Citrus Sinensis ID: 036117


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRLQYLD
cHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccEEEEEcccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEEcccccccccHHHHHccccccEEEcccccccccccHHHHcccccccEEEccccccEEcccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHcccccccccccccEEEEEccccccccccccEEEcccccccccccHHcccccccccEEccccccccccEEEEEccccEEcccHHcccccccccccccccEEEEccccccccccccccEEccccEEcccccHHHHccccccEEEcccccccccccHHHHccccccccccccEEEcccccccccccHHcccccccccEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHcccccccccccccEEEEEcccccEEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccEEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEcccEEEcccccccccccHHHcccccccEEEccEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccccc
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSlvssslpswtainsnsgpcnwngiqcnevgsiseinlansgldgtldgfdfsafpnltalnlnmnnlvgsipagigNATKLILLDLssnnltnpippeigylSDLRVLLLYNnsltgqiphQLSNLQNAWLLRIGanyledpdpvkfkgmASLTDLWLDYNLLEKFPSFIAECSKLMfldlsdnlimghipieqlthlenleylnltknsfegeipreiktfpklrhlklgqnkltgtipdeigllsNLEILEFHENLfhglipsslgnLRRLQRLNlksaglnssipkelgfcANLTFLELSINNltgslplsLASLRQISELGISNNQLSEIISLQLQMndlsgklppeigllpkleYLYLFdnkfsgpipqqignltnlfdlqlannffngsipstiGNLSSLVKLSlssnqltgtlppeignsksdfgprflrNVSFsynnfsgklppgicrggnliYLTANVNklvgpipeslwnctgltrvrleqnrldgditnalgiypdlqyidlgdnqlsgvltsnwgkctnlsnfrisgnrikggipaelgnltylqnldifdnqltgkipaqlfRSSFLIRLNLRRnqlsdkipaeigklsrlqyld
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRrnqlsdkipaeigklsrlqyld
MVHRTLHFLILSYVVVQISAQKEAKAllnwksslvssslpsWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPnltalnlnmnnlVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSlgnlrrlqrlnlKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNlsslvklslssnqlTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRLQYLD
***RTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSL*******************FGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQL******************
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVS*SL*SWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRLQYLD
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRLQYLD
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRLQYLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query641 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.934 0.534 0.397 1e-103
C0LGQ5 1249 LRR receptor-like serine/ no no 0.943 0.484 0.360 4e-85
Q8VZG8 1045 Probable LRR receptor-lik no no 0.946 0.580 0.344 1e-82
Q9SHI2 1101 Leucine-rich repeat recep no no 0.951 0.554 0.348 8e-82
C0LGV1 1135 LRR receptor-like serine/ no no 0.954 0.539 0.346 2e-81
P93194 1109 Receptor-like protein kin N/A no 0.964 0.557 0.333 1e-79
Q9FL28 1173 LRR receptor-like serine/ no no 0.921 0.503 0.333 7e-77
C0LGR3 1091 Probable LRR receptor-lik no no 0.934 0.549 0.344 7e-76
Q9LHP4 1141 Receptor-like protein kin no no 0.884 0.496 0.335 9e-76
Q9LVP0 1102 Probable leucine-rich rep no no 0.953 0.554 0.336 5e-74
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  375 bits (964), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 248/624 (39%), Positives = 338/624 (54%), Gaps = 25/624 (4%)

Query: 23  EAKALLNWKSSLV-SSSLPSWTA---INSNSGPCNWNGIQCNEVGSISEINLANSGLDGT 78
           EA ALL WKS+   SS L SW      N++    +W G+ CN  GSI E+NL N+G++GT
Sbjct: 33  EANALLKWKSTFTNSSKLSSWVHDANTNTSFSCTSWYGVSCNSRGSIEELNLTNTGIEGT 92

Query: 79  LDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDL 138
              F F +  NL  ++L+MN L G+IP   GN +KLI  DLS+N+LT  I P +G L +L
Sbjct: 93  FQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKNL 152

Query: 139 RVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEK 198
            VL L+ N LT  IP +L N+++   L +  N L    P     + +L  L+L  N L  
Sbjct: 153 TVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTG 212

Query: 199 -FPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPK 257
             P  +     +  L LS N + G IP   L +L+NL  L L +N   G IP EI     
Sbjct: 213 VIPPELGNMESMTDLALSQNKLTGSIP-STLGNLKNLMVLYLYENYLTGVIPPEIGNMES 271

Query: 258 LRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLN 317
           + +L L QNKLTG+IP  +G L NL +L   +N   G IP  LGN+  +  L L +  L 
Sbjct: 272 MTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLT 331

Query: 318 SSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDL 377
            SIP  LG   NLT L L  N LTG +P          ELG     +  +I LQL  N L
Sbjct: 332 GSIPSSLGNLKNLTILYLYENYLTGVIP---------PELG----NMESMIDLQLNNNKL 378

Query: 378 SGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLS 437
           +G +P   G L  L YLYL+ N  +G IPQ++GN+ ++ +L L+ N   GS+P + GN +
Sbjct: 379 TGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFT 438

Query: 438 SLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLT 497
            L  L L  N L+G +PP + NS        L  +    NNF+G  P  +C+G  L  ++
Sbjct: 439 KLESLYLRVNHLSGAIPPGVANSS------HLTTLILDTNNFTGFFPETVCKGRKLQNIS 492

Query: 498 ANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTS 557
            + N L GPIP+SL +C  L R R   N+  GDI  A GIYPDL +ID   N+  G ++S
Sbjct: 493 LDYNHLEGPIPKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISS 552

Query: 558 NWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLN 617
           NW K   L    +S N I G IP E+ N+T L  LD+  N L G++P  +   + L RL 
Sbjct: 553 NWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLR 612

Query: 618 LRRNQLSDKIPAEIGKLSRLQYLD 641
           L  NQLS ++PA +  L+ L+ LD
Sbjct: 613 LNGNQLSGRVPAGLSFLTNLESLD 636





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
224129576 1220 predicted protein [Populus trichocarpa] 0.996 0.523 0.652 0.0
359480046 1219 PREDICTED: probable LRR receptor-like se 0.990 0.520 0.454 1e-150
359480048 1219 PREDICTED: probable LRR receptor-like se 1.0 0.525 0.451 1e-150
225438015 1219 PREDICTED: probable LRR receptor-like se 1.0 0.525 0.451 1e-149
225438011 1132 PREDICTED: probable leucine-rich repeat 0.971 0.550 0.453 1e-146
356570668 1230 PREDICTED: probable LRR receptor-like se 0.993 0.517 0.427 1e-142
356503631 1228 PREDICTED: probable LRR receptor-like se 1.0 0.521 0.423 1e-138
255571222 1224 receptor protein kinase, putative [Ricin 0.971 0.508 0.416 1e-135
224070124 1202 predicted protein [Populus trichocarpa] 0.968 0.516 0.434 1e-133
224103093 1178 predicted protein [Populus trichocarpa] 0.968 0.527 0.428 1e-132
>gi|224129576|ref|XP_002320620.1| predicted protein [Populus trichocarpa] gi|222861393|gb|EEE98935.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/693 (65%), Positives = 521/693 (75%), Gaps = 54/693 (7%)

Query: 2   VHRTLHFLILSYVVVQISAQKEAKALLNWKSSLVSSSLPSWTAINSNSGPCNWNGIQCNE 61
           + R  HFLILS   V I+AQ+EA+ LLNWK+SL   +LPSWT +NS+S PCNW GI+C+ 
Sbjct: 5   LQRIFHFLILSSAFVLITAQREAETLLNWKNSLNFPTLPSWT-LNSSSSPCNWTGIRCSG 63

Query: 62  VGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSS 121
            GSI EINL NSGLDGTLD FD S+FPNL++LNLN+NNLVG IP+GIGNATKLI LDLSS
Sbjct: 64  EGSIIEINLENSGLDGTLDRFDSSSFPNLSSLNLNLNNLVGDIPSGIGNATKLISLDLSS 123

Query: 122 NNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFK 181
           NN TN IPPEIG L +L+VL LYNNSLTG IPHQLSNLQ  WLL + ANYL DPDPV+FK
Sbjct: 124 NNFTNQIPPEIGNLKELQVLRLYNNSLTGPIPHQLSNLQKLWLLDLSANYLRDPDPVQFK 183

Query: 182 GMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTK 241
           GMASLT+L L Y LLE  P+FIAEC  L+FLDLSDNLI G IP+  L+ L+ LE+LNLTK
Sbjct: 184 GMASLTELRLSYILLEAVPAFIAECPNLIFLDLSDNLITGQIPMPLLSRLKRLEFLNLTK 243

Query: 242 NSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLG 301
           NS EG +   I  F  LRHL+LG NKL GTIP EIGLLSNLE+LE HEN F G +PSS+G
Sbjct: 244 NSVEGPLSTNIGNFRNLRHLRLGMNKLNGTIPYEIGLLSNLEVLELHENGFDGPMPSSVG 303

Query: 302 NLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISN 361
           NLR L+ LNLK +GLNSSIP+ELG C+NLT+LELS N+L G+LPLS+ASL QI E GIS+
Sbjct: 304 NLRMLRNLNLKLSGLNSSIPEELGLCSNLTYLELSSNSLIGALPLSMASLTQIREFGISD 363

Query: 362 NQL------------SEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQI 409
           N+L            SE++SLQLQ+N+ SGK+PP+IG L KL+ LYLF N+ SGPIP +I
Sbjct: 364 NKLSGNIHPSLLSNWSELVSLQLQINNFSGKVPPQIGTLHKLKLLYLFQNRLSGPIPPEI 423

Query: 410 GNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKS------- 462
           GNL+NL +LQLA+NFF GSIP TIGNLSSL KL L  NQL G LPPE+GN KS       
Sbjct: 424 GNLSNLIELQLADNFFTGSIPPTIGNLSSLTKLILPYNQLNGKLPPELGNIKSLEELDLS 483

Query: 463 ----------------------------------DFGPRFLRNVSFSYNNFSGKLPPGIC 488
                                             DFGP FLRN +FSYNNFSGKLPPGIC
Sbjct: 484 ENDLQGTLPLSITGLRNLNLFYVASNNFSGSIPEDFGPDFLRNATFSYNNFSGKLPPGIC 543

Query: 489 RGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGD 548
            GG LIYL AN N LVGPIP SL NCTGLTRVRLEQN LDGDI+NA G+YP+L+YIDLGD
Sbjct: 544 NGGKLIYLAANRNNLVGPIPSSLRNCTGLTRVRLEQNLLDGDISNAFGMYPNLEYIDLGD 603

Query: 549 NQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLF 608
           N+LSG+L+SNWG+CT LSNFRI+GN + G IP ELGNLT LQNLD+  NQL GKIP +LF
Sbjct: 604 NRLSGMLSSNWGQCTILSNFRIAGNIMSGNIPPELGNLTELQNLDLSGNQLIGKIPIELF 663

Query: 609 RSSFLIRLNLRRNQLSDKIPAEIGKLSRLQYLD 641
            SS L R NL  NQLS  IP E+G LS+LQYLD
Sbjct: 664 SSSKLNRFNLSNNQLSGHIPEEVGMLSQLQYLD 696




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359480046|ref|XP_002270822.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480048|ref|XP_003632391.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438015|ref|XP_002270968.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438011|ref|XP_002270684.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570668|ref|XP_003553507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|356503631|ref|XP_003520610.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|255571222|ref|XP_002526561.1| receptor protein kinase, putative [Ricinus communis] gi|223534122|gb|EEF35839.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224070124|ref|XP_002303118.1| predicted protein [Populus trichocarpa] gi|222844844|gb|EEE82391.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103093|ref|XP_002334092.1| predicted protein [Populus trichocarpa] gi|222869551|gb|EEF06682.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.815 0.466 0.370 5e-83
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.917 0.530 0.325 3e-75
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.912 0.468 0.331 5.7e-72
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.695 0.426 0.362 6.2e-70
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.921 0.526 0.311 2.1e-69
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.828 0.487 0.335 1.2e-67
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.820 0.420 0.335 5.3e-67
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.917 0.501 0.324 1.1e-66
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.867 0.487 0.326 1.2e-66
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.950 0.536 0.314 8.7e-66
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 832 (297.9 bits), Expect = 5.0e-83, P = 5.0e-83
 Identities = 201/542 (37%), Positives = 280/542 (51%)

Query:   112 TKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANY 171
             + L  +DLS N L+  IPP+ G LS L    L  N LTG+I   L NL+N  +L +  NY
Sbjct:   102 SNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNY 161

Query:   172 LEDPDPVKFKGMASLTDLWLDYNLLE-KFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTH 230
             L    P +   M S+TDL L  N L    PS +     LM L L +N + G IP E L +
Sbjct:   162 LTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPE-LGN 220

Query:   231 LENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHEN 290
             +E++  L L++N   G IP  +     L  L L +N LTG IP EIG + ++  L   +N
Sbjct:   221 MESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQN 280

Query:   291 LFHGLIPSSXXXXXXXXXXXXKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLAS 350
                G IPSS                L   IP +LG   ++  LELS N LTGS+P SL +
Sbjct:   281 KLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGN 340

Query:   351 LRQISELGISNNQLSEII-----------SLQLQMNDLSGKLPPEIGLLPKLEYLYLFDN 399
             L+ ++ L +  N L+ +I            LQL  N L+G +P   G L  L YLYL+ N
Sbjct:   341 LKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLN 400

Query:   400 KFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNXXXXXXXXXXXXXXTGTLPPEIGN 459
               +G IPQ++GN+ ++ +L L+ N   GS+P + GN              +G +PP + N
Sbjct:   401 YLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVAN 460

Query:   460 SKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTR 519
             S        L  +    NNF+G  P  +C+G  L  ++ + N L GPIP+SL +C  L R
Sbjct:   461 SSH------LTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSLIR 514

Query:   520 VRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGI 579
              R   N+  GDI  A GIYPDL +ID   N+  G ++SNW K   L    +S N I G I
Sbjct:   515 ARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAI 574

Query:   580 PAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRLQY 639
             P E+ N+T L  LD+  N L G++P  +   + L RL L  NQLS ++PA +  L+ L+ 
Sbjct:   575 PTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRVPAGLSFLTNLES 634

Query:   640 LD 641
             LD
Sbjct:   635 LD 636


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-89
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-57
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-52
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  297 bits (762), Expect = 3e-89
 Identities = 212/636 (33%), Positives = 312/636 (49%), Gaps = 80/636 (12%)

Query: 5   TLHFLILSYVVVQISAQKEAKALLNWKSSLVSSS--LPSWTAINSNSGPCNWNGIQCNEV 62
            L FL L++    +   +E + LL++KSS+      L +W   NS++  C W GI CN  
Sbjct: 15  MLFFLFLNF---SMLHAEELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGITCNNS 68

Query: 63  GSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGI-GNATKLILLDLSS 121
             +  I+L+   + G +    F   P +  +NL+ N L G IP  I   ++ L  L+LS+
Sbjct: 69  SRVVSIDLSGKNISGKISSAIFR-LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSN 127

Query: 122 NNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDPDPVKFK 181
           NN T  IP   G + +L  L L NN L+G+IP+                           
Sbjct: 128 NNFTGSIPR--GSIPNLETLDLSNNMLSGEIPND-------------------------- 159

Query: 182 GMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTK 241
                                I   S L  LDL  N+++G IP   LT+L +LE+L L  
Sbjct: 160 ---------------------IGSFSSLKVLDLGGNVLVGKIPN-SLTNLTSLEFLTLAS 197

Query: 242 NSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLG 301
           N   G+IPRE+     L+ + LG N L+G IP EIG L++L  L+   N   G IPSSLG
Sbjct: 198 NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG 257

Query: 302 NLRRLQRLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISELGISN 361
           NL+ LQ L L    L+  IP  +     L  L+LS N+L+G +P  +  L+ +       
Sbjct: 258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNL------- 310

Query: 362 NQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLA 421
               EI  L L  N+ +GK+P  +  LP+L+ L L+ NKFSG IP+ +G   NL  L L+
Sbjct: 311 ----EI--LHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLS 364

Query: 422 NNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSG 481
            N   G IP  + +  +L KL L SN L G +P  +G  +S      LR V    N+FSG
Sbjct: 365 TNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS------LRRVRLQDNSFSG 418

Query: 482 KLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDL 541
           +LP    +   + +L  + N L G I    W+   L  + L +N+  G + ++ G    L
Sbjct: 419 ELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG-SKRL 477

Query: 542 QYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTG 601
           + +DL  NQ SG +    G  + L   ++S N++ G IP EL +   L +LD+  NQL+G
Sbjct: 478 ENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSG 537

Query: 602 KIPAQLFRSSFLIRLNLRRNQLSDKIPAEIGKLSRL 637
           +IPA       L +L+L +NQLS +IP  +G +  L
Sbjct: 538 QIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESL 573


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 641
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PLN03150623 hypothetical protein; Provisional 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
PLN03150623 hypothetical protein; Provisional 99.13
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.45
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.32
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.14
KOG4341483 consensus F-box protein containing LRR [General fu 97.93
PRK15386 426 type III secretion protein GogB; Provisional 97.92
PRK15386 426 type III secretion protein GogB; Provisional 97.91
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.91
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG4341483 consensus F-box protein containing LRR [General fu 97.62
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.57
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.23
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.77
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.44
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.77
KOG4308 478 consensus LRR-containing protein [Function unknown 94.19
KOG4308478 consensus LRR-containing protein [Function unknown 92.45
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.95
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.4
smart0037026 LRR Leucine-rich repeats, outliers. 88.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.84
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.43
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.09
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.31
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.07
smart0037026 LRR Leucine-rich repeats, outliers. 84.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.44
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.2e-68  Score=613.59  Aligned_cols=579  Identities=31%  Similarity=0.496  Sum_probs=516.6

Q ss_pred             CcHHHHHHHHHHHhcCCCCC--CCCCCCCCCCCCCccccceeeCCCCCEEEEEcCCCCCccccCCcCCCCCCCCCEEECC
Q 036117           19 SAQKEAKALLNWKSSLVSSS--LPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLN   96 (641)
Q Consensus        19 ~~~~~~~~l~~~~~~~~~~~--~~~W~~~~~~~~~c~~~gv~c~~~~~v~~l~l~~~~~~~~~~~~~~~~l~~L~~L~L~   96 (641)
                      ..++|+.||++||+++..+.  ..+|...   .+||.|.|+.|+..++|+.|+++++++.+.++ ..|..+++|++|+|+
T Consensus        26 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~---~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~-~~~~~l~~L~~L~Ls  101 (968)
T PLN00113         26 LHAEELELLLSFKSSINDPLKYLSNWNSS---ADVCLWQGITCNNSSRVVSIDLSGKNISGKIS-SAIFRLPYIQTINLS  101 (968)
T ss_pred             CCHHHHHHHHHHHHhCCCCcccCCCCCCC---CCCCcCcceecCCCCcEEEEEecCCCccccCC-hHHhCCCCCCEEECC
Confidence            36689999999999986443  6789654   68999999999988899999999999998887 789999999999999


Q ss_pred             CCCCCccCchhcc-CCCCCCEEECCCCcCCCCCccccCCCCCCCEEEcccccCCCCCChhccCCCCCcEEEeccccCCCC
Q 036117           97 MNNLVGSIPAGIG-NATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIGANYLEDP  175 (641)
Q Consensus        97 ~n~~~~~~~~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~  175 (641)
                      +|.+.+.+|..+. .+++|++|++++|.+++.+|.  +.+++|++|++++|.+.+.+|..++++++|++|++++|.+.+.
T Consensus       102 ~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~  179 (968)
T PLN00113        102 NNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGK  179 (968)
T ss_pred             CCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccccc
Confidence            9999988887765 899999999999999988885  5689999999999999999999999999999999999999988


Q ss_pred             CCcccCCCCCCCEEEcCCCCC-CCCchhhcCCCCCcEEEeeCCcCCCCCChhhhcCCCCCcEEeccCCcccccCCcccCC
Q 036117          176 DPVKFKGMASLTDLWLDYNLL-EKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKT  254 (641)
Q Consensus       176 ~~~~l~~l~~L~~L~l~~~~~-~~l~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~  254 (641)
                      .+..+.++++|++|++++|.+ +.+|..+.++++|++|++++|.+.+.+|..+ .++++|++|++++|.+.+.+|..+..
T Consensus       180 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~l~~  258 (968)
T PLN00113        180 IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEI-GGLTSLNHLDLVYNNLTGPIPSSLGN  258 (968)
T ss_pred             CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhH-hcCCCCCEEECcCceeccccChhHhC
Confidence            899999999999999999998 5778999999999999999999988777654 89999999999999999899999999


Q ss_pred             CCCCCEEEcCCCcCCccCCcccCCCCcccEeeeecccccccCccccCCCCCCCeeeccCccCCCCCCcCCCCCCCCCEEE
Q 036117          255 FPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFCANLTFLE  334 (641)
Q Consensus       255 l~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~  334 (641)
                      +++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|.+.+..|..+..+++|+.|+
T Consensus       259 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~  338 (968)
T PLN00113        259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQ  338 (968)
T ss_pred             CCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEE
Confidence            99999999999999988898899999999999999999999999999999999999999999888888899999999999


Q ss_pred             ccCccccccCchhhhcCCCCCeEeCCcccccccceeecccccccccCCcCCCCCCCCCEEEccCCcCcCCchhhhhCCCC
Q 036117          335 LSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTN  414 (641)
Q Consensus       335 l~~n~l~~~~~~~l~~~~~L~~L~l~~n~~~~l~~l~l~~~~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~l~~  414 (641)
                      +++|.+.+.+|..+..+++|+.|++++             |.+.+.+|..++.+++|+.|++++|.+.+.+|..+..+++
T Consensus       339 L~~n~l~~~~p~~l~~~~~L~~L~Ls~-------------n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~  405 (968)
T PLN00113        339 LWSNKFSGEIPKNLGKHNNLTVLDLST-------------NNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS  405 (968)
T ss_pred             CcCCCCcCcCChHHhCCCCCcEEECCC-------------CeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCC
Confidence            999999999999999888888888554             4555667888888899999999999999999999999999


Q ss_pred             CCeEecccCcCCccCcccccCCCCCCEEEccCCcCcccCCcchhcCCCCCCCCCccEEEccCCcccccCCccccCCCCCc
Q 036117          415 LFDLQLANNFFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLI  494 (641)
Q Consensus       415 L~~L~l~~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~~~L~  494 (641)
                      |+.|++++|.+++.+|..+..+++|+.+++++|.+++.+|..+..++      +|+.|++++|++.+.+|..+ ..++|+
T Consensus       406 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~------~L~~L~L~~n~~~~~~p~~~-~~~~L~  478 (968)
T PLN00113        406 LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMP------SLQMLSLARNKFFGGLPDSF-GSKRLE  478 (968)
T ss_pred             CCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCC------CCcEEECcCceeeeecCccc-ccccce
Confidence            99999999999988898899999999999999999988887777666      89999999999988888755 457899


Q ss_pred             eEeccCCcccCCCccccccCCCCcEEECCCCcCccccCcccCCCCCCcEEeCCCCcccccCChhhhcCCCCCEEeCcCCc
Q 036117          495 YLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNR  574 (641)
Q Consensus       495 ~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~L~~n~  574 (641)
                      .|++++|++.+.+|..+.++++|+.|++++|.+.+.+|..++.+++|++|+|++|.+++.+|..+..+++|+.|++++|+
T Consensus       479 ~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~  558 (968)
T PLN00113        479 NLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQ  558 (968)
T ss_pred             EEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCc
Confidence            99999999999999888999999999999999999999989999999999999999999999999999999999999999


Q ss_pred             CcccCCccccCCCCCCEEeCCCCcCcccCCccccCCCCCCEEeCcCCC-Ccc
Q 036117          575 IKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQ-LSD  625 (641)
Q Consensus       575 l~~~~p~~l~~l~~L~~L~L~~n~l~~~ip~~l~~~~~L~~l~l~~n~-l~~  625 (641)
                      +.+.+|..+.++++|+.|++++|++.|.+|.. ..+..+....+.+|+ ++|
T Consensus       559 l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~  609 (968)
T PLN00113        559 LSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDLCG  609 (968)
T ss_pred             ccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCccccC
Confidence            99999999999999999999999999988864 334445555666776 444



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-36
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-31
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-36
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-31
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-15
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-05
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-04
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-04
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 2e-04
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 4e-04
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 6e-04
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 8e-04
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 146 bits (369), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 174/608 (28%), Positives = 269/608 (44%), Gaps = 97/608 (15%) Query: 46 NSNSGPCNWNGIQCNEVGSISEINLANSGLDGTLDGFDFSAFPXXXXXXXXXXXXV---- 101 +SN PC ++G+ C + ++ I+L++ L+ FSA Sbjct: 31 SSNKNPCTFDGVTCRD-DKVTSIDLSSKPLN-----VGFSAVSSSLLSLTGLESLFLSNS 84 Query: 102 ---GSIPAGIGNATKLILLDLSSNNLTNPIPP--EIGYLSDLRVLLLYNNSLTGQIPHQL 156 GS+ +G + L LDLS N+L+ P+ +G S L+ L + +N+L P ++ Sbjct: 85 HINGSV-SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTL--DFPGKV 141 Query: 157 S---NLQNAWLLRIGANYLEDPDPVKF---KGMASLTDLWLDYNLLEKFPSFIAECSKLM 210 S L + +L + AN + + V + G L L + N + ++ C L Sbjct: 142 SGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD-VSRCVNLE 200 Query: 211 FLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTG 270 FLD+S N IP L L++L+++ N G+ R I T +L+ L + N+ G Sbjct: 201 FLDVSSNNFSTGIPF--LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG 258 Query: 271 TIPDEIGLLSNLEILEFHENLFHGLIPSSXXXXXXXXXXXXKSAGLNSSIPKEL-GFCAN 329 IP L +L+ L EN F G IP L G C Sbjct: 259 PIPPLP--LKSLQYLSLAENKFTG------------------------EIPDFLSGACDT 292 Query: 330 LTFLELSINNLTGSLPLSLASLRQISELGISNNQLSEIISLQLQMNDLSGKLPPEIGL-L 388 LT L+LS N+ G++P S + SL L N+ SG+LP + L + Sbjct: 293 LTGLDLSGNHFYGAVPPFFGSCSLLE-------------SLALSSNNFSGELPMDTLLKM 339 Query: 389 PKLEYLYLFDNKFSGPIPQQIGNLT-NLFDLQLANNFFNGSIPSTIGNXXXXXXXXXXXX 447 L+ L L N+FSG +P+ + NL+ +L L L++N F+G I Sbjct: 340 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI------------------ 381 Query: 448 XXTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPI 507 LP N K+ +L+N N F+GK+PP + L+ L + N L G I Sbjct: 382 -----LPNLCQNPKNTLQELYLQN-----NGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 431 Query: 508 PESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQYIDLGDNQLSGVLTSNWGKCTNLSN 567 P SL + + L ++L N L+G+I L L+ + L N L+G + S CTNL+ Sbjct: 432 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNW 491 Query: 568 FRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRLNLRRNQLSDKI 627 +S NR+ G IP +G L L L + +N +G IPA+L LI L+L N + I Sbjct: 492 ISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTI 551 Query: 628 PAEIGKLS 635 PA + K S Sbjct: 552 PAAMFKQS 559
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-150
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-136
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-133
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-100
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-80
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-73
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-71
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-38
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-69
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-66
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-53
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-46
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-44
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-37
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-28
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-17
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  451 bits (1162), Expect = e-150
 Identities = 181/640 (28%), Positives = 283/640 (44%), Gaps = 51/640 (7%)

Query: 19  SAQKEAKALLNWKSSLVSSS-LPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDG 77
           S  +E   L+++K  L   + LP W   +SN  PC ++G+ C +   ++ I+L++  L+ 
Sbjct: 9   SLYREIHQLISFKDVLPDKNLLPDW---SSNKNPCTFDGVTCRD-DKVTSIDLSSKPLNV 64

Query: 78  TLDGF--DFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPP--EIG 133
                     +   L +L L+ +++ GS+  G   +  L  LDLS N+L+ P+     +G
Sbjct: 65  GFSAVSSSLLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSRNSLSGPVTTLTSLG 123

Query: 134 YLSDLRVLLLYNNSLTGQIP-HQLSNLQNAWLLRIGANYLEDPDPVKFK---GMASLTDL 189
             S L+ L + +N+L           L +  +L + AN +   + V +    G   L  L
Sbjct: 124 SCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHL 183

Query: 190 WLDYNLLE-KFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGEI 248
            +  N +       ++ C  L FLD+S N     IP   L     L++L+++ N   G+ 
Sbjct: 184 AISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIP--FLGDCSALQHLDISGNKLSGDF 239

Query: 249 PREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSL-GNLRRLQ 307
            R I T  +L+ L +  N+  G IP     L +L+ L   EN F G IP  L G    L 
Sbjct: 240 SRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPDFLSGACDTLT 297

Query: 308 RLNLKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPL-SLASLRQISELGISNNQLSE 366
            L+L       ++P   G C+ L  L LS NN +G LP+ +L  +R +  L +S N+ S 
Sbjct: 298 GLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS- 356

Query: 367 IISLQLQMNDLSGKLPPEIG-LLPKLEYLYLFDNKFSGPIPQQIGN--LTNLFDLQLANN 423
                       G+LP  +  L   L  L L  N FSGPI   +       L +L L NN
Sbjct: 357 ------------GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 404

Query: 424 FFNGSIPSTIGNLSSLVKLSLSSNQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKL 483
            F G IP T+ N S LV L LS N L+GT+P  +G+         LR++    N   G++
Sbjct: 405 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK------LRDLKLWLNMLEGEI 458

Query: 484 PPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNRLDGDITNALGIYPDLQY 543
           P  +     L  L  + N L G IP  L NCT L  + L  NRL G+I   +G   +L  
Sbjct: 459 PQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAI 518

Query: 544 IDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKI 603
           + L +N  SG + +  G C +L    ++ N   G IPA +   +      I  N + GK 
Sbjct: 519 LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS----GKIAANFIAGKR 574

Query: 604 PAQLFRSSFLIRLNLRRN--QLSDKIPAEIGKLSRLQYLD 641
              +         +   N  +       ++ +LS     +
Sbjct: 575 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN 614


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.9
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.4
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.03
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-80  Score=698.08  Aligned_cols=601  Identities=31%  Similarity=0.483  Sum_probs=514.9

Q ss_pred             HhhcCcHHHHHHHHHHHhcCCCCC-CCCCCCCCCCCCCccccceeeCCCCCEEEEEcCCCCCccc---cCC---------
Q 036117           15 VVQISAQKEAKALLNWKSSLVSSS-LPSWTAINSNSGPCNWNGIQCNEVGSISEINLANSGLDGT---LDG---------   81 (641)
Q Consensus        15 ~~~~~~~~~~~~l~~~~~~~~~~~-~~~W~~~~~~~~~c~~~gv~c~~~~~v~~l~l~~~~~~~~---~~~---------   81 (641)
                      +.+++.++|+.||++||+++.++. +++|...   +|||.|.||.|+ .++|++|+|+++++.|.   ++.         
T Consensus         5 ~~~~~~~~~~~all~~k~~~~~~~~l~~W~~~---~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~   80 (768)
T 3rgz_A            5 SPSQSLYREIHQLISFKDVLPDKNLLPDWSSN---KNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLE   80 (768)
T ss_dssp             ---CCHHHHHHHHHHHHTTCSCTTSSTTCCTT---SCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCC
T ss_pred             ccccCCHHHHHHHHHHHhhCCCcccccCCCCC---CCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCccc
Confidence            444567889999999999997554 8899754   689999999998 78999999999999886   431         


Q ss_pred             -------------cCCCCCCCCCEEECCCCCCCccCch--hccCCCCCCEEECCCCcCCCCCcccc-CCCCCCCEEEccc
Q 036117           82 -------------FDFSAFPNLTALNLNMNNLVGSIPA--GIGNATKLILLDLSSNNLTNPIPPEI-GYLSDLRVLLLYN  145 (641)
Q Consensus        82 -------------~~~~~l~~L~~L~L~~n~~~~~~~~--~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~l~~  145 (641)
                                   ..++.+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+.+..|..+ .++++|++|++++
T Consensus        81 ~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~  160 (768)
T 3rgz_A           81 SLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSA  160 (768)
T ss_dssp             EEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCS
T ss_pred             ccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCC
Confidence                         3577788888888888888877777  78888888888888888887777665 7788888888888


Q ss_pred             ccCCCCCChh---ccCCCCCcEEEeccccCCCCCCcccCCCCCCCEEEcCCCCCCCCchhhcCCCCCcEEEeeCCcCCCC
Q 036117          146 NSLTGQIPHQ---LSNLQNAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKLMFLDLSDNLIMGH  222 (641)
Q Consensus       146 n~~~~~~~~~---l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~l~~~l~~~~~L~~L~l~~~~~~~~  222 (641)
                      |.+++..|..   +.++++|++|++++|.+.+..+  +..+++|++|++++|.+...+..+.++++|++|++++|.+.+.
T Consensus       161 n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~  238 (768)
T 3rgz_A          161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGD  238 (768)
T ss_dssp             SCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSC
T ss_pred             CccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCc
Confidence            8888777766   7788888888888888776544  3778889999999888855433488888999999999888866


Q ss_pred             CChhhhcCCCCCcEEeccCCcccccCCcccCCCCCCCEEEcCCCcCCccCCcccCCC-CcccEeeeecccccccCccccC
Q 036117          223 IPIEQLTHLENLEYLNLTKNSFEGEIPREIKTFPKLRHLKLGQNKLTGTIPDEIGLL-SNLEILEFHENLFHGLIPSSLG  301 (641)
Q Consensus       223 ~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~L~~~~l~~~~~~~l~~~-~~L~~L~l~~n~~~~~~~~~l~  301 (641)
                      ++. .+..+++|++|++++|.+.+.+|..  .+++|++|++++|.+.+.+|..+... ++|++|++++|.+.+.+|..+.
T Consensus       239 ~~~-~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~  315 (768)
T 3rgz_A          239 FSR-AISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFG  315 (768)
T ss_dssp             HHH-HTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGG
T ss_pred             ccH-HHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHh
Confidence            554 4588889999999999888777664  78889999999998888888877664 8899999999999888888899


Q ss_pred             CCCCCCeeeccCccCCCCCCcC-CCCCCCCCEEEccCccccccCchhhhcCC-CCCeEeCCccccc-------------c
Q 036117          302 NLRRLQRLNLKSAGLNSSIPKE-LGFCANLTFLELSINNLTGSLPLSLASLR-QISELGISNNQLS-------------E  366 (641)
Q Consensus       302 ~l~~L~~L~l~~~~~~~~~~~~-l~~~~~L~~L~l~~n~l~~~~~~~l~~~~-~L~~L~l~~n~~~-------------~  366 (641)
                      .+++|++|++++|.+.+.+|.. +..+++|++|++++|++++.+|..+..++ +|+.|++++|.+.             .
T Consensus       316 ~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~  395 (768)
T 3rgz_A          316 SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNT  395 (768)
T ss_dssp             GCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCC
T ss_pred             cCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCC
Confidence            9999999999999888777765 78889999999999999888888888887 8999999988753             5


Q ss_pred             cceeecccccccccCCcCCCCCCCCCEEEccCCcCcCCchhhhhCCCCCCeEecccCcCCccCcccccCCCCCCEEEccC
Q 036117          367 IISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANNFFNGSIPSTIGNLSSLVKLSLSS  446 (641)
Q Consensus       367 l~~l~l~~~~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~ls~  446 (641)
                      ++.+++++|.+.+.+|..++.+++|++|++++|++++.+|..+..+++|+.|++++|.+.+.+|..+..+++|++|++++
T Consensus       396 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~  475 (768)
T 3rgz_A          396 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF  475 (768)
T ss_dssp             CCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCS
T ss_pred             ccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecC
Confidence            88899999999999999999999999999999999988999999999999999999999988999999999999999999


Q ss_pred             CcCcccCCcchhcCCCCCCCCCccEEEccCCcccccCCccccCCCCCceEeccCCcccCCCccccccCCCCcEEECCCCc
Q 036117          447 NQLTGTLPPEIGNSKSDFGPRFLRNVSFSYNNFSGKLPPGICRGGNLIYLTANVNKLVGPIPESLWNCTGLTRVRLEQNR  526 (641)
Q Consensus       447 n~l~~~~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~  526 (641)
                      |.+++.+|..+..++      +|++|++++|++++.+|.++..+++|++|++++|++.+.+|..+.++++|++|++++|+
T Consensus       476 N~l~~~~p~~l~~l~------~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~  549 (768)
T 3rgz_A          476 NDLTGEIPSGLSNCT------NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL  549 (768)
T ss_dssp             SCCCSCCCGGGGGCT------TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSE
T ss_pred             CcccCcCCHHHhcCC------CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCc
Confidence            999999999888888      89999999999999999999999999999999999999999999999999999999998


Q ss_pred             CccccCcc----------------------------------------------------------------------cC
Q 036117          527 LDGDITNA----------------------------------------------------------------------LG  536 (641)
Q Consensus       527 l~~~~~~~----------------------------------------------------------------------~~  536 (641)
                      +.|.+|..                                                                      ++
T Consensus       550 l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~  629 (768)
T 3rgz_A          550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD  629 (768)
T ss_dssp             EESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCS
T ss_pred             cCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhh
Confidence            88766643                                                                      33


Q ss_pred             CCCCCcEEeCCCCcccccCChhhhcCCCCCEEeCcCCcCcccCCccccCCCCCCEEeCCCCcCcccCCccccCCCCCCEE
Q 036117          537 IYPDLQYIDLGDNQLSGVLTSNWGKCTNLSNFRISGNRIKGGIPAELGNLTYLQNLDIFDNQLTGKIPAQLFRSSFLIRL  616 (641)
Q Consensus       537 ~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~ip~~l~~~~~L~~l  616 (641)
                      .+++|+.||+++|+++|.+|..+++++.|+.|+|++|+++|.+|..++++++|++|||++|+++|.+|..+..+++|++|
T Consensus       630 ~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L  709 (768)
T 3rgz_A          630 NNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI  709 (768)
T ss_dssp             SSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEE
T ss_pred             ccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEE
Confidence            45678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCcCCCCcccCccc
Q 036117          617 NLRRNQLSDKIPAE  630 (641)
Q Consensus       617 ~l~~n~l~~~~p~~  630 (641)
                      ++++|+++|.||..
T Consensus       710 ~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          710 DLSNNNLSGPIPEM  723 (768)
T ss_dssp             ECCSSEEEEECCSS
T ss_pred             ECcCCcccccCCCc
Confidence            99999999999964



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 641
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-15
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 9e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 93.1 bits (230), Expect = 6e-21
 Identities = 69/384 (17%), Positives = 127/384 (33%), Gaps = 34/384 (8%)

Query: 82  FDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVL 141
           F  +A        L   N+  ++     +  ++  L      + +     + YL++L  +
Sbjct: 16  FTDTALAEKMKTVLGKTNVTDTVS--QTDLDQVTTLQADRLGIKS--IDGVEYLNNLTQI 71

Query: 142 LLYNNSLTGQIP-HQLSNLQ----NAWLLRIGANYLEDPDPVKFKGMASLTDLWLDYNLL 196
              NN LT   P   L+ L     N   +          +        +          L
Sbjct: 72  NFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNL 131

Query: 197 EKFPSFIAECSKLMFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSF------EGEIPR 250
                     + +  +     L             +     NLT          +     
Sbjct: 132 TNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDIS 191

Query: 251 EIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLN 310
            +     L  L    N+++   P  I   +NL+ L  + N        +L +L  L  L+
Sbjct: 192 VLAKLTNLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLD 247

Query: 311 LKSAGLNSSIPKELGFCANLTFLELSINNLTGSLPLSLASLRQISEL-------GISNNQ 363
           L +  +++  P  L     LT L+L  N ++   PL+  +     EL           + 
Sbjct: 248 LANNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISN 305

Query: 364 LSEIISLQLQMNDLSGKLPPEIGLLPKLEYLYLFDNKFSGPIPQQIGNLTNLFDLQLANN 423
           L  +  L L  N++S      +  L KL+ L+  +NK S      + NLTN+  L   +N
Sbjct: 306 LKNLTYLTLYFNNISD--ISPVSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHN 361

Query: 424 FFNGSIPSTIGNLSSLVKLSLSSN 447
             +   P  + NL+ + +L L+  
Sbjct: 362 QISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.44
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.4
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=2.2e-36  Score=301.05  Aligned_cols=291  Identities=26%  Similarity=0.444  Sum_probs=197.8

Q ss_pred             cCcHHHHHHHHHHHhcCCCCC-CCCCCCCCCCCCCcc--ccceeeCCC---CCEEEEEcCCCCCccc--cCCcCCCCCCC
Q 036117           18 ISAQKEAKALLNWKSSLVSSS-LPSWTAINSNSGPCN--WNGIQCNEV---GSISEINLANSGLDGT--LDGFDFSAFPN   89 (641)
Q Consensus        18 ~~~~~~~~~l~~~~~~~~~~~-~~~W~~~~~~~~~c~--~~gv~c~~~---~~v~~l~l~~~~~~~~--~~~~~~~~l~~   89 (641)
                      -|.++|++||++||+++..+. +++|...   +|||.  |.||.|+..   +||++|+|+++++.|.  +| ..++++++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~---~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp-~~l~~L~~   77 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT---TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIP-SSLANLPY   77 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT---SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECC-GGGGGCTT
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCC---CCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCC-hHHhcCcc
Confidence            488999999999999997665 7899754   79994  999999863   4799999999888763  45 66777777


Q ss_pred             CCEEECCC-CCCCccCchhccCCCCCCEEECCCCcCCCCCccccCCCCCCCEEEcccccCCCCCChhccCCCCCcEEEec
Q 036117           90 LTALNLNM-NNLVGSIPAGIGNATKLILLDLSSNNLTNPIPPEIGYLSDLRVLLLYNNSLTGQIPHQLSNLQNAWLLRIG  168 (641)
Q Consensus        90 L~~L~L~~-n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~  168 (641)
                      |++|+|++ |.+.|.+|..++++++|++|++++|++.+..+..+..+.+|+++++++|.+.+.+|..+.+++++++++++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~  157 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD  157 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecc
Confidence            77777775 66777777777777777777777777776666667777777777777777766677777777777777776


Q ss_pred             cccCCCCCCcccCCCCCCCEEEcCCCCCCCCchhhcCCCCC-cEEEeeCCcCCCCCChhhhcCCCCCcEEeccCCccccc
Q 036117          169 ANYLEDPDPVKFKGMASLTDLWLDYNLLEKFPSFIAECSKL-MFLDLSDNLIMGHIPIEQLTHLENLEYLNLTKNSFEGE  247 (641)
Q Consensus       169 ~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~l~~~l~~~~~L-~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~~~  247 (641)
                      +|.+.+..                       |..+..+.++ +.+++++|.+.+..+.. +..+.. ..++++.+...+.
T Consensus       158 ~n~l~~~i-----------------------p~~~~~l~~l~~~l~~~~n~l~~~~~~~-~~~l~~-~~l~l~~~~~~~~  212 (313)
T d1ogqa_         158 GNRISGAI-----------------------PDSYGSFSKLFTSMTISRNRLTGKIPPT-FANLNL-AFVDLSRNMLEGD  212 (313)
T ss_dssp             SSCCEEEC-----------------------CGGGGCCCTTCCEEECCSSEEEEECCGG-GGGCCC-SEEECCSSEEEEC
T ss_pred             cccccccc-----------------------cccccccccccccccccccccccccccc-cccccc-ccccccccccccc
Confidence            66665444                       4444444443 55555555555444432 233332 3566666666666


Q ss_pred             CCcccCCCCCCCEEEcCCCcCCccCCcccCCCCcccEeeeecccccccCccccCCCCCCCeeeccCccCCCCCCcCCCCC
Q 036117          248 IPREIKTFPKLRHLKLGQNKLTGTIPDEIGLLSNLEILEFHENLFHGLIPSSLGNLRRLQRLNLKSAGLNSSIPKELGFC  327 (641)
Q Consensus       248 ~~~~l~~l~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~  327 (641)
                      +|..+..+++++.+++.++.+.+.++ .+..+++|+.|++++|++++.+|..+.++++|++|++++|+++|.+|. ++.+
T Consensus       213 ~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L  290 (313)
T d1ogqa_         213 ASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNL  290 (313)
T ss_dssp             CGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTG
T ss_pred             cccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccC
Confidence            66666666666666666666664433 355666666666666666666666666666666666666666665553 4556


Q ss_pred             CCCCEEEccCcc
Q 036117          328 ANLTFLELSINN  339 (641)
Q Consensus       328 ~~L~~L~l~~n~  339 (641)
                      ++|+.+++++|+
T Consensus       291 ~~L~~l~l~~N~  302 (313)
T d1ogqa_         291 QRFDVSAYANNK  302 (313)
T ss_dssp             GGSCGGGTCSSS
T ss_pred             CCCCHHHhCCCc
Confidence            666666666665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure