Citrus Sinensis ID: 035724
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1939 | 2.2.26 [Sep-21-2011] | |||||||
| O15050 | 2925 | TPR and ankyrin repeat-co | yes | no | 0.211 | 0.140 | 0.248 | 8e-21 | |
| Q8BV79 | 2999 | TPR and ankyrin repeat-co | yes | no | 0.211 | 0.136 | 0.242 | 2e-19 | |
| Q00416 | 2231 | Helicase SEN1 OS=Saccharo | yes | no | 0.086 | 0.074 | 0.356 | 2e-19 | |
| B6SFA4 | 818 | Probable helicase MAGATAM | no | no | 0.097 | 0.231 | 0.331 | 2e-18 | |
| Q9FJR0 | 1254 | Regulator of nonsense tra | no | no | 0.088 | 0.136 | 0.342 | 8e-17 | |
| Q9EPU0 | 1124 | Regulator of nonsense tra | no | no | 0.087 | 0.151 | 0.359 | 3e-16 | |
| Q92900 | 1129 | Regulator of nonsense tra | no | no | 0.087 | 0.150 | 0.359 | 3e-16 | |
| Q92355 | 1687 | Helicase sen1 OS=Schizosa | yes | no | 0.082 | 0.094 | 0.363 | 6e-16 | |
| O94387 | 1944 | Uncharacterized ATP-depen | no | no | 0.084 | 0.084 | 0.345 | 2e-15 | |
| Q9VYS3 | 1180 | Regulator of nonsense tra | yes | no | 0.084 | 0.138 | 0.333 | 5e-15 |
| >sp|O15050|TRNK1_HUMAN TPR and ankyrin repeat-containing protein 1 OS=Homo sapiens GN=TRANK1 PE=2 SV=4 | Back alignment and function desciption |
|---|
Score = 104 bits (259), Expect = 8e-21, Method: Compositional matrix adjust.
Identities = 118/475 (24%), Positives = 206/475 (43%), Gaps = 64/475 (13%)
Query: 891 ETSLIYGEPPILLESRNDENAIIKIFGNSGDAGGNMVGFGAEQVILVRDDCVRKEISNYV 950
++ L G P +LES + + I + GN + FGA QVILV ++ +++I +
Sbjct: 1499 DSGLFDGPKPTVLESCSVSDLAILLRGNKRKT--QPIEFGAHQVILVANETAKEKIPEEL 1556
Query: 951 GKQALVLTIVESKGLEFQ-VIHYT-----------------------SQCCNSPFKHALF 986
G ALVLTI E+KGLEF V+ Y S+ N P
Sbjct: 1557 G-LALVLTIYEAKGLEFDDVLLYNFFTDSEAYKEWKIISSFTPTSTDSREENRPLVEVPL 1615
Query: 987 D--STSPGSFPSFNEAKHNVLCSELKQLYVAITRTRQRLWIWENMEEFSKPMFDYWKKKS 1044
D +S G N + +L ELKQLY AITR R LWI++ E P F Y+ ++
Sbjct: 1616 DKPGSSQGRSLMVNPEMYKLLNGELKQLYTAITRARVNLWIFDENREKRAPAFKYFIRRD 1675
Query: 1045 LVQVRQLDDS--LAQAMQV-ASSPEEWKSRGIKLFHEHNYDMATICFEKAKDSYWEGRSK 1101
VQV + D++ +M V S+P EW ++G + +A C++K ++ + +
Sbjct: 1676 FVQVVKTDENKDFDDSMFVKTSTPAEWIAQGDYYAKHQCWKVAAKCYQKG-GAFEKEKLA 1734
Query: 1102 ATGLKATADRCRSSNPKQANVNLREAAKIFEAIGKADSAAKCFYNLGEYERAGRIYLERR 1161
A + + + +PK+ + E AK + + + KC E++ + ++ ER
Sbjct: 1735 LAHDTALSMKSKKVSPKEKQLEYLELAKTYLECKEPTLSLKCLSYAKEFQLSAQL-CERL 1793
Query: 1162 EEPELEKAGECFFLAGCYKLAADVYAKGKFFSECLAVCSKGKLFEIGLQYMNHWKQHADT 1221
++ A + + CYK A + + + F L + + +LFE + +++ T
Sbjct: 1794 --GKIRDAAYFYKRSQCYKDAFRCFEQIQEFDLALKMYCQEELFEEAAIAVEKYEEMLKT 1851
Query: 1222 DVEHAGTDVGLLVRSMEINKIEQEFLEKCAIHYYGLQDKKSMMKFVKSFRSVDLMRKFLK 1281
+++ I+K L A +Y ++ + S + M++ +
Sbjct: 1852 -------------KTLPISK-----LSYSASQFY--------LEAAAKYLSANKMKEMMA 1885
Query: 1282 SLSCFD--DLLVLEEESGNFMDAANIARLRGDIFLAVDLLQKAGCFKEACNVTLN 1334
LS D D LV + +AA++ G A L+++ GC EA +T +
Sbjct: 1886 VLSKLDIEDQLVFLKSRKRLAEAADLLNREGRREEAALLMKQHGCLLEAARLTAD 1940
|
Homo sapiens (taxid: 9606) |
| >sp|Q8BV79|TRNK1_MOUSE TPR and ankyrin repeat-containing protein 1 OS=Mus musculus GN=Trank1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1939 | ||||||
| 255555527 | 2820 | conserved hypothetical protein [Ricinus | 0.535 | 0.368 | 0.534 | 0.0 | |
| 359473525 | 2792 | PREDICTED: uncharacterized protein LOC10 | 0.537 | 0.373 | 0.518 | 0.0 | |
| 356510822 | 2812 | PREDICTED: uncharacterized protein LOC10 | 0.530 | 0.365 | 0.496 | 0.0 | |
| 359473527 | 2788 | PREDICTED: uncharacterized protein LOC10 | 0.524 | 0.364 | 0.493 | 0.0 | |
| 449445371 | 2710 | PREDICTED: uncharacterized protein LOC10 | 0.529 | 0.378 | 0.472 | 0.0 | |
| 297738288 | 2562 | unnamed protein product [Vitis vinifera] | 0.486 | 0.368 | 0.471 | 0.0 | |
| 449526710 | 2474 | PREDICTED: uncharacterized protein LOC10 | 0.507 | 0.398 | 0.48 | 0.0 | |
| 147865014 | 2676 | hypothetical protein VITISV_037587 [Viti | 0.499 | 0.361 | 0.471 | 0.0 | |
| 297738290 | 6100 | unnamed protein product [Vitis vinifera] | 0.487 | 0.155 | 0.470 | 0.0 | |
| 359473531 | 2818 | PREDICTED: uncharacterized protein LOC10 | 0.507 | 0.349 | 0.459 | 0.0 |
| >gi|255555527|ref|XP_002518800.1| conserved hypothetical protein [Ricinus communis] gi|223542181|gb|EEF43725.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1065 bits (2754), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 583/1091 (53%), Positives = 758/1091 (69%), Gaps = 53/1091 (4%)
Query: 876 YFERFHDIRKHHGQPETSLIYGEPPILLES-RNDENAIIKIFGNSGDAGGNMVGFGAEQV 934
+F F DI H ETS I+GE PILLES +DENAI+ IFGN+G+ GG+ VGFGAEQV
Sbjct: 1510 FFPTFVDILNH----ETSQIFGEAPILLESGDDDENAIVTIFGNNGNIGGSFVGFGAEQV 1565
Query: 935 ILVRDDCVRKEISNYVGKQALVLTIVESKGLEFQVIHYTSQCCNSPFKHA---------- 984
ILVRDD RKEI YVGKQALVLTIVE KGLEFQ + + +SP ++
Sbjct: 1566 ILVRDDSARKEICKYVGKQALVLTIVECKGLEFQDVLLYNFFGSSPLRNKWRVLYEYMKE 1625
Query: 985 --LFDSTSPGSFPSFNEAKHNVLCSELKQLYVAITRTRQRLWIWENMEEFSKPMFDYWKK 1042
L D++SP SFP+FN A+HNVLCSELKQLYVAITRTRQRLWI EN EF+KP+FDYW+K
Sbjct: 1626 QNLLDASSPQSFPTFNPARHNVLCSELKQLYVAITRTRQRLWICENAAEFAKPIFDYWRK 1685
Query: 1043 KSLVQVRQLDDSLAQAMQVASSPEEWKSRGIKLFHEHNYDMATICFEKAKDSYWEGRSKA 1102
K++VQVR+LD+SLA AMQVASSPEEWKS+G KL E NY+MAT+CFE+A D+Y E +KA
Sbjct: 1686 KAVVQVRKLDNSLALAMQVASSPEEWKSQGYKLLREANYEMATMCFERAGDAYGEKLAKA 1745
Query: 1103 TGLKATADRCRSSNPKQANVNLREAAKIFEAIGKADSAAKCFYNLGEYERAGRIYLERRE 1162
GLKA AD+ SNP A++ R+AA+IFE+IGKAD AA+CFY L EYERAGRIYL+ E
Sbjct: 1746 AGLKAAADKMHVSNPDTASIARRQAAEIFESIGKADYAAECFYMLNEYERAGRIYLQCGE 1805
Query: 1163 EPELEKAGECFFLAGCYKLAADVYAKGKFFSECLAVCSKGKLFEIGLQYMNHWKQHADTD 1222
+E+AGECF+LAGCY+ AA++YAKG FS+CL C++GKLF++GL+Y+ +WKQH
Sbjct: 1806 SA-IERAGECFYLAGCYECAAEIYAKGNHFSKCLLACTEGKLFDMGLKYIQYWKQHVK-- 1862
Query: 1223 VEHAGTDVGLLVRSMEINKIEQEFLEKCAIHYYGLQDKKSMMKFVKSFRSVDLMRKFLKS 1282
D ++ +S EI+ IEQEFLE+CA+HY+ L D ++MM++V++F S+ +R FLK
Sbjct: 1863 -----ADTCMVKKSREIDSIEQEFLERCALHYHKLNDNRAMMRYVRAFDSISSVRTFLKK 1917
Query: 1283 LSCFDDLLVLEEESGNFMDAANIARLRGDIFLAVDLLQKAGCFKEACNVTLNHVISNSLW 1342
L+C D+LL EEESGNF++AANIA+ +GDI L DLL KA FK+A + L + ++SLW
Sbjct: 1918 LTCLDELLSFEEESGNFLEAANIAKQKGDILLEADLLGKAEQFKDASLLILWYAFASSLW 1977
Query: 1343 SPGSKGWPLKQFTKKKELLEKAKSLAKNESNQFYEFVCTEADILSNDQSDLSIINQQLNA 1402
S G+KGWPLKQF +K++LL KAKS AKN S QFYEF EADIL NDQ+ L ++ Q L+A
Sbjct: 1978 SSGNKGWPLKQFAEKEKLLTKAKSFAKNVSIQFYEFTHVEADILLNDQTSLFMLKQHLDA 2037
Query: 1403 STRHQSISGETLSVRQILDFHLKTDSSKYVWGDELVLDLT-YSEEIICKNRVSVQSLVYF 1461
S H+S GE LS R+ILD HL + +KY W D++++DL +SE I N+VS ++LVYF
Sbjct: 2038 SQGHKSTRGEILSARKILDTHLNVNPAKYGWEDDMIIDLVRFSEGKISGNQVSSETLVYF 2097
Query: 1462 WDCWKDKIVNVIEYLGCLKSQDFSDHGSYGDFCLHYLGVWKQHSNLDTVYLLLNSDADWV 1521
W+ WKD +VN+ +YL L+ +D ++ SY +FCL+YLGV +Q +NLD VYLLL +A WV
Sbjct: 2098 WNFWKDNVVNIFKYLESLEKRDVNECRSYEEFCLNYLGVRRQFNNLDAVYLLLVPNAYWV 2157
Query: 1522 RGLGNSYALWSWKLPSIDVHQLVSAGKNYWSSELLSVGMKVLYYLEALNKQSSTNSPSVF 1581
+ L N + + K S+DV+Q +SA ++YW SELLSVGM VL L+AL S N S+F
Sbjct: 2158 KELDNRFMKSNGKFLSLDVNQFISAAQSYWCSELLSVGMDVLVKLKALYNLSIKNYLSLF 2217
Query: 1582 SQVLCLNCINEVAKFLLSSKHLNLSHHDAEILQKFVDRSTEHFFDSIFPLDRRESLKMNM 1641
Q L I VAKFLL SK L+ HHD + L +FV STEH F I+PL RESLK NM
Sbjct: 2218 CQSRLLIHIYAVAKFLLGSKFLDRRHHDKKALLEFVWLSTEHLFGCIYPLHWRESLKENM 2277
Query: 1642 ITLKGTEFYRNIIKEVIFKHLKDSP--SYGRIGSVMVMILGSGKLGNDVYERVAKWFDGN 1699
I+L+ TEF+RN+IKE + + + SYG++G + ILGSGKL N++Y+++A N
Sbjct: 2278 ISLRRTEFFRNLIKENTSETVSFASMLSYGQLGRISNAILGSGKLCNELYKKIADGVRWN 2337
Query: 1700 SLWKELFESLSWNMGSKSCQGSASCHNFDELKESHIQ-KFYKALVDIYGANWRKVH-YIT 1757
+ W L LS N N + E ++ K + AL D Y ANWRK + +I+
Sbjct: 2338 TAWMALIVDLSRNKDI----------NIEGANELSLKWKLHGALEDAYNANWRKENDFIS 2387
Query: 1758 PASFLYLIERLLILLSRLNGYIFTTKSSFVDWFIYQE--GSTNPTCSSSTDVKQSFGGVL 1815
P FLYL+ER L+LLS TKS+F +W IY E GS+N T + QS +L
Sbjct: 2388 PECFLYLVERQLMLLSYFRDDFLITKSAFTEWLIYLESDGSSNSTLVEHS--PQSVNSIL 2445
Query: 1816 EFIGTVVRQFLYNGKEVMEWIGKSHTNITHYHSLVVLRLVVIICLLHLNFGGDSLNLLLD 1875
+F+ VVR FLYN K MEWI KS TN+ Y++ VVLRLVVI C+L LNFG +LL +
Sbjct: 2446 QFLVDVVRYFLYNMKYTMEWIKKSRTNVKDYYAGVVLRLVVIACVLFLNFGL-CRDLLFE 2504
Query: 1876 LLGRSYICNKLPREFYDALRRR--RNRSL-----LDVIAEAFIKIGNPLVLASLGDNCPK 1928
LLGR+YI N+LP+E +DAL RR + +SL ++V+A+AF KIGNPLV+ S G + +
Sbjct: 2505 LLGRNYITNQLPKELFDALHRRWKQRKSLNVNIDVNVLADAFKKIGNPLVIVSCGKS-SR 2563
Query: 1929 FAGRDTIFVDM 1939
F D IFVDM
Sbjct: 2564 FLCPDAIFVDM 2574
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359473525|ref|XP_003631315.1| PREDICTED: uncharacterized protein LOC100265010 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356510822|ref|XP_003524133.1| PREDICTED: uncharacterized protein LOC100802419 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359473527|ref|XP_002263192.2| PREDICTED: uncharacterized protein LOC100243095 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449445371|ref|XP_004140446.1| PREDICTED: uncharacterized protein LOC101212468 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297738288|emb|CBI27489.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449526710|ref|XP_004170356.1| PREDICTED: uncharacterized protein LOC101229717 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147865014|emb|CAN78970.1| hypothetical protein VITISV_037587 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297738290|emb|CBI27491.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473531|ref|XP_002269567.2| PREDICTED: uncharacterized protein LOC100251075 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1939 | ||||||
| TAIR|locus:2018561 | 1050 | AT1G65810 [Arabidopsis thalian | 0.092 | 0.171 | 0.622 | 6.1e-108 | |
| TAIR|locus:2018536 | 1065 | AT1G65780 [Arabidopsis thalian | 0.093 | 0.169 | 0.569 | 1.1e-106 | |
| TAIR|locus:2166183 | 871 | AT5G37160 [Arabidopsis thalian | 0.092 | 0.205 | 0.566 | 7e-79 | |
| TAIR|locus:2166173 | 839 | AT5G37150 [Arabidopsis thalian | 0.098 | 0.227 | 0.543 | 5e-75 | |
| TAIR|locus:2173033 | 676 | AT5G52090 [Arabidopsis thalian | 0.098 | 0.282 | 0.538 | 3.3e-74 | |
| TAIR|locus:2166163 | 692 | AT5G37140 [Arabidopsis thalian | 0.090 | 0.252 | 0.561 | 3e-73 | |
| TAIR|locus:2152627 | 638 | AT5G37030 [Arabidopsis thalian | 0.078 | 0.239 | 0.597 | 2.8e-65 | |
| TAIR|locus:2135472 | 689 | AT4G05540 [Arabidopsis thalian | 0.092 | 0.259 | 0.572 | 9.7e-47 | |
| TAIR|locus:2126480 | 1311 | AT4G30100 [Arabidopsis thalian | 0.104 | 0.154 | 0.358 | 1e-26 | |
| UNIPROTKB|F1MVI7 | 2871 | TRANK1 "Uncharacterized protei | 0.167 | 0.113 | 0.248 | 2.2e-26 |
| TAIR|locus:2018561 AT1G65810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 546 (197.3 bits), Expect = 6.1e-108, Sum P(4) = 6.1e-108
Identities = 114/183 (62%), Positives = 140/183 (76%)
Query: 250 LLDFCFTKASLIFCTASSSYKLHRVAMEQLKFLVIDEAAQLKEVESAIPLKLPGIQHAIL 309
L C A L+FCTASSS +LH + QL LVIDEAAQLKE ESAIPL+L G+QHAIL
Sbjct: 526 LQKLCLDNAYLLFCTASSSARLHMSSPIQL--LVIDEAAQLKECESAIPLQLRGLQHAIL 583
Query: 310 IGDECQLPAMVESSVSGEACLGRSLFERLSNLGQAKHLLSIQYRMHPSISSFPNSYFYDN 369
IGDE QLPAM++S+++ EA LGRSLFERL LG K LL++QYRMHPSIS FPN FYD
Sbjct: 584 IGDEKQLPAMIKSNIASEADLGRSLFERLVLLGHNKQLLNMQYRMHPSISIFPNREFYDM 643
Query: 370 KIFDSPNVKEKNYEKRFLPGRMYGPYSFINVLDGREE-SIAHSYRNMVEVFVVMKILLNL 428
KI D+P+V+ ++YEK+FLP +MYGPYSFIN+ GRE+ +S +N+VEV VV +I+ L
Sbjct: 644 KILDAPSVRLRSYEKKFLPEKMYGPYSFINIAYGREQFGEGYSSKNLVEVSVVAEIVSKL 703
Query: 429 YKV 431
Y V
Sbjct: 704 YSV 706
|
|
| TAIR|locus:2018536 AT1G65780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166183 AT5G37160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166173 AT5G37150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173033 AT5G52090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166163 AT5G37140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152627 AT5G37030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135472 AT4G05540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126480 AT4G30100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MVI7 TRANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00013394001 | SubName- Full=Chromosome undetermined scaffold_473, whole genome shotgun sequence; (2586 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1939 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 4e-31 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 1e-14 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 4e-13 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 2e-12 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 1e-07 | |
| pfam13538 | 105 | pfam13538, UvrD_C_2, Family description | 0.001 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 121 bits (307), Expect = 4e-31
Identities = 42/103 (40%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
Query: 330 LGRSLFERLSNLGQ-AKHLLSIQYRMHPSISSFPNSYFYDNKIFDSPNVKEKNYEKRFLP 388
L RSLFERL G A +L QYRMHP IS FP+ FY K+ D +V E+ F
Sbjct: 1 LDRSLFERLQEAGPEAVVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPLPWDFHL 60
Query: 389 GRMYGPYSFINVLDGREES-IAHSYRNMVEVFVVMKILLNLYK 430
GP FI+V EE + SY N E +V++++ L K
Sbjct: 61 PDPLGPLVFIDVDGSEEEEEKSTSYSNEAEAELVVQLVEKLLK 103
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222209 pfam13538, UvrD_C_2, Family description | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1939 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 99.98 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 99.97 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 99.97 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 99.86 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 99.84 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.81 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.79 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 99.74 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 99.68 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.61 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.6 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.6 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.56 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.54 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.53 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 99.53 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 99.52 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.48 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.32 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.3 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 99.25 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.24 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.22 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.17 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.03 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 99.03 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 99.01 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 98.98 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 98.98 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 98.95 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 98.91 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 98.9 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.86 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 98.84 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 98.78 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 98.73 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 98.73 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 98.7 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 98.66 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 98.64 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 98.62 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 98.61 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 98.6 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.47 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.41 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 98.4 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.39 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.36 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 98.34 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 98.33 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 98.33 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 98.33 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 98.31 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.3 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 98.27 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 98.27 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.27 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 98.15 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.08 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.06 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.04 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 98.03 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 98.02 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.0 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.98 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.94 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.92 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 97.91 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.88 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.87 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 97.83 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.81 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.8 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.8 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.76 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 97.72 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 97.71 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.71 | |
| PRK08181 | 269 | transposase; Validated | 97.71 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.7 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.68 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 97.67 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.66 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 97.66 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.65 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.64 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.64 | |
| PRK06526 | 254 | transposase; Provisional | 97.61 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.58 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.57 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.56 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.53 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.53 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.52 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.52 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.52 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.51 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.5 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.47 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 97.47 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.46 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.46 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.46 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.42 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 97.41 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 97.41 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.4 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.39 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.39 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.39 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.38 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.35 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.34 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.33 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.32 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 97.32 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.3 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 97.29 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.29 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.28 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.28 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.23 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.22 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 97.2 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.19 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.17 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.17 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 97.14 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 97.14 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.13 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.09 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.08 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.08 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.08 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 97.07 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.07 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.06 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.05 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.05 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.04 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.04 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.04 | |
| COG5290 | 1243 | IkappaB kinase complex, IKAP component [Transcript | 97.04 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 97.03 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.01 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.01 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.01 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.98 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 96.96 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.96 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 96.95 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 96.94 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 96.91 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.91 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.91 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 96.91 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.9 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.89 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.88 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.87 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.87 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.87 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 96.86 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.86 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.82 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.77 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 96.77 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.77 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.76 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.76 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.75 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.73 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 96.72 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.7 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.67 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.64 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 96.64 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 96.64 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.63 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.63 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.61 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.61 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 96.57 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 96.56 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.55 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 96.55 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.54 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.52 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.49 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.49 | |
| PTZ00424 | 401 | helicase 45; Provisional | 96.47 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 96.44 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 96.42 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.41 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 96.41 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.41 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.4 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 96.36 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.34 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.34 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 96.34 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.33 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.33 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.31 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 96.31 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.3 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.29 | |
| KOG0987 | 540 | consensus DNA helicase PIF1/RRM3 [Cell cycle contr | 96.28 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 96.26 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.25 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.25 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 96.22 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.22 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 96.18 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 96.18 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 96.17 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.16 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.15 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.13 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.13 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 96.13 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.11 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.1 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.1 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 96.1 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 96.1 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.06 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.05 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 96.05 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.04 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.04 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.04 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 96.03 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 96.03 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 96.02 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 96.01 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.0 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 96.0 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.99 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 95.97 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 95.97 | |
| PRK06620 | 214 | hypothetical protein; Validated | 95.95 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 95.95 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 95.91 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.9 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 95.87 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.87 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.86 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 95.85 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.85 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.8 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 95.78 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 95.74 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 95.73 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 95.71 | |
| PHA02244 | 383 | ATPase-like protein | 95.69 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 95.67 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 95.67 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 95.65 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 95.63 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 95.63 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 95.62 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 95.61 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.6 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 95.6 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 95.58 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 95.58 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.56 | |
| COG5290 | 1243 | IkappaB kinase complex, IKAP component [Transcript | 95.54 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 95.53 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 95.52 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 95.51 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.48 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 95.4 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 95.34 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.34 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 95.33 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 95.32 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 95.27 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.27 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.27 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.25 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 95.24 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.19 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 95.18 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 95.16 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.15 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.13 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 95.13 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 95.11 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 95.1 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 95.09 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 95.08 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 95.07 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 95.03 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.02 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 95.0 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 94.98 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 94.97 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 94.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 94.96 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 94.93 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 94.82 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.77 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 94.76 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 94.76 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.75 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.75 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 94.75 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 94.73 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 94.72 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 94.67 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 94.67 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 94.65 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 94.64 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.64 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.63 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 94.62 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 94.62 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 94.62 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.61 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 94.6 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 94.6 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.58 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 94.57 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 94.56 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 94.55 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 94.51 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 94.5 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 94.5 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.49 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 94.44 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 94.39 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 94.38 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 94.36 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 94.32 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 94.31 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 94.28 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 94.25 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.2 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 94.2 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 94.2 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 94.19 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 94.19 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 94.18 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 94.15 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 94.13 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 94.13 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.12 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 94.1 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 94.1 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 94.08 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 94.07 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 94.04 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 94.03 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.99 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 93.98 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 93.88 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 93.87 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 93.86 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 93.84 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.83 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 93.82 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.81 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 93.8 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 93.78 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 93.77 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 93.76 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 93.72 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.7 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 93.66 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 93.65 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.64 | |
| KOG2280 | 829 | consensus Vacuolar assembly/sorting protein VPS16 | 93.59 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 93.57 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 93.56 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 93.56 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 93.55 | |
| PRK13764 | 602 | ATPase; Provisional | 93.53 | |
| PHA02624 | 647 | large T antigen; Provisional | 93.52 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 93.48 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 93.47 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.43 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 93.39 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 93.37 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.34 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 93.34 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 93.34 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 93.33 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 93.33 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 93.33 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 93.32 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 93.3 | |
| PF13479 | 213 | AAA_24: AAA domain | 93.3 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 93.24 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 93.24 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 93.23 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 93.22 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 93.19 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 93.17 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 93.13 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 93.12 | |
| PHA02774 | 613 | E1; Provisional | 93.11 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.1 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 93.1 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.08 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 93.06 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 93.04 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 93.02 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 93.01 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 93.0 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 92.9 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 92.9 | |
| PTZ00110 | 545 | helicase; Provisional | 92.89 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 92.89 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 92.87 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 92.78 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 92.76 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 92.69 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 92.65 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 92.64 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 92.64 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 92.64 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 92.63 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 92.58 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 92.56 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 92.55 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 92.55 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 92.54 | |
| PTZ00293 | 211 | thymidine kinase; Provisional | 92.53 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 92.48 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 92.48 | |
| PF05729 | 166 | NACHT: NACHT domain | 92.46 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 92.43 | |
| PRK09087 | 226 | hypothetical protein; Validated | 92.41 | |
| KOG2247 | 615 | consensus WD40 repeat-containing protein [General | 92.39 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 92.35 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 92.34 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.33 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 92.29 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 92.28 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 92.23 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 92.22 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 92.09 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 92.05 | |
| PHA00350 | 399 | putative assembly protein | 92.04 | |
| PHA00547 | 337 | hypothetical protein | 92.04 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 92.04 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 92.03 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 92.0 | |
| KOG2247 | 615 | consensus WD40 repeat-containing protein [General | 91.97 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 91.94 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 91.89 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 91.89 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 91.85 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 91.77 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 91.72 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 91.65 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 91.57 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 91.56 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 91.47 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 91.45 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 91.45 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 91.42 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 91.4 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 91.39 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 91.35 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 91.34 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 91.33 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 91.28 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 91.26 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 91.26 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 91.25 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 91.23 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 91.09 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 91.04 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 90.99 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 90.99 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 90.95 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 90.92 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 90.89 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 90.89 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 90.86 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 90.8 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 90.77 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 90.72 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 90.71 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 90.5 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 90.5 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 90.48 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 90.46 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.46 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 90.41 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 90.33 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-55 Score=525.51 Aligned_cols=434 Identities=26% Similarity=0.358 Sum_probs=339.1
Q ss_pred cccccccChHHHHHHcHhHHHHHHHHHHHHhHhhhhcCCchhhccccccCCCCceeEeEEEeeeecccCCCC--------
Q 035724 3 QIPLSFQSVNRYFESFVFPLLEETRAQLSSSMEKISEAPFAQVVDLEDSKPYGAMLSDVKVDYWRNRFSNYS-------- 74 (1939)
Q Consensus 3 kIP~tF~S~~eY~~sF~~pLieE~rAel~Ss~e~is~ap~~ei~~~~~~~~~g~~ly~l~v~~~rtgl~g~~-------- 74 (1939)
++..+|+++.+|.++|-++.-.|. .+++ .+ ++....-+++| +|.-||..+.
T Consensus 231 hv~~ry~da~~y~~vf~pliklea--------------~ydk--~~----Kes~~q~~~tv-RW~~gLnkk~~a~f~~~k 289 (935)
T KOG1802|consen 231 HVQLRYEDAYEYQNVFSPLIKLEA--------------DYDK--RL----KESQTQENGTV-RWDIGLNKKRLAYFTLPK 289 (935)
T ss_pred cccccccchHHHhhhcchhhhhhh--------------hhhh--hh----hhhcccccceE-EeeeccccceEEEEecCC
Confidence 456789999999999944444442 2222 11 11122234444 6766665431
Q ss_pred -cCCCCCCCCcEEEEecCCCCCchhhhhcccce-eEEEEEeeccCCCCCCCccceEEEEecccccccCCCccEEEEEecc
Q 035724 75 -KESYKVLPGDILVLADAKPETASDLRRVGRMW-TFVSVTKVTEDKNESDTTSTSFKVKASKENQIDGANKSLFAIFLTN 152 (1939)
Q Consensus 75 -~~~y~~~~GDIV~Ls~~kp~~~sDl~r~g~~~-~~gvV~kv~~d~~e~~~~~~~~~v~~sk~~~~~~~~~~l~vv~l~N 152 (1939)
....++..||.+.|+....... +| .+|.|.++++...++ ..++++++.+.. ......+.+-|++|
T Consensus 290 ~~~e~kl~~GdE~~L~y~~~~~~--------~w~~~g~v~~~pd~~~dE----~~lEl~~~~~~p-~e~~~~Ftvd~vwk 356 (935)
T KOG1802|consen 290 LDSELKLAIGDEIRLTYSGGLVL--------PWNGIGSVLKIPDNNGDE----VKLELEFSQDPP-IEVTHGFTVDFVWK 356 (935)
T ss_pred CcchhccccCCeeEEEecCCcCC--------cccccceEEecCCCCcce----eEEEeecCCCCC-cccccceEEEEEEc
Confidence 2345678999999998654331 23 469999998754333 567777777633 33445689999999
Q ss_pred cccHHHHHHHHHhccCh------hHHHHhhcCCCCcccccccCCCcCCCccccccCCCCCCCCCHHHHHHHHHHHhcccC
Q 035724 153 VTSNTRIWNSLHMSGNL------KIIKELLCTDSVVKEDCELCPVQSDGIWNDIFGPSLSSTLNDSQAQAVLSCLRRTHC 226 (1939)
Q Consensus 153 ~~t~~R~~~AL~~~~~~------~ii~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~~L~~~~~ 226 (1939)
-++|.||..||..++.. -+...+|+.+.. + +.....+++.|..+..++||.||..||+.+|+
T Consensus 357 ~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~--~------~~~k~~LP~~~s~~~lpkLN~SQ~~AV~~VL~---- 424 (935)
T KOG1802|consen 357 STSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVE--D------SSLKKLLPRRFSVPNLPKLNASQSNAVKHVLQ---- 424 (935)
T ss_pred CccHHHHHHHHHHhhhccccchhhhhhHHhcCcch--h------hhhcccCchhhcCCCchhhchHHHHHHHHHHc----
Confidence 99999999999987631 244455654211 0 11112233445455568999999999999998
Q ss_pred CCCCcEEEEeCCCCCchhHHHHHHH-------------------------------------------------------
Q 035724 227 DHKATVELIWGPPGTGKTKTVSMLL------------------------------------------------------- 251 (1939)
Q Consensus 227 ~~~~~v~LI~GPPGTGKTtti~~li------------------------------------------------------- 251 (1939)
.+++|||||||||||.|.++|+
T Consensus 425 ---rplsLIQGPPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgLKVvRl~aksRE~~~S~vs~L~l 501 (935)
T KOG1802|consen 425 ---RPLSLIQGPPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGLKVVRLCAKSREDIESDVSFLSL 501 (935)
T ss_pred ---CCceeeecCCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCceEeeeehhhhhhccCCccHHHH
Confidence 7899999999999999999998
Q ss_pred -----------------------------------------HHHhcCCcEEEEcccchhhHHhhhccCCcEEEEeCCccc
Q 035724 252 -----------------------------------------DFCFTKASLIFCTASSSYKLHRVAMEQLKFLVIDEAAQL 290 (1939)
Q Consensus 252 -----------------------------------------~~~l~~a~vI~~T~sss~~l~~l~~~~fdvVIIDEASQ~ 290 (1939)
+.++.+++||+||+.+++... +....|..|+||||.|+
T Consensus 502 h~~~~~~~~pELq~l~klkde~gelS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~r-l~~~kfr~VLiDEaTQa 580 (935)
T KOG1802|consen 502 HEQLRNMDKPELQKLLKLKDEGGELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRR-LSKFKFRTVLIDEATQA 580 (935)
T ss_pred HHHHhccCcHHHHHHHhhhhhcccccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchh-hccccccEEEEeccccc
Confidence 345678999999999887543 44478999999999999
Q ss_pred chHHhhccccCCCcceEEEEeccccCCcceeccccccccccCCHHHHHHhcCCccccccccccCChhhhccCcccccCCC
Q 035724 291 KEVESAIPLKLPGIQHAILIGDECQLPAMVESSVSGEACLGRSLFERLSNLGQAKHLLSIQYRMHPSISSFPNSYFYDNK 370 (1939)
Q Consensus 291 ~E~e~lipL~~~~~~rlVLiGD~~QLpPvV~s~~~~~~gl~~SLFeRL~~~~~~~~~L~~QYRmhp~I~~f~S~~FY~gk 370 (1939)
+||++++|+.+ |.+++||||||+||.|++..+.++.+|+.+||||||+..|..+++|.+||||||.|++|||+.||+|.
T Consensus 581 tEpe~LiPlvl-G~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~ 659 (935)
T KOG1802|consen 581 TEPECLIPLVL-GAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGE 659 (935)
T ss_pred CCcchhhhhhh-cceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccch
Confidence 99999999998 89999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCccccccccccc--CCCCCCCCeEEEEcCCCccc--cCCCCcCCHHHHHHHHHHHHHHHHcCCCCCcceE------
Q 035724 371 IFDSPNVKEKNYEKRF--LPGRMYGPYSFINVLDGREE--SIAHSYRNMVEVFVVMKILLNLYKVHNVSNLCSS------ 440 (1939)
Q Consensus 371 L~~~~~v~~~~~~~~~--l~~p~~~p~~Fidv~~G~Ee--~~g~S~~N~~EA~~V~~lV~~L~~~~~~~~~~I~------ 440 (1939)
|.++.....+.....+ |+.| ..|+.|..+ .|.|+ .+|+|+.|..||..+.+|++.|++.+..+ ..||
T Consensus 660 LqnGVT~~~R~~~g~~~pwp~p-~~pl~fy~~-~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~-~qIGVITpYe 736 (935)
T KOG1802|consen 660 LQNGVTEIERSPLGVDFPWPQP-DKPLFFYVC-YGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKP-SQIGVITPYE 736 (935)
T ss_pred hhcCcchhhhccCCCCCCCCCC-CCccceEEe-ccceeeeccccceecHHHHHHHHHHHHHHHHcCCCH-HHeeeecccc
Confidence 9999988777654443 4444 348888888 88887 88999999999999999999999998544 4444
Q ss_pred -------------------eee-----eeec-------------ccc------cccc------------eeEEEEEcchH
Q 035724 441 -------------------LMK-----KCIN-------------VKY------FFLS------------MHCLWILGNAR 465 (1939)
Q Consensus 441 -------------------L~k-----tVDg-------------VRS------GFLs------------K~~LiIVGN~~ 465 (1939)
|-+ +||+ ||| |||+ |+||+||||+.
T Consensus 737 gQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glvivGN~~ 816 (935)
T KOG1802|consen 737 GQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLVIVGNPK 816 (935)
T ss_pred hhHHHHHHHHHhcCccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceEEecCHH
Confidence 101 6776 898 9998 99999999999
Q ss_pred HhhhcchHHHHHHHHHHHcCceecCc
Q 035724 466 TLTRKKSVWEALVHDANARQCFFNAE 491 (1939)
Q Consensus 466 tL~~~~~~W~~li~~~k~rgc~~~~~ 491 (1939)
+|++ ++.|.++|.++++++|++.+.
T Consensus 817 ~L~k-~~LW~~li~h~~eke~l~eg~ 841 (935)
T KOG1802|consen 817 VLRK-HPLWGHLITHYKEKEVLVEGP 841 (935)
T ss_pred Hhhh-chHHHHHHHHhhcccceeecc
Confidence 9999 599999999999999999874
|
|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG5290 IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5290 IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2247 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PHA00547 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >KOG2247 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1939 | ||||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 1e-17 | ||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 3e-17 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 3e-17 | ||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 2e-15 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 1e-05 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 1e-05 |
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
|
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
Score = 197 bits (501), Expect = 7e-52
Identities = 52/181 (28%), Positives = 90/181 (49%), Gaps = 5/181 (2%)
Query: 252 DFCFTKASLIFCTASSSYKLHRVAMEQLKFLVIDEAAQLKEVESAIPLKLPGIQHAILIG 311
KA ++ CT + + + + ++IDE+ Q E E IP+ + G + IL+G
Sbjct: 493 AEILNKADVVCCTCVGAG--DKRLDTKFRTVLIDESTQASEPECLIPI-VKGAKQVILVG 549
Query: 312 DECQLPAMVESSVSGEACLGRSLFERLSNLGQAKHLLSIQYRMHPSISSFPNSYFYDNKI 371
D QL ++ + +A L +SLFERL +LG L +QYRM+P +S FP++ FY+ +
Sbjct: 550 DHQQLGPVILERKAADAGLKQSLFERLISLGHVPIRLEVQYRMNPYLSEFPSNMFYEGSL 609
Query: 372 FDSPNVKEKNYEKRFLPGRMYGPYSFINVLDGREESIA--HSYRNMVEVFVVMKILLNLY 429
+ ++++ P + G GREE A S+ N +E +I+ L+
Sbjct: 610 QNGVTIEQRTVPNSKFPWPIRGIPMMFWANYGREEISANGTSFLNRIEAMNCERIITKLF 669
Query: 430 K 430
+
Sbjct: 670 R 670
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1939 | |||
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.73 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.58 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.58 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 99.51 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.37 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.37 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 99.32 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.21 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.16 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.15 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.0 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.9 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 98.87 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 98.87 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 98.81 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 98.7 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 98.65 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 98.64 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 98.64 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.61 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 98.57 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.57 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 98.52 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.49 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.47 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.47 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.46 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.42 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.42 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.41 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.41 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.39 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.38 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.34 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.28 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.27 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.16 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.14 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.08 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.07 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.04 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.02 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.01 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.99 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.98 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.98 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.95 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.92 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.92 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.91 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.9 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.88 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.84 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.83 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.81 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.78 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.77 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.77 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.76 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.76 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.73 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.69 | |
| 1w36_C | 1122 | RECC, exodeoxyribonuclease V gamma chain; recombin | 97.69 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.68 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.64 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.64 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.63 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.63 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 97.62 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.57 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 97.54 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.53 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.52 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.52 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.51 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 97.5 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.49 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 97.48 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.43 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.33 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 97.32 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.32 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.3 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.3 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.29 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 97.29 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.28 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.26 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 97.26 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 97.25 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.24 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.19 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.18 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.18 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 97.15 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.14 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 97.12 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.11 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.1 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.1 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 97.09 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.08 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.07 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.04 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.03 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 97.02 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.01 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.01 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 97.0 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.95 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 96.95 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.93 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.93 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.92 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 96.91 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.9 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 96.9 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 96.9 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 96.89 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.89 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.88 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.87 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 96.87 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.86 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.86 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.85 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.85 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.85 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.84 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 96.84 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 96.83 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.83 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.83 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 96.81 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.8 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 96.8 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 96.8 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 96.78 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 96.77 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.77 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.76 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 96.74 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 96.73 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.72 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 96.71 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 96.7 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.69 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.67 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.66 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 96.65 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 96.64 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.62 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.62 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 96.61 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.58 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 96.58 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.57 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.57 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.55 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 96.55 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.54 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 96.53 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 96.52 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.48 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.47 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 96.47 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.46 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 96.45 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.44 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 96.44 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 96.44 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 96.42 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.39 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.38 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.37 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 96.36 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.34 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.32 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.31 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 96.28 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 96.28 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.26 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.25 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 96.24 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 96.22 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.22 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.22 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.21 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 96.17 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 96.16 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.16 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 96.14 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.11 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 96.07 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.06 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.06 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.05 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 96.05 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.05 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.03 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 96.02 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.01 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.01 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.99 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 95.95 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 95.94 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 95.93 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.91 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 95.89 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 95.86 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.86 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.84 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 95.83 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.82 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.82 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 95.8 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 95.79 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 95.78 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.78 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 95.77 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 95.77 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 95.77 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 95.76 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.73 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.72 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 95.71 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.69 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 95.67 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 95.67 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.67 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.62 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.61 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 95.61 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 95.61 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.6 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 95.6 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 95.58 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 95.54 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.52 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.51 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 95.5 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.5 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 95.48 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 95.48 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.48 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.47 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 95.47 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 95.44 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.44 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 95.42 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 95.4 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 95.4 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 95.39 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.39 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 95.36 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 95.33 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.32 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 95.31 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 95.31 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 95.28 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.17 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 95.12 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 95.12 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 95.11 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.06 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.0 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 95.0 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.0 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 94.96 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 94.93 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 94.9 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 94.81 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.72 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 94.71 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.66 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 94.63 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 94.63 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 94.61 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 94.56 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 94.55 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.54 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.54 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 94.46 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 94.44 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 94.4 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 94.39 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 94.37 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 94.36 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 94.31 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 94.3 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 94.29 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 94.28 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 94.24 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 94.23 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 94.14 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 94.11 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 94.08 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 94.08 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 94.04 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 93.98 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.93 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 93.91 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.91 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 93.89 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 93.89 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 93.88 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 93.83 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 93.83 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 93.83 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 93.76 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.76 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 93.75 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.73 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 93.72 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 93.69 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.67 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.64 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 93.59 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 93.45 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 93.44 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 93.33 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 93.26 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.25 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 92.92 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 92.85 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 92.75 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 92.74 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 92.66 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 92.6 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 92.51 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 92.42 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 92.39 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 92.28 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 92.26 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 92.19 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 92.16 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 92.07 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 92.07 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 92.05 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 91.95 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 91.94 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 91.93 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 91.69 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 91.33 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 91.22 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 91.17 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 91.14 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 91.12 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 91.11 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 91.1 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 91.06 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 91.03 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 91.01 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 91.0 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 91.0 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 90.81 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 90.76 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 90.65 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 90.62 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 90.61 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.46 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 90.37 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 90.37 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 90.28 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.2 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 90.17 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 90.12 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 90.11 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 90.11 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 90.08 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 90.08 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 90.08 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 90.05 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 89.78 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 89.73 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 89.63 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 89.57 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 89.54 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 89.49 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 89.42 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 89.36 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 89.3 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 89.28 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 89.27 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 89.22 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 89.17 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.14 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 89.1 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 89.04 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 88.99 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 88.84 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 88.82 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 88.77 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 88.75 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 88.74 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 88.64 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 88.62 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 88.58 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 88.58 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 88.56 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 88.54 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 88.52 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 88.49 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 88.48 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 88.46 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 88.44 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 88.37 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 88.36 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 88.35 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 88.21 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 88.19 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.17 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 88.14 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 88.09 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 88.08 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 88.06 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 88.03 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 87.96 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 87.93 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 87.91 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 87.9 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 87.84 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 87.79 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 87.71 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 87.7 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 87.68 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 87.68 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 87.61 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 87.54 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 87.44 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 87.39 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 87.39 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 87.37 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 87.29 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 87.21 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 87.19 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 87.18 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 87.15 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 87.15 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 87.1 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 87.03 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 87.0 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 86.99 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 86.98 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 86.92 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 86.91 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 86.9 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 86.87 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 86.86 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 86.74 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 86.73 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 86.72 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 86.71 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 86.71 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 86.67 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 86.66 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 86.64 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 86.61 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 86.6 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 86.56 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 86.48 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 86.48 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 86.47 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 86.47 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 86.41 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 86.37 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 86.35 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 86.34 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 86.28 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 86.28 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 86.23 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 86.17 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 86.12 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 86.12 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 86.1 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 86.06 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 86.05 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 85.93 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 85.88 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 85.86 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 85.76 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 85.7 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 85.7 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 85.68 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 85.66 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 85.62 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 85.55 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 85.54 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 85.53 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 85.52 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 85.45 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 85.44 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 85.44 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 85.38 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 85.36 |
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-53 Score=552.62 Aligned_cols=437 Identities=24% Similarity=0.242 Sum_probs=337.2
Q ss_pred cChHHHHHHcHhHHHHHHHHHHHHhHhhhhcCCchhhccccccCCCCceeEeEEEeeeecccCCC--------------C
Q 035724 9 QSVNRYFESFVFPLLEETRAQLSSSMEKISEAPFAQVVDLEDSKPYGAMLSDVKVDYWRNRFSNY--------------S 74 (1939)
Q Consensus 9 ~S~~eY~~sF~~pLieE~rAel~Ss~e~is~ap~~ei~~~~~~~~~g~~ly~l~v~~~rtgl~g~--------------~ 74 (1939)
.|+++|++.|..+|..|+++|+....+.+...+..+.. +.|.+++++.+...++|++|+ .
T Consensus 2 ~~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~~~~~~------~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~~ 75 (646)
T 4b3f_X 2 AAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQ------SRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSAAA 75 (646)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCHHHHG------GGTSEEEEEEEEEEEECSSSCEEEEEEESCC---CC
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHH------hCCceecceEEEEEEecCCCeEEEEEEecCCCCCCC
Confidence 36899999999999999999999999999888877743 568999999999999988764 3
Q ss_pred cCCCCCCCCcEEEEecCCCCCchhhhhcccceeEEEEEeeccCCCCCCCccceEEEEecccccc---cCCCccEEEEEec
Q 035724 75 KESYKVLPGDILVLADAKPETASDLRRVGRMWTFVSVTKVTEDKNESDTTSTSFKVKASKENQI---DGANKSLFAIFLT 151 (1939)
Q Consensus 75 ~~~y~~~~GDIV~Ls~~kp~~~sDl~r~g~~~~~gvV~kv~~d~~e~~~~~~~~~v~~sk~~~~---~~~~~~l~vv~l~ 151 (1939)
.+.+.+++||+|+|++..+.. .....|+|++++.+ .+.|.+...... ......+.+.++.
T Consensus 76 l~~~~~~~Gd~v~~~~~~~~~--------~~~~~g~v~~~~~~---------~i~v~~~~~~~~~~~~~~~~~~~~~~~~ 138 (646)
T 4b3f_X 76 LPSNSFTSGDIVGLYDAANEG--------SQLATGILTRVTQK---------SVTVAFDESHDFQLSLDRENSYRLLKLA 138 (646)
T ss_dssp CCCCCCCTTCEEEEEETTTTS--------CCCEEEEEEEEETT---------EEEEECC-------CCCSSCCEEEEEEC
T ss_pred CccCCCCCCCEEEEEecCCCC--------CceEEEEEEEEeCC---------EEEEEECCccccccccCCCCcEEEEEec
Confidence 457789999999999866542 24567999999874 577777654332 2234578999999
Q ss_pred ccccHHHHHHHHHhccC------hhHHHHhhcCCCCcccccccCCCcCCCccccccCCCCCCCCCHHHHHHHHHHHhccc
Q 035724 152 NVTSNTRIWNSLHMSGN------LKIIKELLCTDSVVKEDCELCPVQSDGIWNDIFGPSLSSTLNDSQAQAVLSCLRRTH 225 (1939)
Q Consensus 152 N~~t~~R~~~AL~~~~~------~~ii~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~~L~~~~ 225 (1939)
|.+||+||++||..+.. ..+.+.+++..++.. ...... ....+..||++|++||..+++.
T Consensus 139 ~~~~~~r~~~al~~l~~~~~~~~~~l~~~l~~~~~p~~---------~~~~~~---~~~~~~~LN~~Q~~AV~~al~~-- 204 (646)
T 4b3f_X 139 NDVTYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSP---------ASEIHP---LTFFNTCLDTSQKEAVLFALSQ-- 204 (646)
T ss_dssp CHHHHHHHHHHHHHHHTCCSSTTHHHHHHHTTSSCCCC---------CCCCCC---CCCSSTTCCHHHHHHHHHHHHC--
T ss_pred cchHHHHHHHHHHHhhhcccCchHHHHHHHcCCCCCCC---------ccccCc---ccccCCCCCHHHHHHHHHHhcC--
Confidence 99999999999987642 235555665433211 010000 0234678999999999999984
Q ss_pred CCCCCcEEEEeCCCCCchhHHHHHHHHHH---------------------------------------------------
Q 035724 226 CDHKATVELIWGPPGTGKTKTVSMLLDFC--------------------------------------------------- 254 (1939)
Q Consensus 226 ~~~~~~v~LI~GPPGTGKTtti~~li~~~--------------------------------------------------- 254 (1939)
++++||+||||||||+|+++++..+
T Consensus 205 ----~~~~lI~GPPGTGKT~ti~~~I~~l~~~~~~ILv~a~TN~AvD~i~erL~~~~~~ilRlG~~~r~~~~~~~~~l~~ 280 (646)
T 4b3f_X 205 ----KELAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCKQRILRLGHPARLLESIQQHSLDA 280 (646)
T ss_dssp ----SSEEEEECCTTSCHHHHHHHHHHHHHHTTCCEEEEESSHHHHHHHHHHHHHTTCCEEECSCCSSCCHHHHTTBHHH
T ss_pred ----CCceEEECCCCCCHHHHHHHHHHHHHhCCCeEEEEcCchHHHHHHHHHHHhcCCceEEecchhhhhhhhhhhhHHH
Confidence 5799999999999999999888211
Q ss_pred -----------------------------------------------------------hcCCcEEEEcccchhhH---H
Q 035724 255 -----------------------------------------------------------FTKASLIFCTASSSYKL---H 272 (1939)
Q Consensus 255 -----------------------------------------------------------l~~a~vI~~T~sss~~l---~ 272 (1939)
+..+++|++|+.++... .
T Consensus 281 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~ 360 (646)
T 4b3f_X 281 VLARSDSAQIVADIRKDIDQVFVKNKKTQDKREKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLK 360 (646)
T ss_dssp HHTTTTCSSTHHHHHHHHTTSSTTTTC------CCSSHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGG
T ss_pred HHhhchHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHH
Confidence 12345677766554322 2
Q ss_pred hhhccCCcEEEEeCCcccchHHhhccccCCCcceEEEEeccccCCcceeccccccccccCCHHHHHHhcC--Cccccccc
Q 035724 273 RVAMEQLKFLVIDEAAQLKEVESAIPLKLPGIQHAILIGDECQLPAMVESSVSGEACLGRSLFERLSNLG--QAKHLLSI 350 (1939)
Q Consensus 273 ~l~~~~fdvVIIDEASQ~~E~e~lipL~~~~~~rlVLiGD~~QLpPvV~s~~~~~~gl~~SLFeRL~~~~--~~~~~L~~ 350 (1939)
.+....||+||||||+|++|+++++|+.. .+++||||||+||||++.+..+...|++.|+|+||.... .+.++|++
T Consensus 361 ~~~~~~Fd~vIIDEAsQ~~e~~~lipL~~--~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~~~~v~~L~~ 438 (646)
T 4b3f_X 361 LLPESYFDVVVIDECAQALEASCWIPLLK--ARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVVRTLTV 438 (646)
T ss_dssp GSCTTCCSEEEETTGGGSCHHHHTTTGGG--SSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHGGGTEEECCE
T ss_pred hhhhccCCEEEEcCccccchHHHHhhccc--cceEEEcCCccccCceecchhhhhccccchHHHHHHHhcCCceeeeccc
Confidence 23456799999999999999999999964 589999999999999999988888999999999998763 45678999
Q ss_pred cccCChhhhccCcccccCCCCCCCCccccccccccc---CCCCCCCCeEEEEcCCCc-----cccCCCCcCCHHHHHHHH
Q 035724 351 QYRMHPSISSFPNSYFYDNKIFDSPNVKEKNYEKRF---LPGRMYGPYSFINVLDGR-----EESIAHSYRNMVEVFVVM 422 (1939)
Q Consensus 351 QYRmhp~I~~f~S~~FY~gkL~~~~~v~~~~~~~~~---l~~p~~~p~~Fidv~~G~-----Ee~~g~S~~N~~EA~~V~ 422 (1939)
||||||.|+.|+|..||+|+|.+++++..+...... .......|+.|+|+ .|. ++..+.|+.|..||++|+
T Consensus 439 qYRmhp~I~~f~n~~fY~g~L~~~~~~~~~~~~~lp~~~~~~~~~~p~~f~d~-~g~~~~~~~~~~~~s~~N~~EA~~V~ 517 (646)
T 4b3f_X 439 QYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDT-AGCGLFELEEEDEQSKGNPGEVRLVS 517 (646)
T ss_dssp ESSSCHHHHHHHHHHHSTTCCEECTTTTTCCGGGSTTCCCCTTTTCSEEEEEC-TTSSCCCCC-----CCCCHHHHHHHH
T ss_pred ccCCcHHHHhhhHHhhcCCccccCcchhhhhhccccccccccccCCceEEEec-CCCccccccccCCccccCHHHHHHHH
Confidence 999999999999999999999999988765443321 11122358999999 443 236788999999999999
Q ss_pred HHHHHHHHcCCCCCcceEe---------------e--------eeeec-------------ccc------cccc------
Q 035724 423 KILLNLYKVHNVSNLCSSL---------------M--------KKCIN-------------VKY------FFLS------ 454 (1939)
Q Consensus 423 ~lV~~L~~~~~~~~~~I~L---------------~--------ktVDg-------------VRS------GFLs------ 454 (1939)
.+++.|++.+..+ ..|++ . .|||+ ||| |||+
T Consensus 518 ~~v~~L~~~gv~~-~dIgVItpYraQ~~~l~~~l~~~~~~i~v~TVd~fQG~E~dvII~S~vrsn~~~~iGFl~~~rRlN 596 (646)
T 4b3f_X 518 LHIQALVDAGVPA-RDIAVVSPYNLQVDLLRQSLVHRHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRIN 596 (646)
T ss_dssp HHHHHHHHHTCCG-GGEEEEESCHHHHHHHHHHHTTTCTTCEEEEGGGGTTCCEEEEEEECCCCCTTCCCCSTTCHHHHH
T ss_pred HHHHHHHhcCCCc-CcEEEECCCHHHHHHHHHHHHHhCCCCEECChhhcccccCCEEEEEeccCCCCCCccccCCcCcEE
Confidence 9999999987544 44541 0 17775 887 9997
Q ss_pred ------eeEEEEEcchHHhhhcchHHHHHHHHHHHcCceecCc
Q 035724 455 ------MHCLWILGNARTLTRKKSVWEALVHDANARQCFFNAE 491 (1939)
Q Consensus 455 ------K~~LiIVGN~~tL~~~~~~W~~li~~~k~rgc~~~~~ 491 (1939)
|++||||||..+|.+ ++.|++++++++++|+++.+-
T Consensus 597 VAlTRAk~~liivGn~~~l~~-~~~~~~li~~~~~~g~~~~~~ 638 (646)
T 4b3f_X 597 VAVTRARRHVAVICDSRTVNN-HAFLKTLVEYFTQHGEVRTAF 638 (646)
T ss_dssp HHHHTEEEEEEEEECHHHHTT-SHHHHHHHHHHHHSSEEEEGG
T ss_pred eEhhhhhCeEEEEEchHHhcC-CHHHHHHHHHHHHCCCEeeHH
Confidence 999999999999988 599999999999999998763
|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1939 | ||||
| d1w36b2 | 395 | c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta | 2e-04 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 0.002 |
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 395 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V beta chain (RecB), N-terminal domain species: Escherichia coli [TaxId: 562]
Score = 43.1 bits (100), Expect = 2e-04
Identities = 26/181 (14%), Positives = 60/181 (33%), Gaps = 9/181 (4%)
Query: 855 HPLVITFHKFLMMLDGTLGSSYFERFHDIRKHHGQPETSLIYGEPPILLESRNDENAIIK 914
H + +F + E L L + +++
Sbjct: 151 HAWDVVVEEFDGYRQIWRKRGVMPMLRALMSARNIAENLLATAGGERRLTDILHISELLQ 210
Query: 915 IFGNSGDAGGNMVGFGAEQVILVRDDCVRKEISNYVGKQALVL-TIVESKGLEFQVIHYT 973
G ++ +V + ++ ++ + +++ K + + TI +SKGLE+ ++
Sbjct: 211 EAGTQLESEHALVRWLSQHILEPDSNASSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLP 270
Query: 974 SQCCNSPFKHALFDSTSPGSFP--------SFNEAKHNVLCSELKQLYVAITRTRQRLWI 1025
+ A + S + A+ L +L+ LYVA+TR+ +
Sbjct: 271 FITNFRVQEQAFYHDRHSFEAVLDLNAAPESVDLAEAERLAEDLRLLYVALTRSVWHCSL 330
Query: 1026 W 1026
Sbjct: 331 G 331
|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1939 | |||
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.73 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.62 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.27 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.07 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.05 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.97 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.73 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.37 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.13 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.09 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.07 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.02 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.94 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 97.91 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.78 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 97.74 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 97.66 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.57 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.51 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.46 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.42 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.41 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.32 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.27 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.26 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.23 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.21 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 97.08 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.07 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.06 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.01 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.95 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.9 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 96.81 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.81 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 96.78 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 96.77 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.71 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.69 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.66 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.65 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 96.65 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.55 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 96.5 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 96.45 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.45 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.44 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 96.42 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.41 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 96.37 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.32 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.32 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.3 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.29 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.26 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.25 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 96.23 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.18 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.16 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.13 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.13 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 96.12 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.08 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.08 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.96 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.91 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.9 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 95.9 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 95.88 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 95.87 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.82 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 95.77 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.65 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.64 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 95.63 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 95.61 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.55 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.53 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.52 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 95.5 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 95.43 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.29 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.09 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 95.07 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 95.05 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 95.04 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.02 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.0 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.78 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.68 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.64 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 94.61 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.56 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 94.52 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 94.49 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.34 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.33 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.33 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.32 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.16 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.97 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 93.94 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 93.85 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.65 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.56 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.47 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.4 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.22 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 93.15 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 93.14 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.1 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.06 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 92.93 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 92.47 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.29 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.28 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.14 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 92.08 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 91.98 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 91.93 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.92 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 91.86 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 91.85 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 91.85 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.85 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 91.84 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 91.75 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.69 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 91.59 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 91.31 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 91.27 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 91.27 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 91.25 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 91.2 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.16 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.04 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.99 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 90.98 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 90.96 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 90.95 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 90.94 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 90.93 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 90.89 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.77 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 90.74 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.71 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 90.69 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 90.27 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.23 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 90.2 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 90.16 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 89.99 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 89.9 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 89.9 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 89.82 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 89.77 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 89.75 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 89.74 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 89.65 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.46 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.44 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 89.37 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 89.29 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 89.24 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 89.15 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 89.04 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 88.79 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 88.79 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 88.73 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 88.63 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 88.62 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 88.62 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 88.56 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 88.46 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 88.34 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 88.25 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 88.21 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 88.1 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 88.1 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 87.96 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 87.88 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 87.86 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 87.46 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 87.42 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 87.35 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 87.15 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 87.0 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 86.95 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 86.91 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 86.81 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 86.77 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 86.72 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.44 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 86.4 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 86.39 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 86.26 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 86.16 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 86.11 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.89 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 85.73 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 85.72 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 85.62 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 85.55 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 85.26 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 85.19 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 85.05 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 85.05 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 84.98 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 84.91 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 84.9 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 84.85 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 84.75 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 84.75 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 84.69 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 84.63 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 84.58 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 84.57 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 84.56 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 84.06 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 83.98 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 83.7 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 83.7 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 83.38 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 83.38 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 82.97 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 82.95 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 82.69 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 82.64 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 82.29 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 82.26 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 82.17 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 82.1 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 82.09 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 81.83 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 81.82 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 81.79 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 81.77 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 81.64 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 81.61 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 81.59 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 81.16 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 81.09 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 81.08 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 80.62 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 80.46 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 80.42 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 80.3 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 80.26 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 80.19 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 80.11 | |
| d1wmia1 | 88 | Hypothetical protein PHS013 {Pyrococcus horikoshii | 80.1 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V alpha chain (RecD) species: Escherichia coli [TaxId: 562]
Probab=99.73 E-value=2.3e-18 Score=206.82 Aligned_cols=158 Identities=23% Similarity=0.267 Sum_probs=106.3
Q ss_pred EEEEecccccHHHHHHHHHhccChhHHHHhhcCCCCcccccccCCCcCCCccccccCCCCCCCCCHHHHHHHHHHHhccc
Q 035724 146 FAIFLTNVTSNTRIWNSLHMSGNLKIIKELLCTDSVVKEDCELCPVQSDGIWNDIFGPSLSSTLNDSQAQAVLSCLRRTH 225 (1939)
Q Consensus 146 ~vv~l~N~~t~~R~~~AL~~~~~~~ii~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~~L~~~~ 225 (1939)
++++.-+++|.+|+|+++..++.. +.++..+.+... ......++..++ ...++++|+.|+..+++
T Consensus 98 p~vl~~~~lyl~~~~~~E~~ia~~--l~~~~~~~~~~~-------~~~~~~~~~~~~---~~~~~~~Q~~A~~~al~--- 162 (359)
T d1w36d1 98 PMILCGDRLYLNRMWCNERTVARF--FNEVNHAIEVDE-------ALLAQTLDKLFP---VSDEINWQKVAAAVALT--- 162 (359)
T ss_dssp SEEECSSEEEEHHHHHHHHHHHHH--HTSCCBCCCCCH-------HHHHHHHHTTCC---CTTSCCHHHHHHHHHHT---
T ss_pred ceEEECCEeehHHHHHHHHHHHHH--HHHhcCCCCCCh-------HHHHHHHHHhcc---CcccccHHHHHHHHHHc---
Confidence 455566789999999999986532 333222221111 000111223343 24578899999999998
Q ss_pred CCCCCcEEEEeCCCCCchhHHHHHHHHHHh-----cCCcEEEEcccchhh--HH--------------------------
Q 035724 226 CDHKATVELIWGPPGTGKTKTVSMLLDFCF-----TKASLIFCTASSSYK--LH-------------------------- 272 (1939)
Q Consensus 226 ~~~~~~v~LI~GPPGTGKTtti~~li~~~l-----~~a~vI~~T~sss~~--l~-------------------------- 272 (1939)
+++++|+||||||||||+..++..+. ...+|++|+.++.+. +.
T Consensus 163 ----~~~~vI~G~pGTGKTt~i~~~l~~l~~~~~~~~~~I~l~ApTgkAA~~L~e~~~~~~~~~~~~~~~~~~~~~~~~t 238 (359)
T d1w36d1 163 ----RRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDAST 238 (359)
T ss_dssp ----BSEEEEECCTTSTHHHHHHHHHHHHHHTCSSCCCCEEEEBSSHHHHHHHHHHHTHHHHHSSCCSCCCCSCSCCCBT
T ss_pred ----CCeEEEEcCCCCCceehHHHHHHHHHHHHhccCCeEEEecCcHHHHHHHHHHHHHHHhhcCchhhhhhhhhhhhhH
Confidence 68999999999999999988875553 234677776554321 10
Q ss_pred -----------------hhhccCCcEEEEeCCcccchHHhhccc-cCCCcceEEEEeccccCCcceec
Q 035724 273 -----------------RVAMEQLKFLVIDEAAQLKEVESAIPL-KLPGIQHAILIGDECQLPAMVES 322 (1939)
Q Consensus 273 -----------------~l~~~~fdvVIIDEASQ~~E~e~lipL-~~~~~~rlVLiGD~~QLpPvV~s 322 (1939)
.....++|+||||||||++++.....+ ..++..++||+||++||||+..+
T Consensus 239 ~~~ll~~~~~~~~~~~~~~~~l~~d~lIIDEaSmv~~~l~~~ll~~~~~~~~lILvGD~~QLppV~~G 306 (359)
T d1w36d1 239 LHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQLASVEAG 306 (359)
T ss_dssp TTSCC-----------CTTSCCSCSEEEECSGGGCBHHHHHHHHHTCCTTCEEEEEECTTSGGGTSTT
T ss_pred HHHHHhhhhcchHHHHhhhcccccceeeehhhhccCHHHHHHHHHHhcCCCEEEEECChhhccCCCCC
Confidence 012246899999999999988554333 23467899999999999998543
|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmia1 d.298.1.2 (A:1-88) Hypothetical protein PHS013 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|