Citrus Sinensis ID: 035790
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 13249030 | 635 | F-box containing protein TIR1 [Populus t | 0.843 | 0.262 | 0.844 | 2e-82 | |
| 224082031 | 635 | f-box family protein [Populus trichocarp | 0.843 | 0.262 | 0.844 | 5e-82 | |
| 359492916 | 601 | PREDICTED: transport inhibitor response | 0.838 | 0.276 | 0.862 | 1e-80 | |
| 302142027 | 552 | unnamed protein product [Vitis vinifera] | 0.838 | 0.300 | 0.862 | 1e-80 | |
| 224067017 | 635 | f-box family protein [Populus trichocarp | 0.843 | 0.262 | 0.820 | 6e-79 | |
| 255545892 | 635 | TRANSPORT INHIBITOR RESPONSE 1 protein, | 0.843 | 0.262 | 0.808 | 2e-77 | |
| 350535739 | 623 | LeTIR [Solanum lycopersicum] gi|26217414 | 0.843 | 0.268 | 0.804 | 1e-76 | |
| 449497026 | 637 | PREDICTED: transport inhibitor response | 0.843 | 0.262 | 0.775 | 2e-76 | |
| 449437292 | 623 | PREDICTED: transport inhibitor response | 0.843 | 0.268 | 0.775 | 3e-76 | |
| 356500748 | 630 | PREDICTED: transport inhibitor response | 0.848 | 0.266 | 0.773 | 6e-74 |
| >gi|13249030|gb|AAK16647.1|AF139835_1 F-box containing protein TIR1 [Populus tremula x Populus tremuloides] | Back alignment and taxonomy information |
|---|
Score = 310 bits (794), Expect = 2e-82, Method: Compositional matrix adjust.
Identities = 141/167 (84%), Positives = 157/167 (94%)
Query: 1 MGRHRPDHATGEPMDEGFGAIVRNCRKLTRLAVSGLLTDRAFGYIGKYGKLIRTLSVAFA 60
MGRH+PDH TGEPMDEGFGAIV+NC+KLTRLAVSGLLTDRAF YIGKYGK++RTLSVAFA
Sbjct: 469 MGRHQPDHVTGEPMDEGFGAIVKNCKKLTRLAVSGLLTDRAFAYIGKYGKIVRTLSVAFA 528
Query: 61 GDSDMGLKYVLEGCPKLQKLEIRDSPFGDAALRSGLHHYYNMRFLWMSSCRLTRQGCQEI 120
GDSDMGLKYVLEGCP+LQKLEIRDSPFGDAAL SGLHHYYNMRFLWMS+C+L+RQGCQ+I
Sbjct: 529 GDSDMGLKYVLEGCPRLQKLEIRDSPFGDAALLSGLHHYYNMRFLWMSACKLSRQGCQQI 588
Query: 121 AQAMPRLVVEVIRSDDEEETDNYVETLYMYRSLEGPRHDAPKFVTIL 167
QA+PRLVVEVI+ DD + D YV+TLYMYRSLEGPR DAP+FV+IL
Sbjct: 589 TQALPRLVVEVIKHDDNVDMDEYVDTLYMYRSLEGPRDDAPRFVSIL 635
|
Source: Populus tremula x Populus tremuloides Species: Populus tremula x Populus tremuloides Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224082031|ref|XP_002306554.1| f-box family protein [Populus trichocarpa] gi|222856003|gb|EEE93550.1| f-box family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359492916|ref|XP_002283927.2| PREDICTED: transport inhibitor response 1-like protein [Vitis vinifera] gi|147845617|emb|CAN80598.1| hypothetical protein VITISV_002642 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142027|emb|CBI19230.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224067017|ref|XP_002302328.1| f-box family protein [Populus trichocarpa] gi|222844054|gb|EEE81601.1| f-box family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255545892|ref|XP_002514006.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223547092|gb|EEF48589.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|350535739|ref|NP_001234722.1| LeTIR [Solanum lycopersicum] gi|262174141|gb|ACY26209.1| LeTIR [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|449497026|ref|XP_004160292.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437292|ref|XP_004136426.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356500748|ref|XP_003519193.1| PREDICTED: transport inhibitor response 1-like protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| UNIPROTKB|Q9AUH6 | 635 | TIR1 "F-box containing protein | 0.843 | 0.262 | 0.844 | 4.3e-77 | |
| UNIPROTKB|B9H6Y0 | 635 | FBL8 "F-box family protein" [P | 0.843 | 0.262 | 0.844 | 1.1e-76 | |
| UNIPROTKB|A5AZ08 | 601 | VITISV_002642 "Putative unchar | 0.838 | 0.276 | 0.862 | 3.9e-76 | |
| UNIPROTKB|B9GV20 | 635 | FBL7 "F-box family protein" [P | 0.843 | 0.262 | 0.820 | 3.1e-74 | |
| UNIPROTKB|B9RJT7 | 635 | RCOM_1038590 "TRANSPORT INHIBI | 0.843 | 0.262 | 0.808 | 7.5e-73 | |
| TAIR|locus:2158824 | 619 | AFB5 "AT5G49980" [Arabidopsis | 0.843 | 0.269 | 0.784 | 1.8e-71 | |
| TAIR|locus:2135942 | 623 | AFB4 "AT4G24390" [Arabidopsis | 0.843 | 0.268 | 0.736 | 1.1e-66 | |
| UNIPROTKB|A5C819 | 620 | VITISV_016565 "Putative unchar | 0.833 | 0.266 | 0.598 | 5.2e-49 | |
| UNIPROTKB|B9H216 | 579 | FBL5 "F-box family protein" [P | 0.833 | 0.284 | 0.592 | 1.1e-48 | |
| UNIPROTKB|B9HZ12 | 579 | FBL6 "F-box family protein" [P | 0.833 | 0.284 | 0.586 | 2.3e-48 |
| UNIPROTKB|Q9AUH6 TIR1 "F-box containing protein TIR1" [Populus tremula x Populus tremuloides (taxid:47664)] | Back alignment and assigned GO terms |
|---|
Score = 776 (278.2 bits), Expect = 4.3e-77, P = 4.3e-77
Identities = 141/167 (84%), Positives = 157/167 (94%)
Query: 1 MGRHRPDHATGEPMDEGFGAIVRNCRKLTRLAVSGLLTDRAFGYIGKYGKLIRTLSVAFA 60
MGRH+PDH TGEPMDEGFGAIV+NC+KLTRLAVSGLLTDRAF YIGKYGK++RTLSVAFA
Sbjct: 469 MGRHQPDHVTGEPMDEGFGAIVKNCKKLTRLAVSGLLTDRAFAYIGKYGKIVRTLSVAFA 528
Query: 61 GDSDMGLKYVLEGCPKLQKLEIRDSPFGDAALRSGLHHYYNMRFLWMSSCRLTRQGCQEI 120
GDSDMGLKYVLEGCP+LQKLEIRDSPFGDAAL SGLHHYYNMRFLWMS+C+L+RQGCQ+I
Sbjct: 529 GDSDMGLKYVLEGCPRLQKLEIRDSPFGDAALLSGLHHYYNMRFLWMSACKLSRQGCQQI 588
Query: 121 AQAMPRLVVEVIRSDDEEETDNYVETLYMYRSLEGPRHDAPKFVTIL 167
QA+PRLVVEVI+ DD + D YV+TLYMYRSLEGPR DAP+FV+IL
Sbjct: 589 TQALPRLVVEVIKHDDNVDMDEYVDTLYMYRSLEGPRDDAPRFVSIL 635
|
|
| UNIPROTKB|B9H6Y0 FBL8 "F-box family protein" [Populus trichocarpa (taxid:3694)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5AZ08 VITISV_002642 "Putative uncharacterized protein" [Vitis vinifera (taxid:29760)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9GV20 FBL7 "F-box family protein" [Populus trichocarpa (taxid:3694)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9RJT7 RCOM_1038590 "TRANSPORT INHIBITOR RESPONSE 1 protein, putative" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158824 AFB5 "AT5G49980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135942 AFB4 "AT4G24390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5C819 VITISV_016565 "Putative uncharacterized protein" [Vitis vinifera (taxid:29760)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9H216 FBL5 "F-box family protein" [Populus trichocarpa (taxid:3694)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9HZ12 FBL6 "F-box family protein" [Populus trichocarpa (taxid:3694)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 2e-04 |
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
Score = 40.8 bits (96), Expect = 2e-04
Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
Query: 75 PKLQKLEIRDSPFGDAALRS---GLHHYYNMRFLWMSSCRLTRQGCQEIAQAMPRL 127
L++L + ++ GDA +R+ GL N+ L +++ LT +G +A+ + L
Sbjct: 165 RDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASL 220
|
LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.47 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.47 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.45 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.29 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.21 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.11 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.0 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.8 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.47 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.22 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.18 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.16 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.16 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.1 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.97 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.89 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.84 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.82 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.74 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.7 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.59 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.54 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.38 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.17 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.99 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.96 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.9 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.8 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.61 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.56 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.52 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.16 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.07 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.04 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.96 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.75 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.71 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.39 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.29 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.13 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.11 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.89 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.89 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 94.71 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.7 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 94.65 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 94.53 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 93.68 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 93.46 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 93.44 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 93.2 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 93.03 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 91.35 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 90.02 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 89.71 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 89.63 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 88.92 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 88.74 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 88.43 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 88.33 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 87.02 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 86.75 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 86.13 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 84.98 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 84.22 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 84.19 | |
| KOG3735 | 353 | consensus Tropomodulin and leiomodulin [Cytoskelet | 82.19 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 82.17 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 81.74 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 81.69 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 80.8 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 80.32 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 80.18 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.47 E-value=2.5e-14 Score=128.12 Aligned_cols=168 Identities=20% Similarity=0.286 Sum_probs=115.1
Q ss_pred CCcHHHHHHHHhhCCCCceeEec--CCCCHHHHHHHHhcCCCCcEEEeeccCC-ChHHHHHHHhcCCCCceEEecCC-CC
Q 035790 12 EPMDEGFGAIVRNCRKLTRLAVS--GLLTDRAFGYIGKYGKLIRTLSVAFAGD-SDMGLKYVLEGCPKLQKLEIRDS-PF 87 (198)
Q Consensus 12 ~~~D~g~~ai~~~c~~L~~L~L~--g~lTD~~L~~I~~~~~~L~~L~L~~c~~-tD~gl~~i~~~C~~L~~L~L~~c-~~ 87 (198)
.+||..+..+++.|++|++|++. -.+||..|+++++.|++|++|++++|.. ++.|++.+.+||++|+++.+++| ..
T Consensus 176 ~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~ 255 (483)
T KOG4341|consen 176 KITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLEL 255 (483)
T ss_pred eccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccc
Confidence 57888999999999999999993 4569999999999999999999999988 88888888888877666655555 34
Q ss_pred C--------------------------hHHHHHHHhcCCCCcEEEeecee-cCHHHHHHHHHhCCCCcEEEecCCCCchh
Q 035790 88 G--------------------------DAALRSGLHHYYNMRFLWMSSCR-LTRQGCQEIAQAMPRLVVEVIRSDDEEET 140 (198)
Q Consensus 88 t--------------------------D~~l~~i~~~~~~L~~L~L~~c~-iTd~gl~~La~~~p~L~~~~i~~~~~~~~ 140 (198)
. |+++..+...|..|+.|..++|. ++|.-+.+|.+++++|++..+.++.- =
T Consensus 256 ~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~--f 333 (483)
T KOG4341|consen 256 ELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQ--F 333 (483)
T ss_pred cHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCchHHHHHHhcCCCceEEEeccccch--h
Confidence 4 44444444455555555555555 66666666666667776655554400 0
Q ss_pred HhHHHHHhHhhhccCCCCCCCCc-------ceeecccCCccccccccc
Q 035790 141 DNYVETLYMYRSLEGPRHDAPKF-------VTILRIIKPKLMLVQIKF 181 (198)
Q Consensus 141 ~~~~~~~~~y~sl~g~r~d~p~~-------v~~l~~~~~~~~~l~~~~ 181 (198)
.+.=.+.++|-+-.-+|.|.-+. +..+.+.|+.+..|-+|-
T Consensus 334 sd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslsh 381 (483)
T KOG4341|consen 334 SDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSH 381 (483)
T ss_pred hhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhh
Confidence 00112445555555666665543 444688899988888873
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 198 | ||||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 9e-39 | ||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 6e-19 |
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
|
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-56 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 7e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-49 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-09 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-07 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 8e-12 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-11 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 7e-09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-05 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 7e-06 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 4e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 9e-06 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 5e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 7e-04 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-04 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Score = 185 bits (471), Expect = 5e-56
Identities = 84/171 (49%), Positives = 111/171 (64%), Gaps = 3/171 (1%)
Query: 1 MGRHRPDHATGEPMDEGFGAIVRNCRKLTRLAVSGLLTDRAFGYIGKYGKLIRTLSVAFA 60
+ PD+ T EP+D GFGAIV +C+ L RL++SGLLTD+ F YIG Y K + LSVAFA
Sbjct: 407 IEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFA 466
Query: 61 GDSDMGLKYVLEGCPKLQKLEIRDSPFGDAALRSGLHHYYNMRFLWMSSCRLTRQGCQEI 120
GDSD+G+ +VL GC L+KLEIRD PFGD AL + MR LWMSSC ++ C+ +
Sbjct: 467 GDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLL 526
Query: 121 AQAMPRLVVEVIRSDDEEETDNY---VETLYMYRSLEGPRHDAPKFVTILR 168
Q MP+L VEVI ++ VE +++YR++ GPR D P FV +
Sbjct: 527 GQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMD 577
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.92 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.92 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.73 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.6 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.55 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.53 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.5 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.45 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.42 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.37 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.34 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.29 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.28 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.26 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.26 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.19 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 99.07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.97 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.9 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.73 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.7 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.67 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.64 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.57 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.54 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.5 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.48 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.41 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.36 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.34 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.32 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.32 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.14 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.13 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.11 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.09 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.02 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.02 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.96 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.95 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.95 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.93 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.93 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.92 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.91 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.91 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.9 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.89 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.89 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.88 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.87 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.86 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.86 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.85 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.85 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.84 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.8 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.8 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.79 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.79 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.76 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.76 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.75 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.74 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.73 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.72 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.72 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.7 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.69 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.69 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.65 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.65 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.63 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.63 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.63 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.62 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.61 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.61 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.61 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.6 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.59 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.59 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.59 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.59 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.58 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.58 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.58 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.56 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.54 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.54 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.52 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.49 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.49 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.49 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.45 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.44 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.43 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.43 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.42 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.42 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.4 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.38 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.36 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.36 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.35 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.35 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.35 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.3 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.27 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.27 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.25 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.25 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.24 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.23 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.23 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.22 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.21 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.2 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.19 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.16 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.16 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.16 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.11 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.07 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.03 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.01 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.94 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.92 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.91 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.88 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.73 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.66 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.64 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.63 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.53 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.52 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.46 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.12 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.02 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 95.91 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.89 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.61 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.39 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 94.76 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.71 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.01 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.18 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 88.69 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 87.0 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 82.77 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 81.34 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.92 E-value=3.4e-25 Score=201.45 Aligned_cols=172 Identities=49% Similarity=0.828 Sum_probs=151.7
Q ss_pred CCCCCCCCCCcHHHHHHHHhhCCCCceeEecCCCCHHHHHHHHhcCCCCcEEEeeccCCChHHHHHHHhcCCCCceEEec
Q 035790 4 HRPDHATGEPMDEGFGAIVRNCRKLTRLAVSGLLTDRAFGYIGKYGKLIRTLSVAFAGDSDMGLKYVLEGCPKLQKLEIR 83 (198)
Q Consensus 4 ~~~~~~t~~~~D~g~~ai~~~c~~L~~L~L~g~lTD~~L~~I~~~~~~L~~L~L~~c~~tD~gl~~i~~~C~~L~~L~L~ 83 (198)
+....+|+.+.|+|+.+++++|++|++|++++.++|.++..++..+++|++|+|++|..+|.|+..++.+|++|++|+|+
T Consensus 410 ~~~~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~l~~~~~~~l~~~~~~L~~L~L~~~~i~~~~~~~l~~~~~~L~~L~L~ 489 (594)
T 2p1m_B 410 KAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIR 489 (594)
T ss_dssp TCCCTTTCCCTHHHHHHHHHHCTTCCEEECCSSCCHHHHHHHHHHCTTCCEEEEESCCSSHHHHHHHHHHCTTCCEEEEE
T ss_pred CCcccccCCchhhHHHHHHhhCCCccEEeecCcccHHHHHHHHHhchhccEeeccCCCCcHHHHHHHHhcCCCcCEEECc
Confidence 34678899999999999999999999999988889999999999999999999999999999999999999999999999
Q ss_pred CCCCChHHHHHHHhcCCCCcEEEeeceecCHHHHHHHHHhCCCCcEEEecCCCC---chhHhHHHHHhHhhhccCCCCCC
Q 035790 84 DSPFGDAALRSGLHHYYNMRFLWMSSCRLTRQGCQEIAQAMPRLVVEVIRSDDE---EETDNYVETLYMYRSLEGPRHDA 160 (198)
Q Consensus 84 ~c~~tD~~l~~i~~~~~~L~~L~L~~c~iTd~gl~~La~~~p~L~~~~i~~~~~---~~~~~~~~~~~~y~sl~g~r~d~ 160 (198)
+|+++|.++..++.++++|++|++++|+++++|++.+++.+|+|+++++.+.+. .+..+.+++++.|++++|||.|+
T Consensus 490 ~n~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~lp~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 569 (594)
T 2p1m_B 490 DCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDM 569 (594)
T ss_dssp SCSCCHHHHHHTGGGGGGSSEEEEESSCCBHHHHHHHHHHCTTEEEEEECSSSCGGGSCTTSBCSEEEEEECSSCSCSCC
T ss_pred CCCCcHHHHHHHHHhCCCCCEEeeeCCCCCHHHHHHHHHhCCCCEEEEecCCCccccccccchhhhhhhhhccCCCCCCC
Confidence 999999999988889999999999999999999999999999999999987632 22445678999999999999999
Q ss_pred CCcceeecccCCccc
Q 035790 161 PKFVTILRIIKPKLM 175 (198)
Q Consensus 161 p~~v~~l~~~~~~~~ 175 (198)
|++|.+++|..+...
T Consensus 570 p~~~~~l~~~~~~~~ 584 (594)
T 2p1m_B 570 PGFVWNMDQDSTMRF 584 (594)
T ss_dssp CTTEEEC--------
T ss_pred CCceEeccCCCCCcc
Confidence 999999998876543
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 198 | ||||
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-04 |
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: 28-residue LRR domain: Ribonuclease inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Score = 45.4 bits (105), Expect = 2e-06
Identities = 15/77 (19%), Positives = 28/77 (36%), Gaps = 3/77 (3%)
Query: 52 IRTLSVAFAGDSDMGLKYVLEGCPKLQKLEIRDSPFGDA---ALRSGLHHYYNMRFLWMS 108
I++L + SD +L + Q + + D +A + S L + L +
Sbjct: 4 IQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLR 63
Query: 109 SCRLTRQGCQEIAQAMP 125
S L G + Q +
Sbjct: 64 SNELGDVGVHCVLQGLQ 80
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.76 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.68 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.34 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.29 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.26 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.22 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.22 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.11 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.06 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.03 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.32 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.27 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.19 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.17 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.05 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.92 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.76 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.61 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.47 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.47 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.42 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.35 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.33 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.32 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.29 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.29 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.91 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.89 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.73 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.3 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.29 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.11 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.86 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.77 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 95.41 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.2 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.83 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 94.49 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.77 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 92.75 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 92.13 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 89.83 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76 E-value=5.7e-18 Score=141.47 Aligned_cols=168 Identities=19% Similarity=0.234 Sum_probs=130.9
Q ss_pred CcHHHHHHHHhhCCCCceeEecC-CCCHHHHHHHHhcCCCCcEEEeeccCC-ChHHHHHHHhcCCCCceEEecCC-CCCh
Q 035790 13 PMDEGFGAIVRNCRKLTRLAVSG-LLTDRAFGYIGKYGKLIRTLSVAFAGD-SDMGLKYVLEGCPKLQKLEIRDS-PFGD 89 (198)
Q Consensus 13 ~~D~g~~ai~~~c~~L~~L~L~g-~lTD~~L~~I~~~~~~L~~L~L~~c~~-tD~gl~~i~~~C~~L~~L~L~~c-~~tD 89 (198)
++++++.+++.+|++|++|++++ .++|..+..|++ +++|+.|++++|.. +|.|+..++++|++|++|++++| .++|
T Consensus 58 i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~ 136 (284)
T d2astb2 58 IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTE 136 (284)
T ss_dssp ECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCH
T ss_pred cCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHHhcccccccccccccc
Confidence 56789999999999999999966 469999999984 89999999999977 99999999999999999999999 6999
Q ss_pred HHHHHHH-hcCCCCcEEEeecee--cCHHHHHHHHHhCCCCcEEEecCCC-Cc-hhHhHHHHHhHhhh--ccCCCCCCCC
Q 035790 90 AALRSGL-HHYYNMRFLWMSSCR--LTRQGCQEIAQAMPRLVVEVIRSDD-EE-ETDNYVETLYMYRS--LEGPRHDAPK 162 (198)
Q Consensus 90 ~~l~~i~-~~~~~L~~L~L~~c~--iTd~gl~~La~~~p~L~~~~i~~~~-~~-~~~~~~~~~~~y~s--l~g~r~d~p~ 162 (198)
+++..++ ..+++|++|++++|. +++.++..++..||+|+...+.++. .+ .......++...+. |++-....+.
T Consensus 137 ~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~ 216 (284)
T d2astb2 137 KHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPE 216 (284)
T ss_dssp HHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGG
T ss_pred ccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCCEEECCCCCCCChH
Confidence 9987654 567899999999984 9999999999999999988887652 21 22223344433333 3443344444
Q ss_pred cceeecccCCcccccccccC
Q 035790 163 FVTILRIIKPKLMLVQIKFA 182 (198)
Q Consensus 163 ~v~~l~~~~~~~~~l~~~~~ 182 (198)
.+..| ..|++|..|+++-.
T Consensus 217 ~l~~L-~~~~~L~~L~l~~~ 235 (284)
T d2astb2 217 TLLEL-GEIPTLKTLQVFGI 235 (284)
T ss_dssp GGGGG-GGCTTCCEEECTTS
T ss_pred HHHHH-hcCCCCCEEeeeCC
Confidence 44444 34677888877654
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|