Citrus Sinensis ID: 035755


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--
MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTFL
ccHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcc
MQGDEARVllgfppnsrpnasQVKAAYKRKVwechpdlfpvgrktdaESKFKLISEAYTYLLSGnfhlftfl
MQGDEARVllgfppnsrpnaSQVKAAYKRKVWechpdlfpvgrktdaESKFKLISEAYTYLLSGNFHLFTFL
MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTFL
************************AAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTF*
***DEARVLLGFPPNSRP*ASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTFL
MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTFL
****EARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTFL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFTFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query72 2.2.26 [Sep-21-2011]
P50026 287 Chaperone protein DnaJ OS yes no 0.680 0.170 0.452 8e-05
B9KAB9 370 Chaperone protein DnaJ OS yes no 0.694 0.135 0.471 0.0001
P39101 391 Protein CAJ1 OS=Saccharom yes no 0.680 0.125 0.415 0.0003
A5IIT4 369 Chaperone protein DnaJ OS yes no 0.694 0.135 0.471 0.0004
B1LCI2 369 Chaperone protein DnaJ OS yes no 0.694 0.135 0.471 0.0004
Q9WZV3 369 Chaperone protein DnaJ OS yes no 0.694 0.135 0.471 0.0004
Q2GLU9 382 Chaperone protein DnaJ OS yes no 0.527 0.099 0.55 0.0008
Q6AEC0 369 Chaperone protein DnaJ OS yes no 0.666 0.130 0.396 0.0008
>sp|P50026|DNAJ_SYNE7 Chaperone protein DnaJ OS=Synechococcus elongatus (strain PCC 7942) GN=dnaJ PE=3 SV=2 Back     alignment and function desciption
 Score = 45.8 bits (107), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 4/53 (7%)

Query: 9  LLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYL 61
          LLG P ++  + + +KAA+++   +CHPDL P  R+  AE +FK ISEAY  L
Sbjct: 10 LLGIPQSA--DQAAIKAAFRKLARQCHPDLNPGDRQ--AEERFKQISEAYEIL 58




Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Synechococcus elongatus (strain PCC 7942) (taxid: 1140)
>sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 Back     alignment and function description
>sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
224068695103 predicted protein [Populus trichocarpa] 0.958 0.669 0.768 8e-24
11848683773 unknown [Populus trichocarpa] 0.916 0.904 0.787 9e-23
449435144134 PREDICTED: uncharacterized protein LOC10 0.902 0.485 0.738 4e-20
357511509134 DnaJ [Medicago truncatula] gi|140055579| 0.888 0.477 0.734 4e-19
351726862135 uncharacterized protein LOC100527460 [Gl 0.847 0.451 0.754 1e-18
147818956 329 hypothetical protein VITISV_040169 [Viti 0.902 0.197 0.707 2e-18
297744101100 unnamed protein product [Vitis vinifera] 0.902 0.65 0.707 2e-18
297817566138 DNAJ heat shock N-terminal domain-contai 0.902 0.471 0.692 3e-18
15228699138 chaperone DnaJ domain-containing protein 0.902 0.471 0.692 4e-18
388506666133 unknown [Lotus japonicus] 0.902 0.488 0.692 5e-18
>gi|224068695|ref|XP_002302802.1| predicted protein [Populus trichocarpa] gi|222844528|gb|EEE82075.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/69 (76%), Positives = 58/69 (84%)

Query: 1  MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTY 60
          MQGDEA+VLLGFPPNSRP  SQVKAAY++KVWE HPDLFP+  K  AESKFKLISEAYTY
Sbjct: 1  MQGDEAKVLLGFPPNSRPTLSQVKAAYRKKVWESHPDLFPLHEKPGAESKFKLISEAYTY 60

Query: 61 LLSGNFHLF 69
          L +GN  L 
Sbjct: 61 LQTGNSSLL 69




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118486837|gb|ABK95253.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449435144|ref|XP_004135355.1| PREDICTED: uncharacterized protein LOC101221514 [Cucumis sativus] gi|449503297|ref|XP_004161932.1| PREDICTED: uncharacterized LOC101221514 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357511509|ref|XP_003626043.1| DnaJ [Medicago truncatula] gi|140055579|gb|ABO80934.1| Heat shock protein DnaJ, N-terminal [Medicago truncatula] gi|355501058|gb|AES82261.1| DnaJ [Medicago truncatula] gi|388514157|gb|AFK45140.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351726862|ref|NP_001236373.1| uncharacterized protein LOC100527460 [Glycine max] gi|255632404|gb|ACU16552.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147818956|emb|CAN67128.1| hypothetical protein VITISV_040169 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744101|emb|CBI37071.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297817566|ref|XP_002876666.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322504|gb|EFH52925.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228699|ref|NP_191778.1| chaperone DnaJ domain-containing protein [Arabidopsis thaliana] gi|6899929|emb|CAB71879.1| putative protein [Arabidopsis thaliana] gi|16648712|gb|AAL25548.1| AT3g62190/T17J13_150 [Arabidopsis thaliana] gi|22137248|gb|AAM91469.1| AT3g62190/T17J13_150 [Arabidopsis thaliana] gi|332646799|gb|AEE80320.1| chaperone DnaJ domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388506666|gb|AFK41399.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
TAIR|locus:2098043138 AT3G62190 [Arabidopsis thalian 0.902 0.471 0.692 9.2e-20
SGD|S000000850 391 CAJ1 "Nuclear type II J heat s 0.680 0.125 0.415 4.1e-05
TAIR|locus:2825170 331 AT1G59725 [Arabidopsis thalian 0.708 0.154 0.433 6.6e-05
UNIPROTKB|E2RLL7 222 SAMD13 "Uncharacterized protei 0.694 0.225 0.433 8.1e-05
TIGR_CMR|APH_0015 382 APH_0015 "chaperone protein Dn 0.527 0.099 0.55 0.00011
POMBASE|SPCC63.13 208 SPCC63.13 "DNAJ domain protein 0.694 0.240 0.415 0.00015
TAIR|locus:2012743 349 AT1G10350 [Arabidopsis thalian 0.638 0.131 0.446 0.00015
TAIR|locus:2097880 350 AT3G47940 [Arabidopsis thalian 0.652 0.134 0.468 0.0002
UNIPROTKB|Q5T657155 DNAJB5 "DnaJ homolog subfamily 0.75 0.348 0.372 0.00028
UNIPROTKB|Q74GD3 255 GSU0313 "DnaJ domain protein" 0.652 0.184 0.433 0.0004
TAIR|locus:2098043 AT3G62190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 235 (87.8 bits), Expect = 9.2e-20, P = 9.2e-20
 Identities = 45/65 (69%), Positives = 55/65 (84%)

Query:     1 MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTY 60
             M+ +EA++LLGFPPNSRP+ SQVKAAY++KVWE HPDLFP  +K  AESKFK ISEAY+ 
Sbjct:     1 MEVEEAKILLGFPPNSRPDPSQVKAAYRKKVWESHPDLFPDDQKLVAESKFKSISEAYSC 60

Query:    61 LLSGN 65
             L SG+
Sbjct:    61 LESGD 65




GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0048573 "photoperiodism, flowering" evidence=RCA
SGD|S000000850 CAJ1 "Nuclear type II J heat shock protein of the E. coli dnaJ family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2825170 AT1G59725 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLL7 SAMD13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0015 APH_0015 "chaperone protein DnaJ" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
POMBASE|SPCC63.13 SPCC63.13 "DNAJ domain protein" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2012743 AT1G10350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097880 AT3G47940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T657 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q74GD3 GSU0313 "DnaJ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00021919
hypothetical protein (103 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 4e-09
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-08
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 4e-08
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-08
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-08
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 9e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-06
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-06
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-06
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 7e-06
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-05
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 4e-05
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 4e-05
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-05
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 7e-05
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 1e-04
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-04
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-04
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-04
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-04
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 3e-04
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-04
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 4e-04
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 6e-04
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-04
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 0.001
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 0.001
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 0.001
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 0.002
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 0.003
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 0.003
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
 Score = 46.8 bits (112), Expect = 4e-09
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 9  LLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAY 58
          +LG P ++  +  ++K AY++   + HPD  P G K +AE KFK I+EAY
Sbjct: 6  ILGVPRDA--SLDEIKKAYRKLALKYHPDKNP-GDKEEAEEKFKEINEAY 52


Length = 60

>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 72
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.92
PRK14296 372 chaperone protein DnaJ; Provisional 99.9
PRK14288 369 chaperone protein DnaJ; Provisional 99.89
PRK14286 372 chaperone protein DnaJ; Provisional 99.89
PRK14279 392 chaperone protein DnaJ; Provisional 99.88
PRK14287 371 chaperone protein DnaJ; Provisional 99.87
PRK14282 369 chaperone protein DnaJ; Provisional 99.87
PRK14294 366 chaperone protein DnaJ; Provisional 99.87
PRK14301 373 chaperone protein DnaJ; Provisional 99.87
PRK14276 380 chaperone protein DnaJ; Provisional 99.87
PRK14299 291 chaperone protein DnaJ; Provisional 99.87
PRK14285 365 chaperone protein DnaJ; Provisional 99.87
PRK14297 380 chaperone protein DnaJ; Provisional 99.87
PRK14283 378 chaperone protein DnaJ; Provisional 99.86
PRK14280 376 chaperone protein DnaJ; Provisional 99.86
PRK14277 386 chaperone protein DnaJ; Provisional 99.86
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.86
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.86
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.86
PRK10767 371 chaperone protein DnaJ; Provisional 99.86
PRK14298 377 chaperone protein DnaJ; Provisional 99.86
PRK14295 389 chaperone protein DnaJ; Provisional 99.86
PRK14278 378 chaperone protein DnaJ; Provisional 99.85
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
PRK14281 397 chaperone protein DnaJ; Provisional 99.84
PRK14291 382 chaperone protein DnaJ; Provisional 99.84
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
PRK14289 386 chaperone protein DnaJ; Provisional 99.84
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.84
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.84
PRK14284 391 chaperone protein DnaJ; Provisional 99.84
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
PRK14290 365 chaperone protein DnaJ; Provisional 99.83
PRK14300 372 chaperone protein DnaJ; Provisional 99.82
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.82
PRK14293 374 chaperone protein DnaJ; Provisional 99.81
PRK14292 371 chaperone protein DnaJ; Provisional 99.81
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK00294173 hscB co-chaperone HscB; Provisional 99.79
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK05014171 hscB co-chaperone HscB; Provisional 99.78
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.78
PRK01356166 hscB co-chaperone HscB; Provisional 99.78
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
PRK03578176 hscB co-chaperone HscB; Provisional 99.77
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.74
PHA03102153 Small T antigen; Reviewed 99.72
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.72
PTZ00100116 DnaJ chaperone protein; Provisional 99.7
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.69
PRK01773173 hscB co-chaperone HscB; Provisional 99.68
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.62
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.62
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
PHA02624 647 large T antigen; Provisional 99.57
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.56
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.52
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.48
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 99.42
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.21
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 99.03
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 99.0
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.96
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 98.64
KOG0431453 consensus Auxilin-like protein and related protein 97.98
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.92
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 97.8
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.69
PF1344662 RPT: A repeated domain in UCH-protein 97.12
PF14687112 DUF4460: Domain of unknown function (DUF4460) 93.59
PF11833 194 DUF3353: Protein of unknown function (DUF3353); In 92.03
KOG0724 335 consensus Zuotin and related molecular chaperones 91.64
KOG3442132 consensus Uncharacterized conserved protein [Funct 89.34
COG555288 Uncharacterized conserved protein [Function unknow 88.04
PF1004178 DUF2277: Uncharacterized conserved protein (DUF227 85.37
PRK14102105 nifW nitrogenase stabilizing/protective protein; P 80.08
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=1.1e-27  Score=160.03  Aligned_cols=66  Identities=30%  Similarity=0.424  Sum_probs=62.1

Q ss_pred             CcccchhhhhCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHHHhcChhccchh
Q 035755            1 MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLFT   70 (72)
Q Consensus         1 ~~~~d~y~iLgl~~~~~~~~~~ik~~yr~l~~~~hPDk~~~~~~~~~~~~~~~i~~Ay~~L~d~~~R~~~   70 (72)
                      |..+|||+||||+.+|  |.+|||+|||+|+++||||+++.+  ++|+++|++|++||+|||||++|.-|
T Consensus         1 ~~~~dyYeiLGV~k~A--s~~EIKkAYRkLA~kyHPD~n~g~--~~AeeKFKEI~eAYEVLsD~eKRa~Y   66 (371)
T COG0484           1 MAKRDYYEILGVSKDA--SEEEIKKAYRKLAKKYHPDRNPGD--KEAEEKFKEINEAYEVLSDPEKRAAY   66 (371)
T ss_pred             CCccchhhhcCCCCCC--CHHHHHHHHHHHHHHhCCCCCCCC--HHHHHHHHHHHHHHHHhCCHHHHHHh
Confidence            6689999999999999  999999999999999999999964  89999999999999999999999544



>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3442 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5552 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10041 DUF2277: Uncharacterized conserved protein (DUF2277); InterPro: IPR018735 Members of this family of hypothetical bacterial proteins have no known function Back     alignment and domain information
>PRK14102 nifW nitrogenase stabilizing/protective protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-08
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-08
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 7e-08
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-07
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-07
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-07
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-07
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-07
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-07
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 6e-07
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 6e-07
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-07
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-06
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-06
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-06
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-06
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-06
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-06
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-06
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 4e-06
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 5e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 5e-06
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 6e-06
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 6e-06
2guz_A71 Mitochondrial import inner membrane translocase su 6e-06
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 6e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-06
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-05
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-05
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-05
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-05
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 1e-04
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 1e-04
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 9e-04
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
 Score = 45.7 bits (109), Expect = 1e-08
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 19 NASQ--VKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYL 61
           AS   +K AY++   + HPD  P   K +AE +FK ++EAY  L
Sbjct: 20 QASSEAIKKAYRKLALKWHPDKNP-ENKEEAERRFKQVAEAYEVL 63


>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.9
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.9
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.9
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.9
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.9
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.89
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.89
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.89
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.89
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.88
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.88
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.88
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.88
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.87
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.87
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.87
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.86
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.86
2guz_A71 Mitochondrial import inner membrane translocase su 99.85
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.85
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.85
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.84
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.83
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.83
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.82
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.82
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.81
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.8
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.78
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.75
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.71
2guz_B65 Mitochondrial import inner membrane translocase su 99.5
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.33
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 93.37
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=3.8e-24  Score=115.77  Aligned_cols=65  Identities=26%  Similarity=0.334  Sum_probs=59.4

Q ss_pred             CcccchhhhhCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHHHhcChhccch
Q 035755            1 MQGDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLF   69 (72)
Q Consensus         1 ~~~~d~y~iLgl~~~~~~~~~~ik~~yr~l~~~~hPDk~~~~~~~~~~~~~~~i~~Ay~~L~d~~~R~~   69 (72)
                      +...|+|+||||++++  +..+|+++|+++++++|||+++..  +.+.+.|+.|++||++|+||.+|.-
T Consensus         4 ~~~~~~y~iLgv~~~a--~~~~Ik~ayr~l~~~~HPD~~~~~--~~a~~~f~~i~~Ay~~L~d~~~R~~   68 (79)
T 2dn9_A            4 GSSGDYYQILGVPRNA--SQKEIKKAYYQLAKKYHPDTNKDD--PKAKEKFSQLAEAYEVLSDEVKRKQ   68 (79)
T ss_dssp             SCCSCHHHHHTCCTTC--CHHHHHHHHHHHHHHTCTTTCSSC--TTHHHHHHHHHHHHHHHHSHHHHHH
T ss_pred             CCCCCHHHHcCCCCCC--CHHHHHHHHHHHHHHHCcCCCCCC--HHHHHHHHHHHHHHHHHCCHHHHHH
Confidence            3568999999999999  999999999999999999999864  5788999999999999999998843



>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 72
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-06
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-05
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 0.001
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 0.003
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Murine polyomavirus [TaxId: 10634]
 Score = 39.6 bits (92), Expect = 1e-06
 Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 6/53 (11%)

Query: 9  LLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYL 61
          LL  P     +  +++ AYK++    HPD         + +  + ++  +   
Sbjct: 16 LLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGG------SHALMQELNSLWGTF 62


>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.92
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.89
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.88
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.88
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.86
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.83
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.8
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=6.2e-26  Score=121.03  Aligned_cols=63  Identities=30%  Similarity=0.424  Sum_probs=58.3

Q ss_pred             ccchhhhhCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHHHhcChhccch
Q 035755            3 GDEARVLLGFPPNSRPNASQVKAAYKRKVWECHPDLFPVGRKTDAESKFKLISEAYTYLLSGNFHLF   69 (72)
Q Consensus         3 ~~d~y~iLgl~~~~~~~~~~ik~~yr~l~~~~hPDk~~~~~~~~~~~~~~~i~~Ay~~L~d~~~R~~   69 (72)
                      .+|||+||||++++  |.++|+++|+++++++|||+++++  +.+++.|..|++||+||+||.+|..
T Consensus         2 k~dyY~vLgv~~~A--s~~eIk~aYr~l~~~~HPDk~~~~--~~~~~~f~~i~~Ay~vL~d~~~R~~   64 (75)
T d1xbla_           2 KQDYYEILGVSKTA--EEREIRKAYKRLAMKYHPDRNQGD--KEAEAKFKEIKEAYEVLTDSQKRAA   64 (75)
T ss_dssp             CCCTTTTTCCSSSC--CHHHHHHHHHHHHHHTCCTTCTTT--CHHHHHHHHHHHHHHHTTSSHHHHH
T ss_pred             CCCHHHHcCCCCCc--CHHHHHHHHHHHHhhhhhhccCCC--hHHHHHHHHHHHHHHhcCCHHHHHH
Confidence            47999999999999  999999999999999999999875  6788899999999999999998843



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure