKEPLGDVLVFLPGQEEIEAVEENLKHKIRGLGTKIRELIICPIYANLP 656

Query:   563 TELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVN 622
             +ELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYV+DPGF+K+KSYNP+TGMESLLV 
Sbjct:   657 SELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGFSKMKSYNPRTGMESLLVT 716

Query:   623 PISKASANQRT 633
             PISKASA QRT
Sbjct:   717 PISKASATQRT 727
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
TAIR|locus:2033723 ESP3 "ENHANCED SILENCING PHENOTYPE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003392 mog-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O45244 mog-4 "Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8589 dhx16 "DEAH (Asp-Glu-Ala-His) box polypeptide 16" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGL2 DHX16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF68 DHX16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q767K6 DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
POMBASE|SPBC19C2.01 cdc28 "ATP-dependent RNA helicase Cdc28" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285937 dhx16 "putative RNA splicing factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XV.273.1
annotation not avaliable (1050 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-142
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 5e-75
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 3e-74
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 3e-64
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-54
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-19
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-15
smart0049082 smart00490, HELICc, helicase superfamily c-termina 5e-09
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 8e-07
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 5e-05
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  434 bits (1118), Expect = e-142
 Identities = 178/344 (51%), Positives = 222/344 (64%), Gaps = 26/344 (7%)

Query: 311 DKSAVKSALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAG 370
           D  +  + +  + E R  LP+   R+E+L+A+ +  V++IVGETGSGKTTQ+PQ+L E G
Sbjct: 31  DARSRSANVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEG 90

Query: 371 YTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGML 430
               GKIGCTQ RR+AA SVA RV++E+G KLG  VGYSIRFE   S +T +K MTDG+L
Sbjct: 91  LGIAGKIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGIL 150

Query: 431 LREIVLEPSLESYSVLI-----------DLI---------NYRPDLKLLISSATLDAENF 470
           LREI  +P L  YSV+I           D++           R DLKL+I SATLDAE F
Sbjct: 151 LREIQNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSATLDAERF 210

Query: 471 SDYFGSAPIFKIPRRRYHVELFYTKAPEADYI-EAAIVTALQIHVNEPIGDILVFLTGQD 529
           S YFG+AP+ +I  R Y VE+ Y    EADYI   AIV A+ IH+ E  G ILVFL GQ 
Sbjct: 211 SAYFGNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIHLREGSGSILVFLPGQR 270

Query: 530 QFETAEEILKQRTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEGARKVVLATNIAET 589
           + E   E L++   G      +L I P+YG L  E Q ++FEP P G RKVVLATNIAET
Sbjct: 271 EIERTAEWLEKAELG-----DDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAET 325

Query: 590 SLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT 633
           SLTI GI+YVID G AK K Y+P+TG+  L   PISKASA+QR 
Sbjct: 326 SLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRA 369

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 633
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 99.98
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 99.98
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.97
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.97
PTZ00424401 helicase 45; Provisional 99.97
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.97
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.97
PRK01172 674 ski2-like helicase; Provisional 99.96
PRK02362 737 ski2-like helicase; Provisional 99.96
PRK13767 876 ATP-dependent helicase; Provisional 99.96
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 99.95
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.95
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.95
KOG0346 569 consensus RNA helicase [RNA processing and modific 99.95
PRK09401 1176 reverse gyrase; Reviewed 99.94
PRK00254 720 ski2-like helicase; Provisional 99.94
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.94
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.94
PRK10689 1147 transcription-repair coupling factor; Provisional 99.94
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.94
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.94
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.94
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.93
KOG0327397 consensus Translation initiation factor 4F, helica 99.93
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.93
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.93
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.93
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.93
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.93
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.93
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.92
KOG4284 980 consensus DEAD box protein [Transcription] 99.92
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.92
PRK14701 1638 reverse gyrase; Provisional 99.91
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.91
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 99.9
COG1204 766 Superfamily II helicase [General function predicti 99.88
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.87
PHA02558501 uvsW UvsW helicase; Provisional 99.87
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.86
COG1205 851 Distinct helicase family with a unique C-terminal 99.86
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.86
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.84
PRK13766 773 Hef nuclease; Provisional 99.83
PRK05580 679 primosome assembly protein PriA; Validated 99.81
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.81
COG1202 830 Superfamily II helicase, archaea-specific [General 99.8
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.8
PRK09694 878 helicase Cas3; Provisional 99.78
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.78
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.77
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.75
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.74
KOG0354 746 consensus DEAD-box like helicase [General function 99.71
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.71
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.71
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.71
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.7
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.69
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.69
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.69
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.65
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.65
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.64
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.62
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.61
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.55
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.54
PRK04914 956 ATP-dependent helicase HepA; Validated 99.53
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.53
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.52
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.46
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.45
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.42
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.38
smart0031174 PWI PWI, domain in splicing factors. 99.28
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.25
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.2
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.17
smart00487201 DEXDc DEAD-like helicases superfamily. 99.13
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.12
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.09
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.08
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.03
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.94
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.93
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.88
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.87
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 98.87
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.85
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.82
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.82
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.78
PRK05298652 excinuclease ABC subunit B; Provisional 98.76
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.76
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.75
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.7
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 98.7
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 98.69
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.67
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 98.62
smart0049082 HELICc helicase superfamily c-terminal domain. 98.58
COG4096 875 HsdR Type I site-specific restriction-modification 98.57
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.57
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.57
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.55
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.52
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.35
PF0148077 PWI: PWI domain; InterPro: IPR002483 The PWI domai 98.34
KOG1123 776 consensus RNA polymerase II transcription initiati 98.23
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.15
PF1324576 AAA_19: Part of AAA domain 97.98
PRK14873 665 primosome assembly protein PriA; Provisional 97.93
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 97.91
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.82
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.66
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.52
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.32
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.3
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.24
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.24
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.14
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.07
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.06
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.03
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.03
KOG0387 923 consensus Transcription-coupled repair protein CSB 96.96
KOG1803 649 consensus DNA helicase [Replication, recombination 96.92
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.92
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 96.91
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.9
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.87
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.86
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.73
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.7
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 96.57
PRK14974336 cell division protein FtsY; Provisional 96.52
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.47
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.4
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.38
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.33
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.27
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.24
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.21
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 96.18
PRK10536262 hypothetical protein; Provisional 96.14
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 96.08
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.06
PRK10416318 signal recognition particle-docking protein FtsY; 96.06
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 96.03
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 96.01
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.98
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 95.94
KOG2146354 consensus Splicing coactivator SRm160/300, subunit 95.81
TIGR00064272 ftsY signal recognition particle-docking protein F 95.79
COG4889 1518 Predicted helicase [General function prediction on 95.65
PF05729166 NACHT: NACHT domain 95.58
PRK11054 684 helD DNA helicase IV; Provisional 95.51
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.47
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 95.46
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.42
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 95.41
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 95.39
PRK10875 615 recD exonuclease V subunit alpha; Provisional 95.34
PRK13833323 conjugal transfer protein TrbB; Provisional 95.33
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.3
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.24
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 95.18
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.1
KOG2340698 consensus Uncharacterized conserved protein [Funct 95.1
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.1
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.0
COG3973 747 Superfamily I DNA and RNA helicases [General funct 95.0
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 94.94
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.84
TIGR00959428 ffh signal recognition particle protein. This mode 94.84
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.51
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.45
PRK13851344 type IV secretion system protein VirB11; Provision 94.45
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.43
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 94.42
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.41
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 94.38
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.35
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 94.35
PRK00771437 signal recognition particle protein Srp54; Provisi 94.31
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 94.31
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.25
PRK13826 1102 Dtr system oriT relaxase; Provisional 94.23
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 94.14
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.88
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.7
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.65
PRK10867433 signal recognition particle protein; Provisional 93.58
smart00382148 AAA ATPases associated with a variety of cellular 93.58
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.54
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.51
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.47
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.35
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.34
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.11
PF12846304 AAA_10: AAA-like domain 93.1
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.06
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.95
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.52
PRK05580 679 primosome assembly protein PriA; Validated 92.39
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.36
PF1355562 AAA_29: P-loop containing region of AAA domain 92.31
PRK04296190 thymidine kinase; Provisional 92.01
KOG0347 731 consensus RNA helicase [RNA processing and modific 91.95
PRK10436462 hypothetical protein; Provisional 91.94
KOG2253668 consensus U1 snRNP complex, subunit SNU71 and rela 91.75
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 91.65
PRK06526254 transposase; Provisional 91.61
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 91.51
PRK15483 986 type III restriction-modification system StyLTI en 91.45
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 91.34
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.34
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 91.2
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 91.19
cd01124187 KaiC KaiC is a circadian clock protein primarily f 91.01
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 90.97
TIGR00595 505 priA primosomal protein N'. All proteins in this f 90.97
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 90.91
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 90.91
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 90.86
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 90.85
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 90.82
KOG1805 1100 consensus DNA replication helicase [Replication, r 90.64
cd03115173 SRP The signal recognition particle (SRP) mediates 90.44
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 90.41
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 90.34
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 90.29
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 90.2
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 90.14
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 90.11
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 89.98
PRK05973237 replicative DNA helicase; Provisional 89.95
PRK13764602 ATPase; Provisional 89.92
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 89.91
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 89.89
COG1126240 GlnQ ABC-type polar amino acid transport system, A 89.87
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 89.82
COG1136226 SalX ABC-type antimicrobial peptide transport syst 89.55
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 89.48
TIGR02533486 type_II_gspE general secretory pathway protein E. 89.45
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 89.41
PF13173128 AAA_14: AAA domain 89.29
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 89.17
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 89.12
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 89.11
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 89.0
PRK08181269 transposase; Validated 88.95
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 88.94
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 88.93
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 88.92
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 88.88
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 88.85
PRK09183259 transposase/IS protein; Provisional 88.85
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 88.71
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 88.61
cd01394218 radB RadB. The archaeal protein radB shares simila 88.49
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 88.34
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 88.24
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 88.24
PRK00300205 gmk guanylate kinase; Provisional 88.16
PF00005137 ABC_tran: ABC transporter This structure is on hol 88.16
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 88.02
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 87.92
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 87.76
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 87.7
COG0610 962 Type I site-specific restriction-modification syst 87.7
PHA02244383 ATPase-like protein 87.62
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 87.56
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 87.56
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 87.54
TIGR02237209 recomb_radB DNA repair and recombination protein R 87.52
PRK08533230 flagellar accessory protein FlaH; Reviewed 87.46
PF00004132 AAA: ATPase family associated with various cellula 87.44
PRK14530215 adenylate kinase; Provisional 87.36
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 87.31
PRK13897 606 type IV secretion system component VirD4; Provisio 87.19
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 87.18
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 87.02
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 86.99
PHA03311 828 helicase-primase subunit BBLF4; Provisional 86.95
PRK13850 670 type IV secretion system protein VirD4; Provisiona 86.95
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 86.86
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 86.84
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 86.8
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 86.73
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 86.65
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 86.61
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 86.59
PRK06067234 flagellar accessory protein FlaH; Validated 86.56
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 86.53
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 86.51
PRK08233182 hypothetical protein; Provisional 86.51
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 86.5
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 86.45
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 86.44
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 86.36
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 86.34
PRK14873 665 primosome assembly protein PriA; Provisional 86.32
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 86.32
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 86.3
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 86.29
PRK14701 1638 reverse gyrase; Provisional 86.27
PRK13880 636 conjugal transfer coupling protein TraG; Provision 86.24
PRK10689 1147 transcription-repair coupling factor; Provisional 86.11
CHL00181287 cbbX CbbX; Provisional 86.07
PRK13822 641 conjugal transfer coupling protein TraG; Provision 85.81
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 85.81
PRK12402337 replication factor C small subunit 2; Reviewed 85.75
PF09439181 SRPRB: Signal recognition particle receptor beta s 85.71
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 85.59
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 85.47
COG4525259 TauB ABC-type taurine transport system, ATPase com 85.43
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 85.26
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 85.04
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 84.96
KOG0780483 consensus Signal recognition particle, subunit Srp 84.95
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 84.9
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 84.88
PLN02165334 adenylate isopentenyltransferase 84.88
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 84.8
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 84.8
PRK09361225 radB DNA repair and recombination protein RadB; Pr 84.76
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 84.76
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 84.76
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 84.72
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 84.72
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 84.61
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 84.59
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 84.58
PRK14531183 adenylate kinase; Provisional 84.54
PRK04328249 hypothetical protein; Provisional 84.52
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 84.48
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 84.46
PRK11331459 5-methylcytosine-specific restriction enzyme subun 84.38
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 84.38
TIGR02012321 tigrfam_recA protein RecA. This model describes or 84.37
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 84.36
PRK07261171 topology modulation protein; Provisional 84.32
PRK06921266 hypothetical protein; Provisional 84.32
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 84.3
PRK14527191 adenylate kinase; Provisional 84.3
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 84.29
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 84.18
cd03269210 ABC_putative_ATPase This subfamily is involved in 84.17
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 84.11
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 84.1
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 84.1
PRK11823446 DNA repair protein RadA; Provisional 84.09
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 84.07
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 84.04
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 84.03
PRK06835329 DNA replication protein DnaC; Validated 84.01
TIGR00235207 udk uridine kinase. Model contains a number of lon 83.97
PLN02840 421 tRNA dimethylallyltransferase 83.84
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 83.81
PRK05541176 adenylylsulfate kinase; Provisional 83.79
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 83.79
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 83.69
PRK01184184 hypothetical protein; Provisional 83.67
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 83.62
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 83.45
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 83.4
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 83.32
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 83.25
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 83.23
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 83.15
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 83.14
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 83.1
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 83.09
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 83.01
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 82.99
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 82.97
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 82.97
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 82.96
COG1484254 DnaC DNA replication protein [DNA replication, rec 82.96
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 82.91
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 82.88
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 82.88
TIGR02236310 recomb_radA DNA repair and recombination protein R 82.87
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 82.86
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 82.83
PRK10646153 ADP-binding protein; Provisional 82.82
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 82.79
cd03246173 ABCC_Protease_Secretion This family represents the 82.77
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 82.71
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 82.71
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 82.68
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 82.68
PRK08084235 DNA replication initiation factor; Provisional 82.67
PRK14242253 phosphate transporter ATP-binding protein; Provisi 82.64
PRK08118167 topology modulation protein; Reviewed 82.62
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 82.61
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 82.59
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 82.59
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 82.58
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 82.57
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 82.52
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 82.51
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 82.5
PRK10908222 cell division protein FtsE; Provisional 82.5
PRK09354349 recA recombinase A; Provisional 82.45
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 82.44
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 82.4
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 82.35
PRK08903227 DnaA regulatory inactivator Hda; Validated 82.32
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 82.26
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 82.25
cd01393226 recA_like RecA is a bacterial enzyme which has rol 82.24
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 82.17
PRK14532188 adenylate kinase; Provisional 82.07
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 82.05
PRK05480209 uridine/cytidine kinase; Provisional 82.05
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 82.05
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 82.04
PRK06762166 hypothetical protein; Provisional 82.04
PRK08356195 hypothetical protein; Provisional 82.0
PHA03333 752 putative ATPase subunit of terminase; Provisional 81.98
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 81.94
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 81.93
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 81.92
PHA02533 534 17 large terminase protein; Provisional 81.9
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 81.86
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 81.82
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 81.82
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 81.78
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 81.77
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 81.69
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 81.68
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 81.65
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 81.57
cd00983325 recA RecA is a bacterial enzyme which has roles in 81.57
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 81.51
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 81.51
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 81.49
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 81.47
PRK13700 732 conjugal transfer protein TraD; Provisional 81.46
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 81.45
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 81.42
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 81.4
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 81.39
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 81.37
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 81.34
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 81.31
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 81.26
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 81.19
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 81.19
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 81.17
PRK08727233 hypothetical protein; Validated 81.14
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 81.14
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 81.13
COG0802149 Predicted ATPase or kinase [General function predi 81.1
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 81.08
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 80.95
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 80.9
cd03216163 ABC_Carb_Monos_I This family represents the domain 80.9
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 80.86
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 80.84
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 80.78
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 80.7
cd03215182 ABC_Carb_Monos_II This family represents domain II 80.67
PRK14528186 adenylate kinase; Provisional 80.66
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1e-125  Score=1022.28  Aligned_cols=484  Identities=63%  Similarity=0.965  Sum_probs=458.4

Q ss_pred             HHHHhhchHhHHHHHHHHHHhhHHhhcccCCCCCCchhHHHHHHhhcccc--ChhHHHHHHHhhhhhHHHHHHHHHHHhh
Q 035699          145 EEERLRDQRGKEELERRIRERDVAATRKLTGPKLTWKEEYDAIQRSRKDD--GIENLREVSRQKYLPKRAQKKLEEIKDR  222 (633)
Q Consensus       145 e~~r~~d~~er~~~~~rl~~~d~~~t~~~~~~~~~~~~~~~~~~r~~~~~--~~~~lr~~sr~~yl~kr~~~kl~~l~~~  222 (633)
                      |.+|..|++||++|++||++||+++|||++|+   |+.++++.+|+ +++  ++..||+.|||+||+||+++|+++|+++
T Consensus        39 e~~~~~d~~eR~e~e~~l~~kdk~rtr~~~e~---k~~~ee~~~r~-~~~~ed~~~lR~~Sr~eyl~~r~~~k~e~L~~~  114 (902)
T KOG0923|consen   39 EEERQNDLKERDELEERLEKKDKDRTRNVVER---KKSYEEAAKRK-ALEPEDRTKLRKKSRREYLKKREQKKLEELEAE  114 (902)
T ss_pred             HHHHhhhHHHHHHHHHHHHHhhHHhhhhcccc---hhhHHHHHHhh-ccCcchhhHHhhhhhhhhhhhHHHHHHHHHHhh
Confidence            67888899999999999999999999999996   56788888886 444  6889999999999999999999999999


Q ss_pred             HhHHhhhhcCCcCcHHHHhhHHHHHHHHHHHhhhh-----------------------hccC---------CC-----cc
Q 035699          223 TKDKENLFEGQKLTGAELCELDYEKKILDLVGQEG-----------------------LQRC---------SH-----ES  265 (633)
Q Consensus       223 i~~~e~~~~~~~lt~~e~~~~~~~~~~~~~~~~~~-----------------------~~~~---------~~-----~~  265 (633)
                      |.|+++||++++||++|++|++|||++|.+...+.                       .+||         +|     .|
T Consensus       115 i~D~~~lf~~eklt~~e~~ele~kkell~~~~~~~~~~~~~~e~~~~y~~~~~~d~~~~~ry~d~~~~e~~~p~~eq~~W  194 (902)
T KOG0923|consen  115 IEDEEYLFGDEKLTKREIRELEYKKELLDRGTKETESASEVEEYRSRYDQPGELDKVEPQRYVDLDEEEKVNPGAEQRAW  194 (902)
T ss_pred             hcchhhhcccchhhhhhHhhhhhHHhhhhhhhhhhhcccchHHHHhhhcccccchhhhhHHHhcccchhccChHHHHHHH
Confidence            99999999999999999999999999999765432                       2344         11     25


Q ss_pred             HHHHHHhhhhccCCcccccccccccchhcccccccceeecccCCCCh-------hHHHHHHHHHHHHHccCCChHHHHHH
Q 035699          266 DKQQRKKADLKYGSKNKKQQYDDYQYVFEIEDKIVDFFRESVELPDK-------SAVKSALEMLQEERKTLPIYPFREEL  338 (633)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~-------~~~~~~~~~l~~~r~~LPi~~~q~~i  338 (633)
                      |++|+++|.++||+++..+.+++|+||||+. ++|+|+.++.+.++.       .....+..+|++.|++||+|+|++++
T Consensus       195 Ed~ql~~a~~~~ga~~~~~~~~~ye~vfdd~-~~idF~~e~~~~~~~e~~~~~~~~~~~~~~~iee~RksLPVy~ykdel  273 (902)
T KOG0923|consen  195 EDHQLGNAMLKFGAKDAKEGSDGYEFVFDDQ-IVIDFIQESKLAGSNEEDAKDAPTAYERRESIEEVRKSLPVYPYKDEL  273 (902)
T ss_pred             HHHHhhhhHhhcCCCcCcccccCceeeccch-hhhhHHHhhhccccCccccchhhHHHHHHHHHHHHHhcCCchhhHHHH
Confidence            9999999999999999988899999999996 679999998887764       22223688999999999999999999


Q ss_pred             HHHHHcCCeEEEeccCCChhhchHHHHHHHhccccCC-eeeecchhHHHHHHHHHHHHHHhCCcccceEeeeeecccccC
Q 035699          339 LQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQG-KIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTS  417 (633)
Q Consensus       339 l~al~~~~~vIi~a~TGSGKTt~lp~~Lle~~~~~~g-kilitqPrR~aA~qva~rva~e~g~~vg~~VGy~ir~e~~~s  417 (633)
                      +.++..||++||+|+||||||||+||||+++||+++| +|+||||||++||+||.|||++||+++|++|||+|+|++|++
T Consensus       274 l~av~e~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~EMgvkLG~eVGYsIRFEdcTS  353 (902)
T KOG0923|consen  274 LKAVKEHQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAEEMGVKLGHEVGYSIRFEDCTS  353 (902)
T ss_pred             HHHHHhCcEEEEEcCCCCCccccccHHHHhcccccCCceEeecCcchHHHHHHHHHHHHHhCcccccccceEEEeccccC
Confidence            9999999999999999999999999999999999999 599999999999999999999999999999999999999999


Q ss_pred             CCCcEEEeCchHHHHHHhcCCCCCCceeee-------------------eecccCCCccEEEeecccCHHhHhhhhCCCC
Q 035699          418 DKTVLKYMTDGMLLREIVLEPSLESYSVLI-------------------DLINYRPDLKLLISSATLDAENFSDYFGSAP  478 (633)
Q Consensus       418 ~~t~Iiv~TpGrLL~~l~~~~~L~~~s~vI-------------------di~~~rpdlklil~SAT~~~~~~s~~f~~~p  478 (633)
                      ++|.|.|||+||||++|+++|+|++||+||                   ||+++||++|+|++|||+|+++|+.||+++|
T Consensus       354 ekTvlKYMTDGmLlREfL~epdLasYSViiiDEAHERTL~TDILfgLvKDIar~RpdLKllIsSAT~DAekFS~fFDdap  433 (902)
T KOG0923|consen  354 EKTVLKYMTDGMLLREFLSEPDLASYSVIIVDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATMDAEKFSAFFDDAP  433 (902)
T ss_pred             cceeeeeecchhHHHHHhccccccceeEEEeehhhhhhhhhhHHHHHHHHHHhhCCcceEEeeccccCHHHHHHhccCCc
Confidence            999999999999999999999999999999                   7889999999999999999999999999999


Q ss_pred             EEEeCCeeeeEEEEEEcCCchhHHHHHHHHHHHHHhcCCCCCEEEEcCcHHHHHHHHHHHHHhhcccCCCCCceEEEecc
Q 035699          479 IFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIY  558 (633)
Q Consensus       479 ii~i~gr~~pv~~~y~~~~~~~yl~~~v~~l~~i~~~~~~g~iLVFl~t~~eie~l~~~L~~~~~~l~~~~~~~~v~~lH  558 (633)
                      ||.+|||+|||+++|++.|++||+++++.++++||.+++.|+||||++|+++|+.+.+.|+++++.||+++.++.|||||
T Consensus       434 IF~iPGRRyPVdi~Yt~~PEAdYldAai~tVlqIH~tqp~GDILVFltGQeEIEt~~e~l~~~~~~LGski~eliv~PiY  513 (902)
T KOG0923|consen  434 IFRIPGRRYPVDIFYTKAPEADYLDAAIVTVLQIHLTQPLGDILVFLTGQEEIETVKENLKERCRRLGSKIRELIVLPIY  513 (902)
T ss_pred             EEeccCcccceeeecccCCchhHHHHHHhhheeeEeccCCccEEEEeccHHHHHHHHHHHHHHHHHhccccceEEEeecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHhCCCCCCCeeEEEeCCccccCCCCCCccEEEeCCCCccccccCCCCceeeeeeeccHHHHhhcC
Q 035699          559 GNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT  633 (633)
Q Consensus       559 g~l~~~~R~~i~~~f~~g~rkVLvATdIAerGLdIp~V~~VID~G~~k~~~yd~~~g~~~l~~~~iSka~a~QR~  633 (633)
                      +|||++.|++||+++|+|.||||+||||||+|||||||.||||+||+|+++|||+|||++|.++|||||+|+|||
T Consensus       514 aNLPselQakIFePtP~gaRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynprtGmesL~v~piSKAsA~QRa  588 (902)
T KOG0923|consen  514 ANLPSELQAKIFEPTPPGARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNPRTGMESLLVTPISKASANQRA  588 (902)
T ss_pred             ccCChHHHHhhcCCCCCCceeEEEeecchhhceeecCeEEEecCccccccCcCCCcCceeEEEeeechhhhhhhc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999996

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00311 PWI PWI, domain in splicing factors Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF01480 PWI: PWI domain; InterPro: IPR002483 The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing [] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG2146 consensus Splicing coactivator SRm160/300, subunit SRm160 (contains PWI domain) [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-81
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-81
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 1e-16
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  300 bits (769), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/340 (48%), Positives = 211/340 (62%), Gaps = 36/340 (10%)
Query: 326 RKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLY--EAGYTKQGKIGCTQLX 383
           R+ LP++  R+E L+      ++V VGETGSGKTTQIPQ++   E  + +  ++ CTQ  
Sbjct: 90  RRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPR 149
Query: 384 XXXXXXXXXXXXQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESY 443
                       +EM VKLG EVGYSIRFE+ TS+KT+LKYMTDGMLLRE + +  L  Y
Sbjct: 150 RVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRY 209
Query: 444 SVLI-------------------DLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPR 484
           S +I                    ++  RPDLK++I SATLDAE F  YF  AP+  +P 
Sbjct: 210 SCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPG 269
Query: 485 RRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQ---- 540
           R Y VEL+YT   + DY+++AI T LQIH  E  GDIL+FLTG+D+ E A   +      
Sbjct: 270 RTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQ 329
Query: 541 --RTRGLGTKIAELIICPIYGNLPTELQAKIFEPTPEG-----ARKVVLATNIAETSLTI 593
             R  G G     L + P+YG+LP   Q +IFEP PE       RKVV++TNIAETSLTI
Sbjct: 330 LVREEGCGP----LSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTI 385
Query: 594 DGIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT 633
           DGI YV+DPGF+K K YNP+  +ESLLV+PISKASA QR 
Sbjct: 386 DGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRA 425
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 0.0
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-86
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-80
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-78
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 3e-73
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 9e-71
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-69
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-68
1yks_A 440 Genome polyprotein [contains: flavivirin protease 1e-62
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  545 bits (1406), Expect = 0.0
 Identities = 179/399 (44%), Positives = 239/399 (59%), Gaps = 35/399 (8%)

Query: 263 HESDKQQRKKADLKYGSKNKKQQYDDYQYVFEIEDKIVDFFRESVELPDKSAVKSALEML 322
           H    ++          K  ++ +   +   ++ED  ++ F                  +
Sbjct: 34  HPLPSEEPLVHHDAGEFKGLQRHHTSAEEAQKLEDGKINPF-------TGREFTPKYVDI 86

Query: 323 QEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLY--EAGYTKQGKIGCT 380
            + R+ LP++  R+E L+      ++V VGETGSGKTTQIPQ++   E  + +  ++ CT
Sbjct: 87  LKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACT 146

Query: 381 QLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSL 440
           Q RRVAAMSVA RV++EM VKLG EVGYSIRFE+ TS+KT+LKYMTDGMLLRE + +  L
Sbjct: 147 QPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDL 206

Query: 441 ESYSVLI-------------------DLINYRPDLKLLISSATLDAENFSDYFGSAPIFK 481
             YS +I                    ++  RPDLK++I SATLDAE F  YF  AP+  
Sbjct: 207 SRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLA 266

Query: 482 IPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQR 541
           +P R Y VEL+YT   + DY+++AI T LQIH  E  GDIL+FLTG+D+ E A   +   
Sbjct: 267 VPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLE 326

Query: 542 TRGLGTK--IAELIICPIYGNLPTELQAKIFEPTPEG-----ARKVVLATNIAETSLTID 594
              L  +     L + P+YG+LP   Q +IFEP PE       RKVV++TNIAETSLTID
Sbjct: 327 GDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTID 386

Query: 595 GIKYVIDPGFAKVKSYNPKTGMESLLVNPISKASANQRT 633
           GI YV+DPGF+K K YNP+  +ESLLV+PISKASA QR 
Sbjct: 387 GIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRA 425
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query633
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.98
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.98
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.97
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.97
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.97
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.97
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.97
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.97
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.96
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.96
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.96
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.96
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.96
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.96
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.96
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.95
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.95
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.95
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.95
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.94
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.94
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.94
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.94
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.93
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.93
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.93
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.92
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.92
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.92
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.92
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.9
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.89
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.89
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.89
3h1t_A590 Type I site-specific restriction-modification syst 99.86
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.76
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.74
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.72
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.71
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.7
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.7
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.7
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.7
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.69
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.69
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.69
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.69
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.68
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.68
3bor_A237 Human initiation factor 4A-II; translation initiat 99.68
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.67
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.65
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.65
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.64
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.63
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.6
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.58
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.56
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.54
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.54
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.53
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.52
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.5
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.48
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.47
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.46
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.42
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.42
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.1
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.38
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.33
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.19
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.15
1x4q_A92 U4/U6 small nuclear ribonucleoprotein PRP3; PWI do 98.91
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.79
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.63
3v53_A119 RNA-binding protein 25; PWI, RNA-binding domain; 2 97.46
1mp1_A111 Ser/Arg-related nuclear matrix protein; four helix 97.27
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.27
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.87
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.81
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.65
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.58
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.36
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.17
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.1
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.96
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.3
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.23
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 94.72
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.69
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.43
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 93.28
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 93.08
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.04
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.5
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.34
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 91.8
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 91.62
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.42
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.32
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.3
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.24
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.17
3co5_A143 Putative two-component system transcriptional RES 91.11
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.89
2oap_1511 GSPE-2, type II secretion system protein; hexameri 90.81
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.77
1p9r_A418 General secretion pathway protein E; bacterial typ 90.72
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.7
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 90.7
1vma_A306 Cell division protein FTSY; TM0570, structural gen 90.63
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 90.57
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.56
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 90.52
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 90.33
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 90.32
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 90.19
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.16
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.15
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 89.95
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 89.82
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.71
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 89.48
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 89.47
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 89.39
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.34
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.23
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 89.19
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 89.17
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 89.17
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 88.88
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 88.83
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 88.69
2og2_A359 Putative signal recognition particle receptor; nuc 88.61
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 88.45
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.4
2qgz_A308 Helicase loader, putative primosome component; str 88.24
3vaa_A199 Shikimate kinase, SK; structural genomics, center 88.14
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.07
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 87.99
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 87.95
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 87.94
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 87.94
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 87.81
2chg_A226 Replication factor C small subunit; DNA-binding pr 87.78
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 87.78
3bos_A242 Putative DNA replication factor; P-loop containing 87.68
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 87.52
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 87.26
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.15
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 87.14
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 87.09
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 87.08
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 86.96
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 86.87
1kag_A173 SKI, shikimate kinase I; transferase, structural g 86.82
2kjq_A149 DNAA-related protein; solution structure, NESG, st 86.77
4a74_A231 DNA repair and recombination protein RADA; hydrola 86.66
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 86.46
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 86.36
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 86.26
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 86.09
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 85.96
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 85.92
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 85.79
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 85.71
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 85.65
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 85.65
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 85.62
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 85.61
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 85.49
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 85.38
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.34
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 85.33
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 85.31
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 85.27
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 85.27
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 85.22
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 85.19
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 85.19
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 85.08
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 85.03
2r44_A331 Uncharacterized protein; putative ATPase, structur 84.98
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.95
1g6h_A257 High-affinity branched-chain amino acid transport 84.77
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.72
1ji0_A240 ABC transporter; ATP binding protein, structural g 84.6
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 84.58
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 84.54
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 84.51
1b0u_A262 Histidine permease; ABC transporter, transport pro 84.5
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 84.49
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 84.44
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 84.42
2ghi_A260 Transport protein; multidrug resistance protein, M 84.35
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 84.23
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 84.19
2r6a_A454 DNAB helicase, replicative helicase; replication, 84.12
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 84.05
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 83.99
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 83.94
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 83.88
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 83.82
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 83.82
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 83.72
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 83.65
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 83.64
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 83.6
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 83.55
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 83.54
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 83.49
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 83.41
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 83.41
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 83.31
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 83.28
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 83.19
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 83.16
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 83.14
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 83.14
2z43_A324 DNA repair and recombination protein RADA; archaea 83.1
3kta_A182 Chromosome segregation protein SMC; structural mai 83.1
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 83.03
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 83.03
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 83.02
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 82.95
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 82.93
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 82.8
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 82.77
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 82.76
1ojl_A304 Transcriptional regulatory protein ZRAR; response 82.74
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 82.74
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 82.7
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 82.64
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 82.63
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 82.6
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 82.56
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 82.56
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 82.53
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 82.49
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 82.48
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 82.45
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 82.35
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 82.33
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 82.28
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 82.26
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 82.22
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 82.22
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 82.22
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 82.2
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 82.11
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 82.04
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 81.94
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 81.91
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 81.82
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 81.71
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 81.7
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 81.69
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 81.67
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 81.38
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 81.33
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 81.29
2xxa_A433 Signal recognition particle protein; protein trans 81.25
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 81.23
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 81.2
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 81.14
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 81.13
3bor_A237 Human initiation factor 4A-II; translation initiat 81.03
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 80.99
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 80.93
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 80.93
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 80.91
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 80.89
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 80.86
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 80.82
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 80.78
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 80.78
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 80.74
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 80.71
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 80.65
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 80.62
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 80.62
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 80.61
2v1u_A387 Cell division control protein 6 homolog; DNA repli 80.54
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 80.51
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 80.5
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 80.43
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 80.39
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 80.37
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 80.33
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 80.31
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 80.25
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 80.24
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 80.09
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 80.05
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 80.01
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=4.3e-50  Score=468.73  Aligned_cols=316  Identities=55%  Similarity=0.851  Sum_probs=287.9

Q ss_pred             HHHHHHHHHccCCChHHHHHHHHHHHcCCeEEEeccCCChhhchHHHHHHHhcccc--CCeeeecchhHHHHHHHHHHHH
Q 035699          318 ALEMLQEERKTLPIYPFREELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTK--QGKIGCTQLRRVAAMSVAARVS  395 (633)
Q Consensus       318 ~~~~l~~~r~~LPi~~~q~~il~al~~~~~vIi~a~TGSGKTt~lp~~Lle~~~~~--~gkilitqPrR~aA~qva~rva  395 (633)
                      .+..+.+.|..+|++.++..|+.++.++++++|+|||||||||++|++++...+..  +++++|++|||++|.+++.+++
T Consensus        82 ~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~  161 (773)
T 2xau_A           82 KYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVA  161 (773)
T ss_dssp             HHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHH
T ss_pred             HHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHH
Confidence            34555666789999999999999999999999999999999999999988766554  3479999999999999999999


Q ss_pred             HHhCCcccceEeeeeecccccCCCCcEEEeCchHHHHHHhcCCCCCCceeee-eecc------------------cCCCc
Q 035699          396 QEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSVLI-DLIN------------------YRPDL  456 (633)
Q Consensus       396 ~e~g~~vg~~VGy~ir~e~~~s~~t~Iiv~TpGrLL~~l~~~~~L~~~s~vI-di~~------------------~rpdl  456 (633)
                      ..+|..+|..+||.+++++.....++|+|+|||+|++++..++.+.++++|| |.++                  .++++
T Consensus       162 ~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~~~  241 (773)
T 2xau_A          162 EEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDL  241 (773)
T ss_dssp             HHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCTTC
T ss_pred             HHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhCCCc
Confidence            9999999999999999998888899999999999999999999999999999 4443                  35788


Q ss_pred             cEEEeecccCHHhHhhhhCCCCEEEeCCeeeeEEEEEEcCCchhHHHHHHHHHHHHHhcCCCCCEEEEcCcHHHHHHHHH
Q 035699          457 KLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEE  536 (633)
Q Consensus       457 klil~SAT~~~~~~s~~f~~~pii~i~gr~~pv~~~y~~~~~~~yl~~~v~~l~~i~~~~~~g~iLVFl~t~~eie~l~~  536 (633)
                      ++|+||||++.+.|..||+++|++.++|+.+||+++|.+.+..+|+...+..+++++...++|++||||||+.+|+.+++
T Consensus       242 ~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~  321 (773)
T 2xau_A          242 KIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVR  321 (773)
T ss_dssp             EEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHH
T ss_pred             eEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999889999999888788999999999999999999


Q ss_pred             HHHHhhccc--CCCCCceEEEeccCCCCHHHHHHHhCCCC-----CCCeeEEEeCCccccCCCCCCccEEEeCCCCcccc
Q 035699          537 ILKQRTRGL--GTKIAELIICPIYGNLPTELQAKIFEPTP-----EGARKVVLATNIAETSLTIDGIKYVIDPGFAKVKS  609 (633)
Q Consensus       537 ~L~~~~~~l--~~~~~~~~v~~lHg~l~~~~R~~i~~~f~-----~g~rkVLvATdIAerGLdIp~V~~VID~G~~k~~~  609 (633)
                      .|...+..+  .....++.+.++||+|++.+|..+++.|+     .|.++|||||||||+|||||+|++|||+|+++.+.
T Consensus       322 ~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~  401 (773)
T 2xau_A          322 KISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKV  401 (773)
T ss_dssp             HHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEE
T ss_pred             HHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCcccee
Confidence            998643222  11224789999999999999999999999     99999999999999999999999999999999999


Q ss_pred             ccCCCCceeeeeeeccHHHHhhcC
Q 035699          610 YNPKTGMESLLVNPISKASANQRT  633 (633)
Q Consensus       610 yd~~~g~~~l~~~~iSka~a~QR~  633 (633)
                      |||++|++.|.++|+|++++.||+
T Consensus       402 yd~~~g~~~L~~~p~S~~s~~QR~  425 (773)
T 2xau_A          402 YNPRIRVESLLVSPISKASAQQRA  425 (773)
T ss_dssp             EETTTTEEEEEEEECCHHHHHHHH
T ss_pred             eccccCccccccccCCHHHHHhhc
Confidence            999999999999999999999984
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1x4q_A U4/U6 small nuclear ribonucleoprotein PRP3; PWI domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3v53_A RNA-binding protein 25; PWI, RNA-binding domain; 2.90A {Homo sapiens} Back     alignment and structure
>1mp1_A Ser/Arg-related nuclear matrix protein; four helix bundle, RNA binding protein; NMR {Homo sapiens} SCOP: a.188.1.1 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 633
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-28
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 3e-17
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-16
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 5e-07
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.001
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

 Score =  114 bits (285), Expect = 1e-28
 Identities = 34/319 (10%), Positives = 84/319 (26%), Gaps = 59/319 (18%)

Query: 335 REELLQAVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARV 394
            +++ +   +  + ++    G+GKT +    +      +  +       RV A  +   +
Sbjct: 2   EDDIFR---KKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEAL 58

Query: 395 SQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLREIVLEPSLESYSV--------- 445
                         +       + + ++  M        ++    + +Y++         
Sbjct: 59  RGLPIRY------QTPAIRAEHTGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFT 112

Query: 446 ---------LIDLINYRPDLKLLISSATLDAENFSDYFGSAPIFKIPRRRYHVELFYTKA 496
                     I       +   +  +AT                  P+    +     + 
Sbjct: 113 DPASIAARGYISTRVEMGEAAGIFMTATPP----------GSRDPFPQSNAPIMDEEREI 162

Query: 497 PEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICP 556
           PE  +            V +  G  + F+            L++             +  
Sbjct: 163 PERSWNSG------HEWVTDFKGKTVWFVPSIKAGNDIAACLRKN---------GKKVIQ 207

Query: 557 IYGNLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAK--VKSYNPKT 614
           +          K            V+ T+I+E        + VIDP      V   + + 
Sbjct: 208 LSRKTFDSEYIKTRTND----WDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEE 262

Query: 615 GMESLLVNPISKASANQRT 633
            +      P++ +SA QR 
Sbjct: 263 RVILAGPMPVTHSSAAQRR 281
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query633
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.96
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.78
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.76
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.76
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.75
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.73
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.7
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.7
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.69
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.66
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.66
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.64
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.62
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.62
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.62
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.61
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.59
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.57
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.56
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.56
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.55
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.51
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.44
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.42
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.4
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.36
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.29
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.16
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.15
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.07
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.97
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.93
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.9
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.9
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.87
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.82
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.79
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.67
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.72
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.61
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.58
d1okkd2207 GTPase domain of the signal recognition particle r 97.56
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.38
d2qy9a2211 GTPase domain of the signal recognition particle r 97.37
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.16
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.06
d1mp1a_111 Ser/Arg-related nuclear matrix protein srm160 {Hum 96.91
d1vmaa2213 GTPase domain of the signal recognition particle r 96.72
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.71
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.65
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.52
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.51
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 96.5
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.37
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.75
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.03
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 93.92
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 93.89
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.3
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.12
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.09
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.78
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 92.77
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.61
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.23
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.18
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.98
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.96
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.75
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.68
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 91.68
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.58
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.31
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.18
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.12
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.03
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.65
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 90.59
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 90.5
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 90.46
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 90.45
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.34
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 90.16
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.11
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 90.02
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 89.88
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 89.82
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.76
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.56
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.54
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 89.54
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.45
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.23
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.93
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.84
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 88.79
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 88.73
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 88.59
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.5
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 88.34
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 88.17
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.14
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.0
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.98
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.88
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.8
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.73
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.55
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 87.47
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 87.32
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.32
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 87.23
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.03
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.02
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 86.78
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 86.74
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 86.52
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 85.84
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 85.78
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 85.78
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 85.66
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 85.43
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 85.26
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 85.11
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.82
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.73
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 84.38
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 84.23
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 84.21
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.11
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 83.99
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 83.88
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 83.77
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 83.74
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 83.57
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 83.56
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 83.51
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 83.29
d1g2912240 Maltose transport protein MalK, N-terminal domain 83.28
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 83.15
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 83.03
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 82.97
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 82.66
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 82.41
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 82.27
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 81.81
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 81.76
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 81.68
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 81.58
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 81.58
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 81.35
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 81.32
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 81.12
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 81.02
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.96  E-value=8.3e-30  Score=260.81  Aligned_cols=257  Identities=14%  Similarity=0.129  Sum_probs=187.0

Q ss_pred             HHHcCCeEEEeccCCChhhchHHHHHHHhccccCCeeeecchhHHHHHHHHHHHHHHhCCcccceEeeeeecccccCCCC
Q 035699          341 AVSEYPVLVIVGETGSGKTTQIPQYLYEAGYTKQGKIGCTQLRRVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSDKT  420 (633)
Q Consensus       341 al~~~~~vIi~a~TGSGKTt~lp~~Lle~~~~~~gkilitqPrR~aA~qva~rva~e~g~~vg~~VGy~ir~e~~~s~~t  420 (633)
                      ++..+++++|.||||||||++++.+++.....++.+++|+.|||+||.|+++++... +...   .+  .......+..+
T Consensus         5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q~~~~l~~~-~~~~---~~--~~~~~~~~~~~   78 (305)
T d2bmfa2           5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGL-PIRY---QT--PAIRAEHTGRE   78 (305)
T ss_dssp             SSSTTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHHHHHHTTTS-CCBC---CC----------CCC
T ss_pred             HhhcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHHHHHHHhcC-Ccce---ee--eEEeecccCcc
Confidence            456889999999999999998776766554555668999999999999998876432 1111   11  11223345678


Q ss_pred             cEEEeCchHHHHHHhcCCCCCCceeee-eeccc-----------------CCCccEEEeecccCHHhHhhhhCCCCEEEe
Q 035699          421 VLKYMTDGMLLREIVLEPSLESYSVLI-DLINY-----------------RPDLKLLISSATLDAENFSDYFGSAPIFKI  482 (633)
Q Consensus       421 ~Iiv~TpGrLL~~l~~~~~L~~~s~vI-di~~~-----------------rpdlklil~SAT~~~~~~s~~f~~~pii~i  482 (633)
                      .|+++|||+|..++.....+.+++++| |.+|.                 +++++++++|||++...........|+.. 
T Consensus        79 ~i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~~~~~~~v~~SAT~~~~~~~~~~~~~~~~~-  157 (305)
T d2bmfa2          79 IVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMD-  157 (305)
T ss_dssp             SEEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHHHTSCEEEEECSSCTTCCCSSCCCSSCEEE-
T ss_pred             ccccCCcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhhccccceEEEeecCCCcceeeecccCCcceE-
Confidence            899999999999888777889999988 55543                 35689999999985432222222233322 


Q ss_pred             CCeeeeEEEEEEcCCchhHHHHHHHHHHHHHhcCCCCCEEEEcCcHHHHHHHHHHHHHhhcccCCCCCceEEEeccCCCC
Q 035699          483 PRRRYHVELFYTKAPEADYIEAAIVTALQIHVNEPIGDILVFLTGQDQFETAEEILKQRTRGLGTKIAELIICPIYGNLP  562 (633)
Q Consensus       483 ~gr~~pv~~~y~~~~~~~yl~~~v~~l~~i~~~~~~g~iLVFl~t~~eie~l~~~L~~~~~~l~~~~~~~~v~~lHg~l~  562 (633)
                               .....+......     ... ......+++||||+++++++.++..|.+.         ++.+.++||+++
T Consensus       158 ---------~~~~~~~~~~~~-----~~~-~~~~~~~~~lvf~~~~~~~~~l~~~L~~~---------~~~~~~l~~~~~  213 (305)
T d2bmfa2         158 ---------EEREIPERSWNS-----GHE-WVTDFKGKTVWFVPSIKAGNDIAACLRKN---------GKKVIQLSRKTF  213 (305)
T ss_dssp             ---------EECCCCCSCCSS-----CCH-HHHSSCSCEEEECSCHHHHHHHHHHHHHH---------TCCCEECCTTCH
T ss_pred             ---------EEEeccHHHHHH-----HHH-HHHhhCCCEEEEeccHHHHHHHHHHHHhC---------CCCEEEeCCcCh
Confidence                     221111111000     000 11234689999999999999999999885         677899999997


Q ss_pred             HHHHHHHhCCCCCCCeeEEEeCCccccCCCCCCccEEEeCCCCccc--cccCCCCceeeeeeeccHHHHhhcC
Q 035699          563 TELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFAKVK--SYNPKTGMESLLVNPISKASANQRT  633 (633)
Q Consensus       563 ~~~R~~i~~~f~~g~rkVLvATdIAerGLdIp~V~~VID~G~~k~~--~yd~~~g~~~l~~~~iSka~a~QR~  633 (633)
                      +..+    ..|++|.++++|||+++++|+|+ ++++|||+|.....  .||+.+++..+...|+|.++..||+
T Consensus       214 ~~~~----~~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~  281 (305)
T d2bmfa2         214 DSEY----IKTRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRR  281 (305)
T ss_dssp             HHHG----GGGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHH
T ss_pred             HHHH----hhhhccchhhhhhhHHHHhcCCC-CccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhh
Confidence            7554    45678889999999999999999 59999999998764  4999999999999999999999984
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1mp1a_ a.188.1.1 (A:) Ser/Arg-related nuclear matrix protein srm160 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure