Citrus Sinensis ID: 036072


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-
MIPALRKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLNQRQRRGAKRVHGDGGAKCSRGSTLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSVTDDNQDSDGECDGNNSESEITSVSYKSTADPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRKDRIETD
cHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcHHHHcHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHcHHHHHcccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHcHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccHHHccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEEEEcEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHccc
MIPALRKWSRISILLghsldsqshystlsrsygngygqlYSTTTELLSLNQRQrrgakrvhgdggakcsrgstlslsRLLHYSSYCSLyrshcqvpcllphssslHSLQKVLLNKSTNVVASSLtnhnlatnildsncvnyrnvssvtddnqdsdgecdgnnseseitsvsykstadprEIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRharrpafrffcwagdkpgfahnsrTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLenlgrsklpKEAQLLFDKLkhrftpnlttYTVLLGGWCRVKNLMEAGRVWNEMidkgfkpdVVAHNIMLEGLLKIGKRSDAIKLFEVMkakgpspnvrsYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMeergcppdgltYNALIKLMKIQKMPDEAVRIYKEMVrsgfkptiHTYNMIMKSYFQTGNYEMGRKVWDEMIrrgccpddnsytVLIGGLISQDRSGEAYKYLEEMLEKgmkapvldYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTknrvyrkdrietd
MIPALRKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLNQRQRRgakrvhgdggakcsrgstlslsRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSvtddnqdsdgecdgnnseseitsvsykstadpreiERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDklkhrftpnLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEvmkakgpspnvrSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRsgfkptihtYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIgglisqdrsGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMrfsgkfevsnvlarwaettknrvyrkdrietd
MIPALRKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLNQRQRRGAKRVHGDGGAKCsrgstlslsrllhyssycslyrshcQVPCllphssslhslQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSVTDDNQDSDGECDGNNSESEITSVSYKSTADPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLErfrharrpafrffCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRKDRIETD
*****RKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELL************************STLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNV************************************IERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRV*********
*******WSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELL********************CSRGSTLSLSRLLHYSSYCS*********CLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSVTDDNQDSDGEC****S*SEITSVSYKSTADPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRKDRIE**
MIPALRKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLN********************GSTLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSV*****************************DPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRKDRIETD
MIPALRKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLNQRQRRGAKRVHGDGGAKCSRGSTLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSVTDDNQDSDGECDGNNSESEITSVSYKSTADPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVY********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPALRKWSRISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLNQRQRRGAKRVHGDGGAKCSRGSTLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNHNLATNILDSNCVNYRNVSSVTDDNQDSDGECDGNNSESEITSVSYKSTADPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRKDRIETD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query631 2.2.26 [Sep-21-2011]
Q9LZP3599 Pentatricopeptide repeat- yes no 0.841 0.886 0.597 0.0
Q3EAF8599 Pentatricopeptide repeat- yes no 0.835 0.879 0.603 0.0
Q9LEQ7598 Pentatricopeptide repeat- yes no 0.836 0.882 0.605 0.0
Q9FVX2517 Pentatricopeptide repeat- no no 0.676 0.825 0.304 2e-60
Q9FZD4505 Putative pentatricopeptid no no 0.660 0.825 0.312 5e-58
Q9C9A2510 Pentatricopeptide repeat- no no 0.675 0.835 0.298 9e-58
P0C8A0638 Pentatricopeptide repeat- no no 0.622 0.615 0.309 1e-56
Q9FX35568 Pentatricopeptide repeat- no no 0.651 0.723 0.283 2e-55
Q9FH87637 Putative pentatricopeptid no no 0.618 0.612 0.300 4e-55
Q9LFQ4572 Pentatricopeptide repeat- no no 0.676 0.746 0.289 5e-51
>sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 Back     alignment and function desciption
 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/591 (59%), Positives = 440/591 (74%), Gaps = 60/591 (10%)

Query: 59  RVHGDGGAKCSRGSTLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTN 118
           RV G  G +  R S    SR++H S+Y   YR   Q+P  LPHSS               
Sbjct: 41  RVIGGRGEEEVRFSGALFSRMIHSSTYHP-YR---QIP--LPHSS--------------- 79

Query: 119 VVASSLTNHNLATNILDSN--CVNYRNVSSVTDD--NQDSDGECDGNNSESEITSVSYKS 174
                         +LD++  C  + + SS   D  +++ + ECD N+ E+ ++ V  +S
Sbjct: 80  ------------VQLLDASLGCRGFSSGSSNVSDGCDEEVESECD-NDEETGVSCV--ES 124

Query: 175 TADPREIERVCKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCW 234
           + +P E+ERVCKVIDELF+LDRNMEAVLDE  ++LSH+L+V+VLERFRHAR+PAFRFFCW
Sbjct: 125 STNPEEVERVCKVIDELFALDRNMEAVLDEMKLDLSHDLIVEVLERFRHARKPAFRFFCW 184

Query: 235 AGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKE 294
           A ++ GFAH+SRTYNSMMSIL + RQFETMVS+LEEMG KGLL+METF IAM AFAAAKE
Sbjct: 185 AAERQGFAHDSRTYNSMMSILAKTRQFETMVSVLEEMGTKGLLTMETFTIAMKAFAAAKE 244

Query: 295 RKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVL 354
           RKKAV IFELM KYKFK GV+TINCLL++LGR+KL KEAQ+LFDKLK RFTPN+ TYTVL
Sbjct: 245 RKKAVGIFELMKKYKFKIGVETINCLLDSLGRAKLGKEAQVLFDKLKERFTPNMMTYTVL 304

Query: 355 LGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGP 414
           L GWCRV+NL+EA R+WN+MID+G KPD+VAHN+MLEGLL+  K+SDAIKLF VMK+KGP
Sbjct: 305 LNGWCRVRNLIEAARIWNDMIDQGLKPDIVAHNVMLEGLLRSRKKSDAIKLFHVMKSKGP 364

Query: 415 SPNVRSYTIMIWKFCKQ--------------------NAAVYTCLITGFGNRRRMDIVYD 454
            PNVRSYTIMI  FCKQ                    +AAVYTCLITGFG ++++D VY+
Sbjct: 365 CPNVRSYTIMIRDFCKQSSMETAIEYFDDMVDSGLQPDAAVYTCLITGFGTQKKLDTVYE 424

Query: 455 LLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYF 514
           LLKEM+E+G PPDG TYNALIKLM  QKMP+ A RIY +M+++  +P+IHT+NMIMKSYF
Sbjct: 425 LLKEMQEKGHPPDGKTYNALIKLMANQKMPEHATRIYNKMIQNEIEPSIHTFNMIMKSYF 484

Query: 515 QTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVL 574
              NYEMGR VW+EMI++G CPDDNSYTVLI GLI + +S EA +YLEEML+KGMK P++
Sbjct: 485 MARNYEMGRAVWEEMIKKGICPDDNSYTVLIRGLIGEGKSREACRYLEEMLDKGMKTPLI 544

Query: 575 DYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRK 625
           DYNKFAAD  R G+  + +ELAQ+ +FSGKF  + + ARWA+ T+ R  ++
Sbjct: 545 DYNKFAADFHRGGQPEIFEELAQRAKFSGKFAAAEIFARWAQMTRRRFKQR 595





Arabidopsis thaliana (taxid: 3702)
>sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 Back     alignment and function description
>sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 Back     alignment and function description
>sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 Back     alignment and function description
>sp|Q9FZD4|PPR59_ARATH Putative pentatricopeptide repeat-containing protein At1g26500 OS=Arabidopsis thaliana GN=At1g26500 PE=3 SV=1 Back     alignment and function description
>sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 Back     alignment and function description
>sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 Back     alignment and function description
>sp|Q9FX35|PP117_ARATH Pentatricopeptide repeat-containing protein At1g73400, mitochondrial OS=Arabidopsis thaliana GN=At1g73400 PE=2 SV=2 Back     alignment and function description
>sp|Q9FH87|PP447_ARATH Putative pentatricopeptide repeat-containing protein At5g65820 OS=Arabidopsis thaliana GN=At5g65820 PE=3 SV=1 Back     alignment and function description
>sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query631
356549210648 PREDICTED: pentatricopeptide repeat-cont 0.944 0.919 0.619 0.0
255548471533 pentatricopeptide repeat-containing prot 0.770 0.911 0.714 0.0
224128340540 predicted protein [Populus trichocarpa] 0.746 0.872 0.708 0.0
147862837 927 hypothetical protein VITISV_028672 [Viti 0.866 0.590 0.616 0.0
225447826679 PREDICTED: pentatricopeptide repeat-cont 0.866 0.805 0.613 0.0
449454008621 PREDICTED: pentatricopeptide repeat-cont 0.849 0.863 0.617 0.0
356561933510 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.724 0.896 0.714 0.0
15228767599 pentatricopeptide repeat-containing prot 0.841 0.886 0.597 0.0
15228788599 pentatricopeptide repeat-containing prot 0.835 0.879 0.603 0.0
15241508598 pentatricopeptide repeat-containing prot 0.836 0.882 0.605 0.0
>gi|356549210|ref|XP_003542990.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/642 (61%), Positives = 473/642 (73%), Gaps = 46/642 (7%)

Query: 11  ISILLGHSLDSQSHYSTLSRSYGNGYGQLYSTTTELLSLNQR---QRRGAKRVHGDGGAK 67
           +++ L H  DSQ  Y         G   ++STT +L SL+QR   QRRG +        +
Sbjct: 18  LTLFLRHHTDSQLPY---------GPCCVFSTT-KLRSLHQRRPPQRRGEQ-------VR 60

Query: 68  CSRGSTLSLSRLLHYSSYCSLYRSHCQVPCLLPHSSSLHSLQKVLLNKSTNVVASSLTNH 127
              GS+L LSRLL  S  C+ + S CQ+P LLPH S L +LQK LL        S+L + 
Sbjct: 61  LPCGSSLPLSRLLRSSLNCTFHHSRCQIPFLLPHPSPLLTLQKKLLIPHLATF-SALPSS 119

Query: 128 NLATNILDSNCVNYRNVSSVTD---DNQDSDGECDGNNSESEITSVSYKSTADPREIERV 184
                    N  + R  +S  D   +N D D +    +   +   VS +S ADP E+ERV
Sbjct: 120 PFHEKFPFLN--SPRTFASNADSGVENDDDDDDGGDGDKGYDGRGVSGESCADPVEVERV 177

Query: 185 CKVIDELFSLDRNMEAVLDECGINLSHNLVVDVLERFRHARRPAFRFFCWAGDKPGFAHN 244
           CKVIDELF+LDRNME VLDECG+ LSH+LVVDVL+RF+HAR+PAFRFFCWAG +PGFAH+
Sbjct: 178 CKVIDELFALDRNMEVVLDECGVRLSHDLVVDVLQRFKHARKPAFRFFCWAGKRPGFAHD 237

Query: 245 SRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFEL 304
           SRTYN MM +LGR RQFETMV+MLEEMGEKGLL+METF IA+ AFA AK+RKKAV IF+L
Sbjct: 238 SRTYNFMMCVLGRTRQFETMVAMLEEMGEKGLLTMETFSIAIKAFAEAKQRKKAVGIFDL 297

Query: 305 MNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNL 364
           M KY FK GVD IN LL++L  +KL KEAQ +F+KLK RFTP+L TYT+LL GWCR+KNL
Sbjct: 298 MKKYGFKVGVDVINFLLDSLSTAKLGKEAQAVFEKLKDRFTPSLQTYTILLSGWCRLKNL 357

Query: 365 MEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIM 424
           +EAGRVWNEMID+GF PDVVAHN+MLEGLLK  K+SDAIKLFE+MKAKGPSPNVRSYTIM
Sbjct: 358 LEAGRVWNEMIDRGFNPDVVAHNVMLEGLLKCKKKSDAIKLFEIMKAKGPSPNVRSYTIM 417

Query: 425 IWKFCKQ--------------------NAAVYTCLITGFGNRRRMDIVYDLLKEMEERGC 464
           I  FCKQ                    +AA+YTCLITGFG +++MD+VY LLKEM ERGC
Sbjct: 418 IQDFCKQKLMGEAIEYFDVMVDRGCQPDAALYTCLITGFGRQKKMDMVYSLLKEMRERGC 477

Query: 465 PPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRK 524
           PPDG TYNALIKLM  Q MPD+AVRIYK+M++SG KPTIHTYNMIMKSYF T NYEMG +
Sbjct: 478 PPDGRTYNALIKLMTSQHMPDDAVRIYKKMIQSGIKPTIHTYNMIMKSYFVTKNYEMGHE 537

Query: 525 VWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLS 584
           +WDEM ++GCCPDDNSY V IGGLI QDRSGEA KYLEEMLEKGMKAP LDYNKFA+D+S
Sbjct: 538 IWDEMHQKGCCPDDNSYIVYIGGLIRQDRSGEACKYLEEMLEKGMKAPKLDYNKFASDIS 597

Query: 585 RAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTKNRVYRKD 626
           + G + +L+ELA+KM F GKFEVSNVLA WA+  K    R++
Sbjct: 598 KTGNAVILEELARKMNFVGKFEVSNVLASWADMMKKSAKRRE 639




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255548471|ref|XP_002515292.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545772|gb|EEF47276.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224128340|ref|XP_002320305.1| predicted protein [Populus trichocarpa] gi|222861078|gb|EEE98620.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147862837|emb|CAN78368.1| hypothetical protein VITISV_028672 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447826|ref|XP_002268129.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454008|ref|XP_004144748.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cucumis sativus] gi|449490811|ref|XP_004158714.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356561933|ref|XP_003549231.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|15228767|ref|NP_191806.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181319|sp|Q9LZP3.1|PP293_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g62470, mitochondrial; Flags: Precursor gi|7340718|emb|CAB82961.1| putative protein [Arabidopsis thaliana] gi|34365579|gb|AAQ65101.1| At3g62470 [Arabidopsis thaliana] gi|332646835|gb|AEE80356.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15228788|ref|NP_191813.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122214682|sp|Q3EAF8.1|PP294_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g62540, mitochondrial; Flags: Precursor gi|332646841|gb|AEE80362.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15241508|ref|NP_196986.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75173968|sp|Q9LEQ7.1|PP382_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g14820, mitochondrial; Flags: Precursor gi|9755750|emb|CAC01881.1| putative protein [Arabidopsis thaliana] gi|332004697|gb|AED92080.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query631
TAIR|locus:2185455598 AT5G14820 "AT5G14820" [Arabido 0.698 0.737 0.507 1.8e-112
TAIR|locus:2096099599 AT3G62470 "AT3G62470" [Arabido 0.698 0.736 0.507 1.8e-112
TAIR|locus:2096074599 AT3G62540 "AT3G62540" [Arabido 0.698 0.736 0.507 3.6e-112
TAIR|locus:2097395 638 AT3G49730 [Arabidopsis thalian 0.603 0.597 0.319 2.6e-47
TAIR|locus:2197925505 AT1G26500 "AT1G26500" [Arabido 0.673 0.841 0.288 9.1e-45
TAIR|locus:2026346510 AT1G71060 [Arabidopsis thalian 0.553 0.684 0.292 5e-44
TAIR|locus:2156213 637 AT5G65820 [Arabidopsis thalian 0.709 0.703 0.283 1.3e-43
TAIR|locus:2139732566 AT4G11690 [Arabidopsis thalian 0.567 0.632 0.264 4.3e-36
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.534 0.563 0.296 9e-34
TAIR|locus:2035206523 AT1G52640 [Arabidopsis thalian 0.645 0.778 0.273 1.7e-32
TAIR|locus:2185455 AT5G14820 "AT5G14820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1110 (395.8 bits), Expect = 1.8e-112, P = 1.8e-112
 Identities = 236/465 (50%), Positives = 307/465 (66%)

Query:   130 ATNILDSN--CVNYRNVSSVTDDNQDSD--GECDGNNSESEITSVSYKSTADPREIERVC 185
             +  +LD++  C  + + SS   D  D +   ECD N+ E+ ++ V  +S+ +P E+ERVC
Sbjct:    78 SVQLLDASLGCRGFSSGSSNVSDGCDEEVESECD-NDEETGVSCV--ESSTNPEEVERVC 134

Query:   186 KVIDELFSLDRNMEAVLDECGINLSHNLVVDVLEXXXXXXXXXXXXXCWAGDKPGFAHNS 245
             KVIDELF+LDRNMEAVLDE  ++LSH+L+V+VLE             CWA ++ GFAH+S
Sbjct:   135 KVIDELFALDRNMEAVLDEMKLDLSHDLIVEVLERFRHARKPAFRFFCWAAERQGFAHDS 194

Query:   246 RTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELM 305
             RTYNSMMSIL + RQFETMVS+LEEMG KGLL+METF IAM AFAAAKERKKAV IFELM
Sbjct:   195 RTYNSMMSILAKTRQFETMVSVLEEMGTKGLLTMETFTIAMKAFAAAKERKKAVGIFELM 254

Query:   306 NKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLM 365
              KYKFK GV+TINCLL++LGR+KL KEAQ+LFDKLK RFTPN+ TYTVLL GWCRV+NL+
Sbjct:   255 KKYKFKIGVETINCLLDSLGRAKLGKEAQVLFDKLKERFTPNMMTYTVLLNGWCRVRNLI 314

Query:   366 EAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMI 425
             EA R+WN+MID G KPD+VAHN+MLEGLL+  K+SDAIKLF VMK+KGP PNVRSYTIMI
Sbjct:   315 EAARIWNDMIDHGLKPDIVAHNVMLEGLLRSMKKSDAIKLFHVMKSKGPCPNVRSYTIMI 374

Query:   426 WKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPD 485
               FCKQ++               M+   +   +M + G  PD   Y  LI     QK  D
Sbjct:   375 RDFCKQSS---------------METAIEYFDDMVDSGLQPDAAVYTCLITGFGTQKKLD 419

Query:   486 EAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLI 545
                 + KEM   G  P   TYN ++K        E G +++++MI+    P  +++ +++
Sbjct:   420 TVYELLKEMQEKGHPPDGKTYNALIKLMANQKMPEHGTRIYNKMIQNEIEPSIHTFNMIM 479

Query:   546 GGLISQDRSGEAYKYL-EEMLEKGMKAPVLDYNKFAADLSRAGRS 589
                    R+ E  + + +EM++KG+      Y      L   G+S
Sbjct:   480 KSYFVA-RNYEMGRAVWDEMIKKGICPDDNSYTVLIRGLISEGKS 523


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2096099 AT3G62470 "AT3G62470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096074 AT3G62540 "AT3G62540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097395 AT3G49730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197925 AT1G26500 "AT1G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026346 AT1G71060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156213 AT5G65820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035206 AT1G52640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LEQ7PP382_ARATHNo assigned EC number0.60510.83670.8829yesno
Q3EAF8PP294_ARATHNo assigned EC number0.60300.83510.8797yesno
Q9LZP3PP293_ARATHNo assigned EC number0.59720.84150.8864yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-21
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-10
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-08
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-08
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-07
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1285434 pfam12854, PPR_1, PPR repeat 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam06239229 pfam06239, ECSIT, Evolutionarily conserved signall 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 99.2 bits (247), Expect = 2e-21
 Identities = 85/381 (22%), Positives = 153/381 (40%), Gaps = 62/381 (16%)

Query: 245 SRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFEL 304
              YN ++    R  + +  + +LE+M ++GLL M+  KI    F  A ++++AV     
Sbjct: 374 IDAYNRLL----RDGRIKDCIDLLEDMEKRGLLDMD--KIYHAKFFKACKKQRAV----- 422

Query: 305 MNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNL 364
                                     KEA   F KL     P L+T+ +L+      +++
Sbjct: 423 --------------------------KEA-FRFAKLIR--NPTLSTFNMLMSVCASSQDI 453

Query: 365 MEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRS---- 420
             A RV   + + G K D   +  ++    K GK     ++F  M   G   NV +    
Sbjct: 454 DGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGAL 513

Query: 421 ----------------YTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGC 464
                           Y IM  K  K +  V+  LI+  G    +D  +D+L EM+    
Sbjct: 514 IDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETH 573

Query: 465 P--PDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMG 522
           P  PD +T  AL+K        D A  +Y+ +     K T   Y + + S  Q G+++  
Sbjct: 574 PIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFA 633

Query: 523 RKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAAD 582
             ++D+M ++G  PD+  ++ L+          +A++ L++  ++G+K   + Y+     
Sbjct: 634 LSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGA 693

Query: 583 LSRAGRSYVLDELAQKMRFSG 603
            S A       EL + ++   
Sbjct: 694 CSNAKNWKKALELYEDIKSIK 714


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|148068 pfam06239, ECSIT, Evolutionarily conserved signalling intermediate in Toll pathway Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 631
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.86
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.75
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.75
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.74
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.74
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.72
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.71
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.7
PRK14574 822 hmsH outer membrane protein; Provisional 99.68
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.68
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.65
PRK14574 822 hmsH outer membrane protein; Provisional 99.58
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.52
KOG2076 895 consensus RNA polymerase III transcription factor 99.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.5
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.48
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.44
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.44
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.44
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.42
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.42
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.4
KOG1126638 consensus DNA-binding cell division cycle control 99.39
KOG2003840 consensus TPR repeat-containing protein [General f 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.37
KOG2076 895 consensus RNA polymerase III transcription factor 99.37
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.34
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.31
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.29
KOG2003 840 consensus TPR repeat-containing protein [General f 99.29
KOG1126638 consensus DNA-binding cell division cycle control 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.2
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.18
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.17
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.17
PRK12370553 invasion protein regulator; Provisional 99.17
PF1304150 PPR_2: PPR repeat family 99.16
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.16
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.16
PRK12370553 invasion protein regulator; Provisional 99.15
PF1304150 PPR_2: PPR repeat family 99.13
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.12
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.1
KOG1129478 consensus TPR repeat-containing protein [General f 99.09
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.08
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.07
KOG0547606 consensus Translocase of outer mitochondrial membr 99.05
KOG1915677 consensus Cell cycle control protein (crooked neck 99.04
KOG1129478 consensus TPR repeat-containing protein [General f 98.98
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.93
KOG0547606 consensus Translocase of outer mitochondrial membr 98.9
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.89
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.89
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.88
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.88
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.84
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.84
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.82
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.81
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.8
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.8
PRK11189296 lipoprotein NlpI; Provisional 98.79
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.74
PRK11189296 lipoprotein NlpI; Provisional 98.71
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.64
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.62
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.62
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.6
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.58
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.54
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.54
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.53
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.49
PF1285434 PPR_1: PPR repeat 98.44
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.43
PRK04841 903 transcriptional regulator MalT; Provisional 98.43
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.42
PF1285434 PPR_1: PPR repeat 98.41
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.37
PRK04841 903 transcriptional regulator MalT; Provisional 98.37
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.36
PLN02789320 farnesyltranstransferase 98.35
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.33
KOG1125579 consensus TPR repeat-containing protein [General f 98.32
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.31
KOG1125579 consensus TPR repeat-containing protein [General f 98.27
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.25
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.25
PLN02789320 farnesyltranstransferase 98.24
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.22
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.21
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.2
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.19
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.18
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.18
KOG1128777 consensus Uncharacterized conserved protein, conta 98.18
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.16
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.16
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.13
KOG1128777 consensus Uncharacterized conserved protein, conta 98.12
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.12
PRK10370198 formate-dependent nitrite reductase complex subuni 98.08
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.08
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.05
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.05
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.04
PRK10370198 formate-dependent nitrite reductase complex subuni 98.03
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.02
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.01
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.98
PRK15359144 type III secretion system chaperone protein SscB; 97.94
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.94
PRK15359144 type III secretion system chaperone protein SscB; 97.93
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.9
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.88
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.87
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.84
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.81
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.81
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.81
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.79
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.76
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.75
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.75
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.72
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.69
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.61
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.61
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.6
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.55
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.54
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.5
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.44
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.42
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.38
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.38
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.38
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.37
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.35
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.34
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.33
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.3
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.29
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.29
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.24
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.24
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.13
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.1
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.1
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.96
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.94
KOG20411189 consensus WD40 repeat protein [General function pr 96.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.9
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.89
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.89
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.88
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.81
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.79
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.76
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.7
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.67
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.62
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.58
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.53
PF12688120 TPR_5: Tetratrico peptide repeat 96.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.48
COG4700251 Uncharacterized protein conserved in bacteria cont 96.42
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.42
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.42
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.37
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.31
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.27
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.09
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.08
KOG0553304 consensus TPR repeat-containing protein [General f 96.05
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.03
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.03
COG3898531 Uncharacterized membrane-bound protein [Function u 95.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.94
PF12688120 TPR_5: Tetratrico peptide repeat 95.93
PRK10803263 tol-pal system protein YbgF; Provisional 95.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.87
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.81
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.66
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.63
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.56
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.53
KOG0553304 consensus TPR repeat-containing protein [General f 95.49
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.41
PRK10803263 tol-pal system protein YbgF; Provisional 95.36
COG4700251 Uncharacterized protein conserved in bacteria cont 95.27
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.23
COG3898531 Uncharacterized membrane-bound protein [Function u 95.22
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.17
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.14
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.12
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.05
PF1337173 TPR_9: Tetratricopeptide repeat 95.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.02
smart00299140 CLH Clathrin heavy chain repeat homology. 94.97
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.91
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.9
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.86
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.74
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.62
PF1337173 TPR_9: Tetratricopeptide repeat 94.59
KOG3941406 consensus Intermediate in Toll signal transduction 94.54
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.54
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.35
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.33
smart00299140 CLH Clathrin heavy chain repeat homology. 94.32
PRK15331165 chaperone protein SicA; Provisional 94.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.28
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.19
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.18
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.0
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.95
KOG3941 406 consensus Intermediate in Toll signal transduction 93.8
KOG1585308 consensus Protein required for fusion of vesicles 93.78
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.58
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.37
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.35
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 93.28
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.25
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.16
PRK15331165 chaperone protein SicA; Provisional 93.13
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 93.09
PF13512142 TPR_18: Tetratricopeptide repeat 93.09
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.09
KOG1585308 consensus Protein required for fusion of vesicles 92.86
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.77
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.71
KOG2610 491 consensus Uncharacterized conserved protein [Funct 92.47
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.37
PRK11906458 transcriptional regulator; Provisional 92.22
KOG1258 577 consensus mRNA processing protein [RNA processing 92.17
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.1
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.04
COG3629280 DnrI DNA-binding transcriptional activator of the 91.82
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.74
COG3629280 DnrI DNA-binding transcriptional activator of the 91.56
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.26
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.12
PRK11906458 transcriptional regulator; Provisional 90.44
PF13512142 TPR_18: Tetratricopeptide repeat 90.35
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.28
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.16
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 90.03
KOG2610491 consensus Uncharacterized conserved protein [Funct 89.86
COG4649221 Uncharacterized protein conserved in bacteria [Fun 89.75
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.55
PF1342844 TPR_14: Tetratricopeptide repeat 89.25
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.14
KOG1941 518 consensus Acetylcholine receptor-associated protei 88.56
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.28
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.07
PF1342844 TPR_14: Tetratricopeptide repeat 88.02
KOG1941 518 consensus Acetylcholine receptor-associated protei 87.94
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.7
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.64
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 87.47
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 87.47
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.42
KOG4555175 consensus TPR repeat-containing protein [Function 87.36
KOG4555175 consensus TPR repeat-containing protein [Function 87.1
PF13929292 mRNA_stabil: mRNA stabilisation 87.08
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 86.86
PF13929292 mRNA_stabil: mRNA stabilisation 86.11
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.7
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.37
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 85.33
COG0457291 NrfG FOG: TPR repeat [General function prediction 84.93
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.61
KOG1550552 consensus Extracellular protein SEL-1 and related 83.81
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 83.04
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 82.82
COG4455273 ImpE Protein of avirulence locus involved in tempe 81.83
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.51
KOG4234271 consensus TPR repeat-containing protein [General f 80.13
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.8e-54  Score=489.10  Aligned_cols=397  Identities=16%  Similarity=0.246  Sum_probs=358.5

Q ss_pred             CCHHHHHHHHHhhccCc--hhHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCHHHHHHHH
Q 036072          209 LSHNLVVDVLERFRHAR--RPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAM  286 (631)
Q Consensus       209 ~~~~~~~~vl~~~~~~~--~~A~~~f~~~~~~~g~~p~~~~y~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~~~~~li  286 (631)
                      .+...+..++.++...+  ..|+++|++|.++.-+.++..+++.++.+|++.|.+++|..+|+.|..   ++..+|+.+|
T Consensus       368 ~~~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~---pd~~Tyn~LL  444 (1060)
T PLN03218        368 RKSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRN---PTLSTFNMLM  444 (1060)
T ss_pred             CCchHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCC---CCHHHHHHHH
Confidence            44566777777775443  348999998865544567888888888889888999999988888875   7788899999


Q ss_pred             HHHHHccCHHHHHHHHHHHHhCCCCcCHHHHHHHHHHHHcCCChHHHHHHHHHHhc-ccCCChhhHHHHHHHHHhcCCHH
Q 036072          287 NAFAAAKERKKAVAIFELMNKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKH-RFTPNLTTYTVLLGGWCRVKNLM  365 (631)
Q Consensus       287 ~~~~~~g~~~~A~~v~~~m~~~g~~~~~~~~~~Ll~~~~~~g~~~~A~~l~~~m~~-~~~p~~~~y~~Li~~~~~~g~~~  365 (631)
                      .+|++.|+++.|.++|+.|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+ ++.||..+|+.||.+|++.|+++
T Consensus       445 ~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~e  524 (1060)
T PLN03218        445 SVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVA  524 (1060)
T ss_pred             HHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHH
Confidence            99999999999999999999988889999999999999999999999999998875 57888999999999999999999


Q ss_pred             HHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--cCCCCcHHHHHHHHHHHhhc------------
Q 036072          366 EAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIGKRSDAIKLFEVMKA--KGPSPNVRSYTIMIWKFCKQ------------  431 (631)
Q Consensus       366 ~A~~l~~~m~~~g~~p~~~ty~~li~~~~~~g~~~~A~~ll~~m~~--~g~~p~~~~~~~li~~~~~~------------  431 (631)
                      +|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|..  .|+.||..+|+++|.+|++.            
T Consensus       525 eAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~  604 (1060)
T PLN03218        525 KAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQM  604 (1060)
T ss_pred             HHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHH
Confidence            9999999999888999999999999999999999999999999876  57888999999999888875            


Q ss_pred             --------CHHHHHHHHHHHhccCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCH
Q 036072          432 --------NAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTI  503 (631)
Q Consensus       432 --------~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~  503 (631)
                              +..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||.
T Consensus       605 M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~  684 (1060)
T PLN03218        605 IHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGT  684 (1060)
T ss_pred             HHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCH
Confidence                    568899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q 036072          504 HTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADL  583 (631)
Q Consensus       504 ~t~~~Li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~ll~~m~~~g~~p~~~~~~~li~~~  583 (631)
                      .+|+.||.+|++.|++++|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|
T Consensus       685 ~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~  764 (1060)
T PLN03218        685 VSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVAS  764 (1060)
T ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCHHHHHHHHHHHHhcCCCchH
Q 036072          584 SRAGRSYVLDELAQKMRFSGKFEVS  608 (631)
Q Consensus       584 ~~~g~~~~A~~l~~~m~~~g~~~~~  608 (631)
                      ++.|++++|.+++++|.+.|.....
T Consensus       765 ~k~G~le~A~~l~~~M~k~Gi~pd~  789 (1060)
T PLN03218        765 ERKDDADVGLDLLSQAKEDGIKPNL  789 (1060)
T ss_pred             HHCCCHHHHHHHHHHHHHcCCCCCH
Confidence            9999999999999999999976433



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 74.1 bits (180), Expect = 7e-14
 Identities = 25/166 (15%), Positives = 55/166 (33%), Gaps = 4/166 (2%)

Query: 445 NRRRMDIVYDLLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRI---YKEMVRSGFKP 501
            +  +D+      +  +           A  K   +      A  +   +    +     
Sbjct: 104 GKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLL 163

Query: 502 TIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLIGGLISQDRSGEAY-KY 560
           T+  YN +M  + + G ++    V   +   G  PD  SY   +  +  QD+      + 
Sbjct: 164 TLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERC 223

Query: 561 LEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFE 606
           LE+M ++G+K   L      ++  RA     + ++        +  
Sbjct: 224 LEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLP 269


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query631
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.87
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.82
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.76
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.66
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.63
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.62
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.62
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.6
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.56
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.53
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.53
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.5
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.47
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.46
3u4t_A272 TPR repeat-containing protein; structural genomics 99.46
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.44
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.44
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.43
3u4t_A272 TPR repeat-containing protein; structural genomics 99.42
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.42
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.41
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.39
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.37
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.34
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.26
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.21
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.21
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.19
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.17
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.11
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.02
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.02
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.0
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.99
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.96
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.93
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.89
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.87
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.84
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.84
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.75
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.72
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.72
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.65
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.63
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.63
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.62
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.59
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.57
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.57
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.55
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.55
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.54
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.54
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.53
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.53
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.52
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.51
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.49
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.49
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.47
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.46
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.46
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.45
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.44
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.43
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.4
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.38
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.35
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.33
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.32
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.29
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.29
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.28
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.25
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.21
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.21
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.17
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.12
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.1
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.03
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.03
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.02
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.02
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.0
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.97
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.97
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.96
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.94
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.91
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.88
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.85
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.84
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.83
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.81
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.79
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.78
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.77
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.74
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.69
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.67
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.65
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.65
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.64
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.63
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.59
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.58
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.56
3k9i_A117 BH0479 protein; putative protein binding protein, 97.51
3k9i_A117 BH0479 protein; putative protein binding protein, 97.48
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.46
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.39
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.38
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.27
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.26
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.23
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.19
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.14
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.11
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.11
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.09
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.01
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.91
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.83
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.73
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.56
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.38
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.3
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.78
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.6
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.59
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.49
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.39
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.66
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.44
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.23
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.13
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.03
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.32
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.08
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 92.89
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.82
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.44
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.31
1pc2_A152 Mitochondria fission protein; unknown function; NM 91.92
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 91.79
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.59
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 90.5
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.28
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.98
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 89.28
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 88.96
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.85
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.02
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.57
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 87.34
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.23
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.59
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 84.49
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 83.85
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.61
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.56
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 80.22
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 80.21
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=99.97  E-value=1e-28  Score=274.85  Aligned_cols=385  Identities=7%  Similarity=-0.053  Sum_probs=267.7

Q ss_pred             CHHHHHHHHHhhccCc--hhHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCC------------
Q 036072          210 SHNLVVDVLERFRHAR--RPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKG------------  275 (631)
Q Consensus       210 ~~~~~~~vl~~~~~~~--~~A~~~f~~~~~~~g~~p~~~~y~~li~~~~~~g~~~~A~~l~~~m~~~g------------  275 (631)
                      +...+..+...+...+  ..|.++|+.+..   ..++..+|+.++.+|.+.|++++|..+|+++....            
T Consensus       116 ~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~  192 (597)
T 2xpi_A          116 NPNDAFWLAQVYCCTGDYARAKCLLTKEDL---YNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQ  192 (597)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHTCG---GGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CC
T ss_pred             CchHHHHHHHHHHHcCcHHHHHHHHHHHhc---cccchhHHHHHHHHHHHHhhHHHHHHHHhccCCcccccccccccccc
Confidence            4444444444443332  337777765532   24567777777777777777777777777432221            


Q ss_pred             ---C-CCHHHHHHHHHHHHHccCHHHHHHHHHHHHhCCCCcCHHHHHH--------------------------------
Q 036072          276 ---L-LSMETFKIAMNAFAAAKERKKAVAIFELMNKYKFKAGVDTINC--------------------------------  319 (631)
Q Consensus       276 ---~-~~~~~~~~li~~~~~~g~~~~A~~v~~~m~~~g~~~~~~~~~~--------------------------------  319 (631)
                         . .+..+|+.++.+|.+.|++++|+++|+.|.+.+ +.+...+..                                
T Consensus       193 ~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  271 (597)
T 2xpi_A          193 DGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD-AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFL  271 (597)
T ss_dssp             CSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHH
T ss_pred             ccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHH
Confidence               1 135677777777777777777777777777654 222222222                                


Q ss_pred             ------HHHHHHcCCChHHHHHHHHHHhcccCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Q 036072          320 ------LLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGL  393 (631)
Q Consensus       320 ------Ll~~~~~~g~~~~A~~l~~~m~~~~~p~~~~y~~Li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~ty~~li~~~  393 (631)
                            ++..|.+.|++++|.++|+++.+. +++..+|+.++.+|.+.|++++|.++|+++.+.+. .+..+|+.++.+|
T Consensus       272 ~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~  349 (597)
T 2xpi_A          272 RSLYMLKLNKTSHEDELRRAEDYLSSINGL-EKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDP-YNLDVYPLHLASL  349 (597)
T ss_dssp             HHHHHTTSCTTTTHHHHHHHHHHHHTSTTG-GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCCTTHHHHHHHH
T ss_pred             HHHHHHHHHHHcCcchHHHHHHHHHHhhcC-CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCc-ccHHHHHHHHHHH
Confidence                  244455666666666666666543 45666666667777777777777777766665532 2555666666666


Q ss_pred             HHcCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHhhc-------------------CHHHHHHHHHHHhccCCHHHHHH
Q 036072          394 LKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQ-------------------NAAVYTCLITGFGNRRRMDIVYD  454 (631)
Q Consensus       394 ~~~g~~~~A~~ll~~m~~~g~~p~~~~~~~li~~~~~~-------------------~~~~~~~li~~~~~~g~~~~A~~  454 (631)
                      .+.|++++|.++++++.+.. ..+..+++.+...|.+.                   +..+|+.++.+|.+.|++++|.+
T Consensus       350 ~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~  428 (597)
T 2xpi_A          350 HESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAIS  428 (597)
T ss_dssp             HHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHH
T ss_pred             HHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHH
Confidence            66666666666666666432 23444555554444432                   56678888888888888999998


Q ss_pred             HHHHHHHcCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHc--
Q 036072          455 LLKEMEERGCPPDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRR--  532 (631)
Q Consensus       455 l~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~Li~~~~~~g~~~~A~~~~~~m~~~--  532 (631)
                      +|+++.+.+. .+..+|+.++.+|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.  
T Consensus       429 ~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~  506 (597)
T 2xpi_A          429 AYTTAARLFQ-GTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVK  506 (597)
T ss_dssp             HHHHHHHTTT-TCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhCc-cchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhh
Confidence            8888887643 367888888888888888899998888888754 346788888888888888999998888888775  


Q ss_pred             --CCCCC--HHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCC
Q 036072          533 --GCCPD--DNSYTVLIGGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGK  604 (631)
Q Consensus       533 --g~~p~--~~t~~~li~~~~~~g~~~~A~~ll~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~  604 (631)
                        +..|+  ..+|..++.+|.+.|++++|.++++++.+.+ +.+..+|..++.+|.+.|++++|.++++++.+...
T Consensus       507 ~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p  581 (597)
T 2xpi_A          507 KTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAISP  581 (597)
T ss_dssp             HSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             ccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCC
Confidence              66777  7788888888888899999998888888765 44778888888888888999888888888876553



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query631
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.82
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.8
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.03
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.03
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.98
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.95
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.91
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.73
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.72
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.7
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.38
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.22
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.1
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.09
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.07
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.04
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.02
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.0
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.97
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.93
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.85
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.75
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.69
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.63
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.61
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.55
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.5
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.23
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.17
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.17
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.16
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.11
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.1
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.97
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.85
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.77
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.74
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.47
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.13
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 95.77
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.92
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.86
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.84
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.46
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.38
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.95
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.02
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.86
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 82.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 81.71
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=4.8e-16  Score=158.71  Aligned_cols=369  Identities=14%  Similarity=0.035  Sum_probs=286.4

Q ss_pred             hhHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCHHHHHHHHHHHHHccCHHHHHHHHHHH
Q 036072          226 RPAFRFFCWAGDKPGFAHNSRTYNSMMSILGRARQFETMVSMLEEMGEKGLLSMETFKIAMNAFAAAKERKKAVAIFELM  305 (631)
Q Consensus       226 ~~A~~~f~~~~~~~g~~p~~~~y~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~~~~~li~~~~~~g~~~~A~~v~~~m  305 (631)
                      +.|.+.|..+.+..  +-+...|..+..++.+.|++++|...|++..+..+.+..++..+..++...|++++|++.+...
T Consensus        16 ~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~   93 (388)
T d1w3ba_          16 EAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHA   93 (388)
T ss_dssp             HHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccccccccccc
Confidence            34777776654322  2247788888888888899999999998888887777888888888888999999999888888


Q ss_pred             HhCCCCcCHHHHHHHHHHHHcCCChHHHHHHHHHHhcccCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHH
Q 036072          306 NKYKFKAGVDTINCLLENLGRSKLPKEAQLLFDKLKHRFTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVA  385 (631)
Q Consensus       306 ~~~g~~~~~~~~~~Ll~~~~~~g~~~~A~~l~~~m~~~~~p~~~~y~~Li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t  385 (631)
                      .+.. +.+..............+....+............................+....+...+....... .-+...
T Consensus        94 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  171 (388)
T d1w3ba_          94 LRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVA  171 (388)
T ss_dssp             HHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHH
T ss_pred             cccc-cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC-cchhHH
Confidence            8765 44455555555555555666666666555554444556666677777778888888888888877653 335677


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHhhcCHHHHHHHHHHHhccCCHHHHHHHHHHHHHcCCC
Q 036072          386 HNIMLEGLLKIGKRSDAIKLFEVMKAKGPSPNVRSYTIMIWKFCKQNAAVYTCLITGFGNRRRMDIVYDLLKEMEERGCP  465 (631)
Q Consensus       386 y~~li~~~~~~g~~~~A~~ll~~m~~~g~~p~~~~~~~li~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~  465 (631)
                      +..+...+...|++++|...++...+.  .|+              +..+|..+...+...|++++|...+.........
T Consensus       172 ~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~--------------~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~  235 (388)
T d1w3ba_         172 WSNLGCVFNAQGEIWLAIHHFEKAVTL--DPN--------------FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN  235 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHHHH--CTT--------------CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT
T ss_pred             HHhhcccccccCcHHHHHHHHHHHHHh--Ccc--------------cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh
Confidence            788888899999999999999988774  343              4456677788899999999999999998876443


Q ss_pred             CCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHH
Q 036072          466 PDGLTYNALIKLMKIQKMPDEAVRIYKEMVRSGFKPTIHTYNMIMKSYFQTGNYEMGRKVWDEMIRRGCCPDDNSYTVLI  545 (631)
Q Consensus       466 p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~Li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li  545 (631)
                       +...+..+...+.+.|++++|...|++..+.. +-+..++..+..+|...|++++|.+.++...... +.+...+..+.
T Consensus       236 -~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~  312 (388)
T d1w3ba_         236 -HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLA  312 (388)
T ss_dssp             -CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHH
T ss_pred             -HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHH
Confidence             67778888899999999999999999998864 3457888999999999999999999999988764 34788889999


Q ss_pred             HHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHhhh
Q 036072          546 GGLISQDRSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLARWAETTK  619 (631)
Q Consensus       546 ~~~~~~g~~~~A~~ll~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~~~l~~~~~~~k  619 (631)
                      ..+...|++++|++.+++.++.. +-+...+..+..+|.+.|++++|.+.+++..+... .....+...+...+
T Consensus       313 ~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P-~~~~a~~~lg~~~~  384 (388)
T d1w3ba_         313 NIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISP-TFADAYSNMGNTLK  384 (388)
T ss_dssp             HHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCT-TCHHHHHHHHHHHH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHH
Confidence            99999999999999999998753 33567788999999999999999999999876542 33445555554443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure