Citrus Sinensis ID: 035975
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 685 | ||||||
| 343887318 | 827 | hypothetical protein [Citrus unshiu] | 1.0 | 0.828 | 0.917 | 0.0 | |
| 296081706 | 795 | unnamed protein product [Vitis vinifera] | 0.927 | 0.798 | 0.461 | 1e-149 | |
| 359475970 | 577 | PREDICTED: uncharacterized protein LOC10 | 0.639 | 0.759 | 0.484 | 1e-103 | |
| 449453057 | 724 | PREDICTED: uncharacterized protein LOC10 | 0.849 | 0.803 | 0.317 | 2e-64 | |
| 449489392 | 735 | PREDICTED: uncharacterized LOC101204547 | 0.846 | 0.789 | 0.309 | 9e-61 | |
| 357151568 | 886 | PREDICTED: uncharacterized protein LOC10 | 0.725 | 0.560 | 0.299 | 2e-49 | |
| 168039363 | 784 | predicted protein [Physcomitrella patens | 0.443 | 0.387 | 0.336 | 4e-36 | |
| 168027868 | 306 | predicted protein [Physcomitrella patens | 0.154 | 0.346 | 0.504 | 2e-23 | |
| 359476274 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.242 | 0.751 | 0.363 | 6e-17 | |
| 440794050 | 983 | DWNN domain containing protein [Acantham | 0.102 | 0.071 | 0.4 | 6e-12 |
| >gi|343887318|dbj|BAK61864.1| hypothetical protein [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 1386 bits (3587), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 681/742 (91%), Positives = 681/742 (91%), Gaps = 57/742 (7%)
Query: 1 ACSGSFVNIAIKKTNEVKPSQPKIEEINFDDFGVDLCPALNGNLSCSDVDDVDKNICVGS 60
ACSGSFVNIAIKKTNEVKPSQPKIEEINFDDFGVDLCPALNGNLSCSDVDDVDKNICVGS
Sbjct: 86 ACSGSFVNIAIKKTNEVKPSQPKIEEINFDDFGVDLCPALNGNLSCSDVDDVDKNICVGS 145
Query: 61 ERENIDTTRTSEPHNTGCQKLEASNVNEAIRRGAVHSRIEEDLLQTESKSDVPQFMKLEL 120
ERENIDTTRTSEPHNTGCQKLEASNVNEAIRRGAVHSRIEEDLLQTESKSDVPQFMKLEL
Sbjct: 146 ERENIDTTRTSEPHNTGCQKLEASNVNEAIRRGAVHSRIEEDLLQTESKSDVPQFMKLEL 205
Query: 121 VIKTNASAMENGNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVEKARCPKCFS 180
VIKTNASAMENGNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVL EKARCPKCFS
Sbjct: 206 VIKTNASAMENGNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLAEKARCPKCFS 265
Query: 181 SKCRLEDLLPNVSLRQAIEHFLESQILISGSENAYHRYAPDGESGIQAKDVSCAVTNLQR 240
SKCRLEDLLPNVSLRQAIEHFLESQILISGSENAYHRYAPDGESGIQAKDVSCAVTNLQR
Sbjct: 266 SKCRLEDLLPNVSLRQAIEHFLESQILISGSENAYHRYAPDGESGIQAKDVSCAVTNLQR 325
Query: 241 EPELADSPSATGRGSNQIVADCDSVIRNNTGSCVNHLGADNSLKSCTLPYKVKQIDAEVH 300
EPELADSPSATGRGSNQIVADCDSVIRNNTGSCVNHLGADN LKSCTLPYKVKQIDAEVH
Sbjct: 326 EPELADSPSATGRGSNQIVADCDSVIRNNTGSCVNHLGADNLLKSCTLPYKVKQIDAEVH 385
Query: 301 GSAQPVDFKRRPVDLDEFAECHGESQPIHVEAEFSNKRKRGLWVDTSGADKSFIESGRNR 360
GSAQPVDFKRRPVDLDEFAECHGESQPIHVEAEFSNKRKRGLWVDTSGADKSFIESGRNR
Sbjct: 386 GSAQPVDFKRRPVDLDEFAECHGESQPIHVEAEFSNKRKRGLWVDTSGADKSFIESGRNR 445
Query: 361 K------DRTCYMCGSPNHLIRDCPAALSPNPMLQQ------GALRGHAPPFWNGPSLAH 408
K DRTCYMCGSPNHLIRDCPAALSPNPMLQQ GALRGHAPPFWNGPSLAH
Sbjct: 446 KLSCPHQDRTCYMCGSPNHLIRDCPAALSPNPMLQQGNAFFAGALRGHAPPFWNGPSLAH 505
Query: 409 VRPIANIYGNHGMMPFNATMAPTTQFAVPAYMPSMFGGIPAYGFDMEASCSGYTMMGGPR 468
VRPIANIYGNHGMMPFN TMAPTTQFAVPAYMPSMFGGIPAYGFDMEASCSGYTMMGGPR
Sbjct: 506 VRPIANIYGNHGMMPFNTTMAPTTQFAVPAYMPSMFGGIPAYGFDMEASCSGYTMMGGPR 565
Query: 469 TPVGVNAGRLGRSRVLHHQDCEKKQKLSNINMSEQSYDDDEDENVNIKHRYDEAERLHDK 528
TPVGVNAGRLGRSRVLHHQDCEKKQKLSNINMSEQSYDDDEDENVNIKHRYDEAER HDK
Sbjct: 566 TPVGVNAGRLGRSRVLHHQDCEKKQKLSNINMSEQSYDDDEDENVNIKHRYDEAERSHDK 625
Query: 529 KSHFSKE---------------------------------------------RERRPCYQ 543
KSHFSKE RERRPCYQ
Sbjct: 626 KSHFSKERSVSFSEGSFTHRSHKRHWCYSNLDDDRHSFDKKYKKNSSSSYPYRERRPCYQ 685
Query: 544 LSEVEDMPSSSSWHGDERHKKHSRQSKKHNEREQFHSDSSWSRHAVKEKDGERKKLKSDV 603
LSEVEDMPSSSSWHGDERHKKHSRQSKKHNEREQFHSDSSWSRHAVKEKDGERKKLKSDV
Sbjct: 686 LSEVEDMPSSSSWHGDERHKKHSRQSKKHNEREQFHSDSSWSRHAVKEKDGERKKLKSDV 745
Query: 604 KRHSHKPDSCSESGLEPSYSSDRKKKQKEKDLSHGSRHSRHKSKSMDDEPSHDRWLMVKG 663
KRHSHKPDSCSESGLEPSYSSDRKKKQKEKDLSHGSRHSRHKSKSMDDEPSHDRWLMVKG
Sbjct: 746 KRHSHKPDSCSESGLEPSYSSDRKKKQKEKDLSHGSRHSRHKSKSMDDEPSHDRWLMVKG 805
Query: 664 SDEDHGEDYRYSERKSGYIKYS 685
SDEDHGEDYRYSERKSGYIKYS
Sbjct: 806 SDEDHGEDYRYSERKSGYIKYS 827
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296081706|emb|CBI20711.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359475970|ref|XP_002279816.2| PREDICTED: uncharacterized protein LOC100252571 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449453057|ref|XP_004144275.1| PREDICTED: uncharacterized protein LOC101204547 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449489392|ref|XP_004158298.1| PREDICTED: uncharacterized LOC101204547 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357151568|ref|XP_003575832.1| PREDICTED: uncharacterized protein LOC100839326 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|168039363|ref|XP_001772167.1| predicted protein [Physcomitrella patens subsp. patens] gi|162676498|gb|EDQ62980.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|168027868|ref|XP_001766451.1| predicted protein [Physcomitrella patens subsp. patens] gi|162682360|gb|EDQ68779.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|359476274|ref|XP_003631810.1| PREDICTED: uncharacterized protein LOC100854580 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|440794050|gb|ELR15221.1| DWNN domain containing protein [Acanthamoeba castellanii str. Neff] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 685 | ||||||
| UNIPROTKB|E1C4G3 | 922 | E1C4G3 "Uncharacterized protei | 0.129 | 0.096 | 0.357 | 1.1e-11 | |
| ZFIN|ZDB-GENE-040930-5 | 1741 | rbbp6 "retinoblastoma binding | 0.112 | 0.044 | 0.405 | 2e-11 | |
| UNIPROTKB|J9P0A5 | 1795 | RBBP6 "Uncharacterized protein | 0.129 | 0.049 | 0.357 | 2.6e-11 | |
| UNIPROTKB|Q7Z6E9 | 1792 | RBBP6 "E3 ubiquitin-protein li | 0.129 | 0.049 | 0.357 | 5.7e-11 | |
| MGI|MGI:894835 | 1790 | Rbbp6 "retinoblastoma binding | 0.129 | 0.049 | 0.357 | 6.6e-11 | |
| UNIPROTKB|F1M6Y5 | 1755 | Rbbp6 "Protein Rbbp6" [Rattus | 0.129 | 0.050 | 0.357 | 2.1e-10 | |
| UNIPROTKB|G3V953 | 1789 | Rbbp6 "Retinoblastoma binding | 0.129 | 0.049 | 0.357 | 2.2e-10 | |
| UNIPROTKB|F1RFD8 | 1728 | RBBP6 "Uncharacterized protein | 0.129 | 0.051 | 0.357 | 2.2e-09 | |
| TAIR|locus:2171569 | 892 | AT5G47430 [Arabidopsis thalian | 0.194 | 0.149 | 0.335 | 3.4e-09 | |
| FB|FBgn0086129 | 1231 | snama "something that sticks l | 0.108 | 0.060 | 0.407 | 6.1e-09 |
| UNIPROTKB|E1C4G3 E1C4G3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 170 (64.9 bits), Expect = 1.1e-11, Sum P(2) = 1.1e-11
Identities = 34/95 (35%), Positives = 54/95 (56%)
Query: 109 KSDVPQFMKLELVIKTNASAMENGNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLV 168
K + P F+ E ++S+ E+ P EL C +C + +AV+IPCC +S+C++CIR
Sbjct: 232 KKEKPPFLPEE----PSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTA 287
Query: 169 LVEKAR--CPKCFSSKCRLEDLLPNVSLRQAIEHF 201
L+E CP C + + L+ N LRQA+ +F
Sbjct: 288 LLESEEHTCPTCHQTDVSPDALIANKFLRQAVNNF 322
|
|
| ZFIN|ZDB-GENE-040930-5 rbbp6 "retinoblastoma binding protein 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P0A5 RBBP6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z6E9 RBBP6 "E3 ubiquitin-protein ligase RBBP6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:894835 Rbbp6 "retinoblastoma binding protein 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M6Y5 Rbbp6 "Protein Rbbp6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V953 Rbbp6 "Retinoblastoma binding protein 6, isoform CRA_a" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFD8 RBBP6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171569 AT5G47430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0086129 snama "something that sticks like glue" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| BRADI4G13220.1 | annotation not avaliable (790 aa) | |||||||
(Brachypodium distachyon) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 685 | |||
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 2e-08 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-08 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 9e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-05 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 7e-05 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 4e-04 | |
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 9e-04 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 0.003 |
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Score = 56.7 bits (136), Expect = 2e-08
Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
Query: 138 LKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVEK-ARCPKCFSSKCRLEDLLPNVSLRQ 196
LKC LC+ L + + PCC H+FC++CI L++ +CP C L+ L P++ +
Sbjct: 275 LKCPLCHCLLRNPMKTPCCGHTFCDECIGTALLDSDFKCPNCSRKDVLLDGLTPDIDKKL 334
Query: 197 AIEHFLESQILISGS 211
+E L+ Q G+
Sbjct: 335 EVEKALKKQRKKVGT 349
|
Length = 427 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 685 | |||
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 99.32 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.13 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.1 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.05 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.99 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.98 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.88 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.73 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.67 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.63 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.62 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.59 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.51 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.45 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.43 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.41 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.4 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.29 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.25 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.23 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.15 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.13 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.13 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.09 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.09 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.08 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.95 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.74 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.73 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.66 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.55 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.53 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.37 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.25 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 97.25 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.19 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.17 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.16 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.88 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.81 | |
| PF13696 | 32 | zf-CCHC_2: Zinc knuckle | 96.79 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 95.98 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.74 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.46 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.34 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.78 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.67 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 94.58 | |
| COG5180 | 654 | PBP1 Protein interacting with poly(A)-binding prot | 94.5 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.17 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.95 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 93.77 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.6 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.99 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.72 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.49 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 92.48 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 92.21 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 91.98 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 91.77 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 91.31 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 91.19 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.93 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 90.77 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 90.69 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.04 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 89.12 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.44 | |
| smart00343 | 26 | ZnF_C2HC zinc finger. | 88.07 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 88.01 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 87.87 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 87.17 | |
| KOG0314 | 448 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.45 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 85.12 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 84.85 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 84.56 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 84.53 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 84.34 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 83.61 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 83.61 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 83.34 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 83.21 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.9 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.58 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 80.38 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.21 |
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.32 E-value=1e-12 Score=136.89 Aligned_cols=131 Identities=26% Similarity=0.527 Sum_probs=99.8
Q ss_pred cCccCCCCCCCccccccccchHHHHhcccccchhhhhhhhccCCCChhhhHhHHHHHhhccccc------ccCCCCCccc
Q 035975 66 DTTRTSEPHNTGCQKLEASNVNEAIRRGAVHSRIEEDLLQTESKSDVPQFMKLELVIKTNASAM------ENGNFPSELK 139 (685)
Q Consensus 66 RvkRSSgip~S~lqkVessdleeAl~~givV~kvd~~a~~tksqPd~qe~kk~E~~~ss~asa~------~~e~LeeeLt 139 (685)
|+.|+||||+.|+..|+..... ....+++ ..++..+ ..+|+.++|++++...++.+... ...+| .|.
T Consensus 204 RirrttGIPk~FLk~ve~p~e~--~~a~imi-t~EG~yV--v~qpdvqsWe~Yq~r~~a~~~~~Dqv~k~~~~~i--~Lk 276 (427)
T COG5222 204 RIRRTTGIPKDFLKPVEGPNEP--SNAAIMI-TPEGGYV--VAQPDVQSWEKYQQRTKAVAEIPDQVYKMQPPNI--SLK 276 (427)
T ss_pred eeeccCCCCHHhcccccCCCcc--cccceEE-cCCCCeE--EeccchHHHHHHHHHHHhhhhCchhhhccCCCCc--ccc
Confidence 7899999999999999975443 1233444 4444444 57899999999988665533210 01122 399
Q ss_pred ccccccccccceeccCCCCccchhHHHHHhhc-CCCCCCCcCCCccccCCCccHHHHHHHHHHHh
Q 035975 140 CSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVE-KARCPKCFSSKCRLEDLLPNVSLRQAIEHFLE 203 (685)
Q Consensus 140 CPIClelf~dPVtLpCCGHSFC~~CI~~~lk~-~~sCPvCR~~~~~~~~L~pN~~L~nLVe~~re 203 (685)
||+|..++.+|+.|+||+|+||..||...+.. .+.||.|...-...+.|.+++....-|+.+++
T Consensus 277 Cplc~~Llrnp~kT~cC~~~fc~eci~~al~dsDf~CpnC~rkdvlld~l~pD~dk~~EvE~~lk 341 (427)
T COG5222 277 CPLCHCLLRNPMKTPCCGHTFCDECIGTALLDSDFKCPNCSRKDVLLDGLTPDIDKKLEVEKALK 341 (427)
T ss_pred CcchhhhhhCcccCccccchHHHHHHhhhhhhccccCCCcccccchhhccCccHHHHHHHHHHHH
Confidence 99999999999999999999999999977765 48999999877778899998888777777655
|
|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13696 zf-CCHC_2: Zinc knuckle | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5180 PBP1 Protein interacting with poly(A)-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00343 ZnF_C2HC zinc finger | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 685 | ||||
| 3ztg_A | 92 | Solution Structure Of The Ring Finger-Like Domain O | 3e-09 | ||
| 2yur_A | 74 | Solution Structure Of The Ring Finger Of Human Reti | 7e-07 | ||
| 2y43_A | 99 | Rad18 Ubiquitin Ligase Ring Domain Structure Length | 2e-05 |
| >pdb|3ZTG|A Chain A, Solution Structure Of The Ring Finger-Like Domain Of Retinoblastoma Binding Protein-6 (Rbbp6) Length = 92 | Back alignment and structure |
|
| >pdb|2YUR|A Chain A, Solution Structure Of The Ring Finger Of Human Retinoblastoma-Binding Protein 6 Length = 74 | Back alignment and structure |
| >pdb|2Y43|A Chain A, Rad18 Ubiquitin Ligase Ring Domain Structure Length = 99 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 685 | |||
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 5e-23 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 1e-18 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 5e-17 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 6e-15 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-13 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 3e-12 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 5e-12 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 7e-12 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 1e-11 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 2e-11 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 4e-11 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 6e-11 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 1e-10 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 2e-10 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 2e-10 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-09 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 1e-09 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 1e-09 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 2e-09 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 4e-09 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 7e-09 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 8e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-08 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 4e-08 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 5e-08 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 5e-08 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 6e-08 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 8e-08 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 1e-07 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 6e-07 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-06 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 1e-06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 1e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-06 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 2e-06 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 2e-06 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 4e-06 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 5e-06 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 3e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 4e-05 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 5e-05 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 1e-04 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 6e-04 |
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
Score = 92.5 bits (230), Expect = 5e-23
Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
Query: 127 SAMENGNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVEKAR--CPKCFSSKCR 184
E+ P EL C +C + +AV+IPCC +S+C++CIR L+E CP C +
Sbjct: 3 LGSEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVS 62
Query: 185 LEDLLPNVSLRQAIEHFLESQ 205
+ L+ N LRQA+ +F
Sbjct: 63 PDALIANKFLRQAVNNFKNET 83
|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 685 | |||
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.56 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.47 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.47 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.45 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.45 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.36 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.35 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.35 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.33 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.31 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.3 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.29 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.29 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.28 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.27 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.27 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.27 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.26 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.24 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.24 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.23 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.21 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.19 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.16 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.14 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.14 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.13 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.12 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.11 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.1 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.05 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.03 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.03 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.02 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.01 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.0 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.0 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.92 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.91 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.91 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.91 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.86 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.85 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.84 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.82 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.8 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.79 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.78 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.77 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.75 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.72 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.69 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.59 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.54 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.52 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.5 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.44 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.43 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.38 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.34 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.31 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.29 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.27 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.16 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.16 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.83 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.73 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 97.15 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 97.13 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 96.74 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.49 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.82 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 95.43 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 95.41 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 95.04 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 94.89 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 94.37 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 94.34 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 94.12 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 94.1 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 94.09 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 94.07 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 93.58 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 93.56 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 93.41 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 93.33 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 93.28 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 93.26 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 93.14 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 93.05 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 92.99 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 92.36 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 92.33 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 92.32 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 91.85 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 91.85 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 90.31 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 89.76 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 88.56 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 84.7 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 82.72 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 82.39 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 81.05 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 80.13 |
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.56 E-value=4e-15 Score=126.90 Aligned_cols=76 Identities=38% Similarity=0.908 Sum_probs=66.7
Q ss_pred ccCCCCCcccccccccccccceeccCCCCccchhHHHHHhhcC--CCCCCCcCCCccccCCCccHHHHHHHHHHHhhc
Q 035975 130 ENGNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVEK--ARCPKCFSSKCRLEDLLPNVSLRQAIEHFLESQ 205 (685)
Q Consensus 130 ~~e~LeeeLtCPIClelf~dPVtLpCCGHSFC~~CI~~~lk~~--~sCPvCR~~~~~~~~L~pN~~L~nLVe~~redq 205 (685)
..+.+.++++|+||+++|.+|++++||||+||..||..|+... ..||+||..+.....+.+|..|.++|+.++...
T Consensus 6 ~~~~~~~~~~C~IC~~~~~~p~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~~~~ 83 (92)
T 3ztg_A 6 EDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNET 83 (92)
T ss_dssp SCCCCCTTTEETTTTEECSSCEECTTTCCEECHHHHHHHHHHCTTCCCTTTCCSSCCTTSCEECHHHHHHHHHHHHHH
T ss_pred ccccCCcCCCCCCCChhhcCceECCCCCCHHHHHHHHHHHHhcCCCcCcCCCCcCCCccccCcCHHHHHHHHHHHHHH
Confidence 3467888999999999999999999459999999999999754 589999986556789999999999999998754
|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 685 | ||||
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-11 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-09 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 4e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 5e-08 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 1e-07 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 8e-07 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 9e-07 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-06 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 2e-05 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-05 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.001 |
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: E3 ubiquitin ligase PUB14 species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 58.6 bits (141), Expect = 1e-11
Identities = 14/70 (20%), Positives = 25/70 (35%), Gaps = 1/70 (1%)
Query: 135 PSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVEKARCPKCFSSKCRLEDLLPNVSL 194
P +C + L K+ V++ ++ I+ L + L PN L
Sbjct: 6 PEYFRCPISLELMKDPVIVSTG-QTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVL 64
Query: 195 RQAIEHFLES 204
+ I + ES
Sbjct: 65 KSLIALWCES 74
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 685 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.5 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.47 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.46 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.35 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.32 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.23 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.12 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.88 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.86 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.79 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.73 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.47 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.36 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.08 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.91 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.5 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 94.81 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 91.13 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 89.02 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 85.83 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.50 E-value=9.2e-15 Score=121.79 Aligned_cols=73 Identities=22% Similarity=0.320 Sum_probs=64.4
Q ss_pred CCCCCcccccccccccccceeccCCCCccchhHHHHHhhcC-CCCCCCcCCCccccCCCccHHHHHHHHHHHhhcc
Q 035975 132 GNFPSELKCSLCNTLFKEAVMIPCCQHSFCEKCIRLVLVEK-ARCPKCFSSKCRLEDLLPNVSLRQAIEHFLESQI 206 (685)
Q Consensus 132 e~LeeeLtCPIClelf~dPVtLpCCGHSFC~~CI~~~lk~~-~sCPvCR~~~~~~~~L~pN~~L~nLVe~~redq~ 206 (685)
.+++++|.||||+++|.+||+++| ||+||+.||..|+... ..||.|+. ......+.+|..|+++|+.|++...
T Consensus 2 ~eiP~~l~CpIc~~l~~dPv~~~c-Ghtfc~~ci~~~l~~~~~~cP~c~~-~l~~~~l~pN~~L~~~I~~~l~~~~ 75 (80)
T d2c2la2 2 RDIPDYLCGKISFELMREPCITPS-GITYDRKDIEEHLQRVGHFNPVTRS-PLTQEQLIPNLAMKEVIDAFISENG 75 (80)
T ss_dssp CCCCSTTBCTTTCSBCSSEEECSS-CCEEETTHHHHHHHHTCSSCTTTCC-CCCGGGCEECHHHHHHHHHHHTTCS
T ss_pred CCCCccccCcCcCchhhhhcccCC-cCeecHHHHHHHHhcCCccCCCccc-cccccccccHHHHHHHHHHHHHHCC
Confidence 357899999999999999999998 9999999999999754 57999997 4567789999999999999987643
|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|