Citrus Sinensis ID: 036006


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEFM
cccccccEEEEcccccEEEEcccccccccccccccEEEEEcccccccccccccccccccccccEEEEEccccccEEEEEccccccccccccccccEEEccccccccEEccccccccccccccEEEEccccccc
cccccHcEEEEEEEcHHHHHccccccccccccccEEEEEEccHcHHHcccHHHHHHHHHHHHcEEEEccHHHHHHEEEcccccccccEEEcccccEEEEcccHcHHHHcccccccEccccHcEEEEEcccccc
valpklenlelRSINVERIWQNQVSALSCGVQNLIHLTLYkcrnlrclfsssilsnsIFVRLQHLeiwgcpvleEIIIVDqekrnnnivmfpqlqylkmydlkkltsfctrdvhiikfpslrklwisrcpefm
valpklenlelRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRdvhiikfpslrklwisrcpefm
VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRClfsssilsnsifVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEFM
********LELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRC****
VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEII***********VMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEFM
VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEFM
VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEFM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEFM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
Q9SH22884 Probable disease resistan yes no 0.857 0.128 0.266 5e-05
Q9SI85893 Probable disease resistan no no 0.879 0.131 0.300 6e-05
Q42484909 Disease resistance protei no no 0.842 0.123 0.303 0.0007
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function desciption
 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 67/135 (49%), Gaps = 21/135 (15%)

Query: 1   VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFV 60
           V+  KL   +++S ++  I    +    C   +L+ + ++ C  LR       L+  IF 
Sbjct: 712 VSTDKLREFQIKSCSISEIKMGGI----CNFLSLVDVNIFNCEGLR------ELTFLIFA 761

Query: 61  -RLQHLEIWGCPVLEEIIIVDQ--EKRNNNIVMFPQLQYLKMYDLKKLTS--------FC 109
            +++ L +W    LE+II  ++  E   + I+ FP+L +L ++DL KL           C
Sbjct: 762 PKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLC 821

Query: 110 TRDVHIIKFPSLRKL 124
             +++I + P+LRKL
Sbjct: 822 LEEINIRECPNLRKL 836




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
255563252 1603 Disease resistance protein RPS5, putativ 0.909 0.075 0.415 1e-16
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.962 0.054 0.368 5e-16
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.962 0.097 0.373 4e-14
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.969 0.052 0.388 6e-14
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.962 0.095 0.350 3e-13
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.962 0.095 0.358 5e-13
224111304 474 predicted protein [Populus trichocarpa] 0.962 0.270 0.343 6e-13
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.962 0.111 0.385 1e-12
224103171 305 predicted protein [Populus trichocarpa] 0.962 0.419 0.385 2e-12
357456329 1280 Cc-nbs resistance protein [Medicago trun 0.977 0.101 0.335 2e-10
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 83/130 (63%), Gaps = 9/130 (6%)

Query: 3    LPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRL 62
             P LENLEL SI  E+I  +Q+SA+S    NL+ L + +C NL+ LF+SS++ N +   L
Sbjct: 947  FPNLENLELSSIACEKICDDQLSAIS---SNLMSLIVERCWNLKYLFTSSLVKNLLL--L 1001

Query: 63   QHLEIWGCPVLEEIIIVDQ--EKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPS 120
            + LE++ C  +E II+ ++  E+  N   +FP+L +LK+ +L  +T FC  D + ++F S
Sbjct: 1002 KRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFC--DGYPVEFSS 1059

Query: 121  LRKLWISRCP 130
            LRKL I  CP
Sbjct: 1060 LRKLLIENCP 1069




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111304|ref|XP_002332954.1| predicted protein [Populus trichocarpa] gi|222834266|gb|EEE72743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103171|ref|XP_002334081.1| predicted protein [Populus trichocarpa] gi|222869602|gb|EEF06733.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357456329|ref|XP_003598445.1| Cc-nbs resistance protein [Medicago truncatula] gi|355487493|gb|AES68696.1| Cc-nbs resistance protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.887 0.132 0.280 5.1e-06
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.864 0.130 0.246 8.2e-06
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.887 0.129 0.279 8.5e-06
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.473 0.071 0.357 8.4e-05
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 118 (46.6 bits), Expect = 5.1e-06, P = 5.1e-06
 Identities = 37/132 (28%), Positives = 60/132 (45%)

Query:     1 VALPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCXXXXXXXXXXXXV 60
             V+  KL   E+   ++  I    +    C   +L+ +T+Y C  LR              
Sbjct:   714 VSTDKLREFEIMCCSISEIKMGGI----CNFLSLVDVTIYNCEGLR-----ELTFLIFAP 764

Query:    61 RLQHLEIWGCPVLEEIIIVDQ--EKRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKF 118
             +L+ L +     LE+II  ++  E  ++ IV FP+L+YL + DL KL +   R    + F
Sbjct:   765 KLRSLSVVDAKDLEDIINEEKACEGEDSGIVPFPELKYLNLDDLPKLKNIYRRP---LPF 821

Query:   119 PSLRKLWISRCP 130
               L K+ I  CP
Sbjct:   822 LCLEKITIGECP 833




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_329000001
cc-nbs-lrr resistance protein (2359 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.15
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.1
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.53
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.35
PRK15386 426 type III secretion protein GogB; Provisional 98.22
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.2
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.14
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.96
KOG4341 483 consensus F-box protein containing LRR [General fu 97.81
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.79
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.75
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.75
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.6
KOG4341483 consensus F-box protein containing LRR [General fu 97.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.3
PRK15386 426 type III secretion protein GogB; Provisional 97.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.27
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.16
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.11
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.07
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.0
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.95
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.95
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.93
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.82
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.74
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.74
KOG0617 264 consensus Ras suppressor protein (contains leucine 96.67
PLN03150623 hypothetical protein; Provisional 96.64
KOG0617 264 consensus Ras suppressor protein (contains leucine 96.47
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 95.79
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.77
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.76
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.73
KOG4237 498 consensus Extracellular matrix protein slit, conta 95.73
PLN03150623 hypothetical protein; Provisional 95.57
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.34
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.33
KOG0472 565 consensus Leucine-rich repeat protein [Function un 95.33
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 95.14
KOG0472565 consensus Leucine-rich repeat protein [Function un 94.93
KOG4237 498 consensus Extracellular matrix protein slit, conta 94.84
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 94.83
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 94.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.7
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.39
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 94.1
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.17
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 92.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 91.62
KOG2982 418 consensus Uncharacterized conserved protein [Funct 90.89
smart0037026 LRR Leucine-rich repeats, outliers. 90.61
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.61
KOG2123 388 consensus Uncharacterized conserved protein [Funct 89.99
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 89.94
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 88.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 85.58
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 85.24
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 84.12
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.15  E-value=1.6e-10  Score=93.16  Aligned_cols=108  Identities=24%  Similarity=0.379  Sum_probs=84.6

Q ss_pred             CCccceeeeccceeeeecccccccccccCCCccEEEEecCCCcceeccCccccccccCcccEEEEeCCCCceEEcccccc
Q 036006            3 LPKLENLELRSINVERIWQNQVSALSCGVQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQE   82 (133)
Q Consensus         3 l~~L~~L~l~~~~l~~~~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~l~~L~~L~i~~c~~l~~i~~~~~~   82 (133)
                      +.+|+.|++.++.++.+|.+..     .+++|+.|+++++..++.++   ...  .+++|+.|.+.+|..+..++.    
T Consensus       610 ~~~L~~L~L~~s~l~~L~~~~~-----~l~~Lk~L~Ls~~~~l~~ip---~ls--~l~~Le~L~L~~c~~L~~lp~----  675 (1153)
T PLN03210        610 PENLVKLQMQGSKLEKLWDGVH-----SLTGLRNIDLRGSKNLKEIP---DLS--MATNLETLKLSDCSSLVELPS----  675 (1153)
T ss_pred             ccCCcEEECcCccccccccccc-----cCCCCCEEECCCCCCcCcCC---ccc--cCCcccEEEecCCCCccccch----
Confidence            4678888888888888876532     48899999999988888773   345  788999999999988887743    


Q ss_pred             ccccccccCCCccEEeecccccccccccCcccccCCCCccEEEEccCCCC
Q 036006           83 KRNNNIVMFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEF  132 (133)
Q Consensus        83 ~~~~~~~~~~~L~~L~i~~c~~L~~l~~~~~~~~~~~~L~~L~i~~c~~l  132 (133)
                          .+..+++|+.|++++|.+++.+|...    .+++|+.|.+.+|..+
T Consensus       676 ----si~~L~~L~~L~L~~c~~L~~Lp~~i----~l~sL~~L~Lsgc~~L  717 (1153)
T PLN03210        676 ----SIQYLNKLEDLDMSRCENLEILPTGI----NLKSLYRLNLSGCSRL  717 (1153)
T ss_pred             ----hhhccCCCCEEeCCCCCCcCccCCcC----CCCCCCEEeCCCCCCc
Confidence                23358889999999999898888653    5688888888888654



syringae 6; Provisional

>PLN03210 Resistant to P Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.03
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.02
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.02
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.02
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.01
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.01
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.99
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.99
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.98
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.96
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.95
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.95
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.94
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.93
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.93
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.92
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.92
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.88
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.87
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.87
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.85
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.85
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.85
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.83
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.82
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.81
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.81
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.8
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.8
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.79
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.76
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.75
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.73
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.72
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.72
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.72
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.72
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.71
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.7
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.69
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.69
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.64
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.63
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.63
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.63
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.62
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.62
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.62
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.61
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.6
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.6
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.58
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.56
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.55
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.52
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.5
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.5
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.5
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.47
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.47
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.47
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.46
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.44
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.43
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.43
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.41
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.4
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.4
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.38
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.38
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.35
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.29
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.27
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.16
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.1
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.96
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.94
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.86
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.69
3sb4_A 329 Hypothetical leucine rich repeat protein; LRR, rig 97.63
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.62
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.56
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.49
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.49
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.39
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 97.25
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.68
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.67
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.67
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.83
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.17
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 87.59
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.16  E-value=2.2e-10  Score=79.91  Aligned_cols=85  Identities=22%  Similarity=0.285  Sum_probs=48.8

Q ss_pred             CCCccEEEEecCCCcceeccCccccccccCcccEEEEeCCCCceEEccccccccccccccCCCccEEeeccccccccccc
Q 036006           31 VQNLIHLTLYKCRNLRCLFSSSILSNSIFVRLQHLEIWGCPVLEEIIIVDQEKRNNNIVMFPQLQYLKMYDLKKLTSFCT  110 (133)
Q Consensus        31 l~~L~~L~i~~c~~l~~~~~~~~~~~~~l~~L~~L~i~~c~~l~~i~~~~~~~~~~~~~~~~~L~~L~i~~c~~L~~l~~  110 (133)
                      +++|++|+++++ .++.+++  .+.  .+++|+.|++++|.....++        .....+++|+.|++++|..+..++.
T Consensus       205 l~~L~~L~L~~N-~l~~l~~--~l~--~l~~L~~L~Ls~n~~~~~~p--------~~~~~l~~L~~L~L~~n~~~~~~p~  271 (328)
T 4fcg_A          205 LQNLKSLKIRNS-PLSALGP--AIH--HLPKLEELDLRGCTALRNYP--------PIFGGRAPLKRLILKDCSNLLTLPL  271 (328)
T ss_dssp             CTTCCEEEEESS-CCCCCCG--GGG--GCTTCCEEECTTCTTCCBCC--------CCTTCCCCCCEEECTTCTTCCBCCT
T ss_pred             CCCCCEEEccCC-CCCcCch--hhc--cCCCCCEEECcCCcchhhhH--------HHhcCCCCCCEEECCCCCchhhcch
Confidence            455555555554 3333321  233  55666666666554333321        1223477788888887776666665


Q ss_pred             CcccccCCCCccEEEEccCCC
Q 036006          111 RDVHIIKFPSLRKLWISRCPE  131 (133)
Q Consensus       111 ~~~~~~~~~~L~~L~i~~c~~  131 (133)
                      ..   ..+++|++|++.+|+.
T Consensus       272 ~~---~~l~~L~~L~L~~n~~  289 (328)
T 4fcg_A          272 DI---HRLTQLEKLDLRGCVN  289 (328)
T ss_dssp             TG---GGCTTCCEEECTTCTT
T ss_pred             hh---hcCCCCCEEeCCCCCc
Confidence            43   2678888888887764



>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.19
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.08
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.05
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.89
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.65
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.62
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 98.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.53
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.43
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.37
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.3
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.24
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.14
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.95
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 97.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.73
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.06
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.94
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 93.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.47
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.19  E-value=7.3e-12  Score=84.23  Aligned_cols=41  Identities=27%  Similarity=0.451  Sum_probs=25.0

Q ss_pred             cCCCccEEeecccccccccccCcccccCCCCccEEEEccCCCC
Q 036006           90 MFPQLQYLKMYDLKKLTSFCTRDVHIIKFPSLRKLWISRCPEF  132 (133)
Q Consensus        90 ~~~~L~~L~i~~c~~L~~l~~~~~~~~~~~~L~~L~i~~c~~l  132 (133)
                      .+|+|++|++++|+.+++-....+  ..+++|++|.+.+|+++
T Consensus       173 ~~~~L~~L~L~~~~~itd~~~~~l--~~~~~L~~L~L~~C~~i  213 (284)
T d2astb2         173 RCPNLVHLDLSDSVMLKNDCFQEF--FQLNYLQHLSLSRCYDI  213 (284)
T ss_dssp             HCTTCSEEECTTCTTCCGGGGGGG--GGCTTCCEEECTTCTTC
T ss_pred             ccccccccccccccCCCchhhhhh--cccCcCCEEECCCCCCC
Confidence            356777777777766664433332  25667777777777654



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure