Citrus Sinensis ID: 036160


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-
MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG
ccHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEcHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHccccccEEHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEcc
cHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEcc
MELAKRVFKSMPELNVVSWNALLNgyaesgdgqkVMHLFCSMKDMEKKFSKFSLSTVLKGfansgyikaGQVVHAMAIRLGCALDKFLSCSlvdmyskcgladnALKVFyrikdpdvvaWGAIITCLDQQGCCQEAAKIFNLmressvkpnqFVLTSLVRATtetgdqrcgeSIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFsrfqdyespdqGLRIFYQMLLKGFKPNMCTFIVILKACsslsdvgfgkqlHAHTIkhsldgnhvvGTSLVDmydksgcledagvAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASClngcspvatlanGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFkgsalrdtaSWNMMIGGYVKHGLGEKALEAFRMMLdegyvpdeITFVVVLSACSHMGLIEEGKKHFSSIKKiygitptiKHFACMIDILgragkfteIENFitetkltpnALVWENLLGACswhgnieldEKDAEKLLElepkmesnyvfpsdisatqgrwnDFSGVRALLssqgikkepscswievdg
melakrvfksmpelNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMressvkpnqFVLTSLVRATtetgdqrcGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALlssqgikkepscswievdg
MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIeldekdaekllelePKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG
**********MPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEK****LL********NYVFPSDISATQGRWNDFSGVRALL******************
MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG
MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG
MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query601 2.2.26 [Sep-21-2011]
Q9SVP7 1064 Pentatricopeptide repeat- yes no 0.988 0.558 0.332 1e-107
Q9SS831028 Pentatricopeptide repeat- no no 0.996 0.582 0.353 1e-105
P93005727 Pentatricopeptide repeat- no no 0.991 0.819 0.342 1e-105
Q9S7F4 825 Putative pentatricopeptid no no 0.983 0.716 0.340 1e-102
Q9SVA5834 Pentatricopeptide repeat- no no 0.996 0.718 0.321 1e-101
Q9LU94701 Putative pentatricopeptid no no 0.991 0.850 0.332 1e-100
O81767 823 Pentatricopeptide repeat- no no 0.980 0.715 0.338 1e-100
Q9ZUW3 868 Pentatricopeptide repeat- no no 0.980 0.678 0.345 2e-99
Q3E6Q1 809 Pentatricopeptide repeat- no no 0.990 0.735 0.323 8e-97
Q9LFL5 850 Pentatricopeptide repeat- no no 0.970 0.685 0.315 1e-96
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function desciption
 Score =  389 bits (999), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/596 (33%), Positives = 328/596 (55%)

Query: 4   AKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFAN 63
           A+ +F +M + + V++N L+NG ++ G G+K M LF  M     +    +L++++   + 
Sbjct: 342 AEHIFSNMSQRDAVTYNTLINGLSQCGYGEKAMELFKRMHLDGLEPDSNTLASLVVACSA 401

Query: 64  SGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAI 123
            G +  GQ +HA   +LG A +  +  +L+++Y+KC   + AL  F   +  +VV W  +
Sbjct: 402 DGTLFRGQQLHAYTTKLGFASNNKIEGALLNLYAKCADIETALDYFLETEVENVVLWNVM 461

Query: 124 ITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGF 183
           +         + + +IF  M+   + PNQ+   S+++     GD   GE IH+ I K  F
Sbjct: 462 LVAYGLLDDLRNSFRIFRQMQIEEIVPNQYTYPSILKTCIRLGDLELGEQIHSQIIKTNF 521

Query: 184 ESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQ 243
           + +  V + L+ MY + G++     +    A +D VSW  + + +  Y   D+ L  F Q
Sbjct: 522 QLNAYVCSVLIDMYAKLGKLDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQ 581

Query: 244 MLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGC 303
           ML +G + +       + AC+ L  +  G+Q+HA         +     +LV +Y + G 
Sbjct: 582 MLDRGIRSDEVGLTNAVSACAGLQALKEGQQIHAQACVSGFSSDLPFQNALVTLYSRCGK 641

Query: 304 LEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNG 363
           +E++ +AF+     D  A+ A+++ + Q+G  E AL+ F +M  EGI +N FT  S +  
Sbjct: 642 IEESYLAFEQTEAGDNIAWNALVSGFQQSGNNEEALRVFVRMNREGIDNNNFTFGSAVKA 701

Query: 364 CSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASW 423
            S  A +  G+ +H++  KTG+  +  V  AL++MYAKCGSI DAE  F   + ++  SW
Sbjct: 702 ASETANMKQGKQVHAVITKTGYDSETEVCNALISMYAKCGSISDAEKQFLEVSTKNEVSW 761

Query: 424 NMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKK 483
           N +I  Y KHG G +AL++F  M+     P+ +T V VLSACSH+GL+++G  +F S+  
Sbjct: 762 NAIINAYSKHGFGSEALDSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFESMNS 821

Query: 484 IYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDE 543
            YG++P  +H+ C++D+L RAG  +  + FI E  + P+ALVW  LL AC  H N+E+ E
Sbjct: 822 EYGLSPKPEHYVCVVDMLTRAGLLSRAKEFIQEMPIKPDALVWRTLLSACVVHKNMEIGE 881

Query: 544 KDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEV 599
             A  LLELEP+  + YV  S++ A   +W+     R  +  +G+KKEP  SWIEV
Sbjct: 882 FAAHHLLELEPEDSATYVLLSNLYAVSKKWDARDLTRQKMKEKGVKKEPGQSWIEV 937





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 Back     alignment and function description
>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=3 SV=1 Back     alignment and function description
>sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana GN=PCMP-H36 PE=3 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description
>sp|Q9LU94|PP255_ARATH Putative pentatricopeptide repeat-containing protein At3g25970 OS=Arabidopsis thaliana GN=PCMP-E46 PE=3 SV=2 Back     alignment and function description
>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=3 SV=2 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFL5|PP390_ARATH Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query601
359484317 1005 PREDICTED: pentatricopeptide repeat-cont 0.993 0.594 0.638 0.0
224122590 726 predicted protein [Populus trichocarpa] 1.0 0.827 0.627 0.0
449491572 1004 PREDICTED: putative pentatricopeptide re 0.971 0.581 0.549 0.0
449458534 989 PREDICTED: putative pentatricopeptide re 0.971 0.590 0.549 0.0
255546193 885 pentatricopeptide repeat-containing prot 0.772 0.524 0.604 1e-171
297738694 764 unnamed protein product [Vitis vinifera] 0.998 0.785 0.482 1e-165
218188593 825 hypothetical protein OsI_02714 [Oryza sa 0.998 0.727 0.445 1e-147
357130409 815 PREDICTED: pentatricopeptide repeat-cont 0.998 0.736 0.447 1e-146
328774757 1161 pentatricopeptide repeat protein 77 [Fun 0.983 0.509 0.360 1e-118
54695180 986 PpPPR_98 [Physcomitrella patens] 0.993 0.605 0.369 1e-116
>gi|359484317|ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/601 (63%), Positives = 471/601 (78%)

Query: 1   MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKG 60
           M LA+RVF  MP+ N VSWNALLNG+A+ GD +KV++LFC M   E  FSKF+LSTVLKG
Sbjct: 280 MVLAERVFLCMPKQNAVSWNALLNGFAQMGDAEKVLNLFCRMTGSEINFSKFTLSTVLKG 339

Query: 61  FANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAW 120
            ANSG ++AGQ+VH++AIR+GC LD+F+SC LVDMYSKCGLA +ALKVF RI+DPDVV+W
Sbjct: 340 CANSGNLRAGQIVHSLAIRIGCELDEFISCCLVDMYSKCGLAGDALKVFVRIEDPDVVSW 399

Query: 121 GAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICK 180
            AIITCLDQ+G  +EAA++F  MR S V PNQF L SLV A T+ GD   GESIHA +CK
Sbjct: 400 SAIITCLDQKGQSREAAEVFKRMRHSGVIPNQFTLASLVSAATDLGDLYYGESIHACVCK 459

Query: 181 YGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRI 240
           YGFE D  V NALV+MYM+ G V  G RVFEA  ++D +SWNAL S F D E+ D GLRI
Sbjct: 460 YGFEYDNTVCNALVTMYMKIGSVQDGCRVFEATTNRDLISWNALLSGFHDNETCDTGLRI 519

Query: 241 FYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDK 300
           F QML +GF PNM TFI IL++CSSLSDV  GKQ+HA  +K+SLDGN  VGT+LVDMY K
Sbjct: 520 FNQMLAEGFNPNMYTFISILRSCSSLSDVDLGKQVHAQIVKNSLDGNDFVGTALVDMYAK 579

Query: 301 SGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASC 360
           +  LEDA   F+ L  +DLFA+T I+  YAQ G+ E A+KCF +M+ EG+K NEFTLAS 
Sbjct: 580 NRFLEDAETIFNRLIKRDLFAWTVIVAGYAQDGQGEKAVKCFIQMQREGVKPNEFTLASS 639

Query: 361 LNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDT 420
           L+GCS +ATL +GR LHS+A+K G   DMFV++ALV MYAKCG ++DAE VF G   RDT
Sbjct: 640 LSGCSRIATLDSGRQLHSMAIKAGQSGDMFVASALVDMYAKCGCVEDAEVVFDGLVSRDT 699

Query: 421 ASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSS 480
            SWN +I GY +HG G KAL+AF  MLDEG VPDE+TF+ VLSACSHMGLIEEGKKHF+S
Sbjct: 700 VSWNTIICGYSQHGQGGKALKAFEAMLDEGTVPDEVTFIGVLSACSHMGLIEEGKKHFNS 759

Query: 481 IKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIE 540
           + KIYGITPTI+H+ACM+DILGRAGKF E+E+FI E KLT N L+WE +LGAC  HGNIE
Sbjct: 760 LSKIYGITPTIEHYACMVDILGRAGKFHEVESFIEEMKLTSNVLIWETVLGACKMHGNIE 819

Query: 541 LDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVD 600
             E+ A KL ELEP+++SNY+  S++ A +G W+D + VRAL+S++G+KKEP CSW+EV+
Sbjct: 820 FGERAAMKLFELEPEIDSNYILLSNMFAAKGMWDDVTNVRALMSTRGVKKEPGCSWVEVN 879

Query: 601 G 601
           G
Sbjct: 880 G 880




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224122590|ref|XP_002330519.1| predicted protein [Populus trichocarpa] gi|222872453|gb|EEF09584.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449491572|ref|XP_004158941.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449458534|ref|XP_004147002.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255546193|ref|XP_002514156.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546612|gb|EEF48110.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297738694|emb|CBI27939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|218188593|gb|EEC71020.1| hypothetical protein OsI_02714 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|357130409|ref|XP_003566841.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|328774757|gb|AEB39778.1| pentatricopeptide repeat protein 77 [Funaria hygrometrica] Back     alignment and taxonomy information
>gi|54695180|dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query601
TAIR|locus:2057630727 AT2G33680 "AT2G33680" [Arabido 0.991 0.819 0.332 2.2e-96
TAIR|locus:20952891028 AT3G09040 "AT3G09040" [Arabido 0.995 0.581 0.342 9.7e-96
TAIR|locus:2119440 1064 AT4G13650 [Arabidopsis thalian 0.991 0.560 0.318 6.1e-94
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.996 0.718 0.313 7e-93
TAIR|locus:2078653 825 AT3G02010 [Arabidopsis thalian 0.993 0.723 0.330 1.2e-90
TAIR|locus:2038603 868 AT2G27610 "AT2G27610" [Arabido 0.980 0.678 0.337 1.9e-90
TAIR|locus:2118964 823 EMB2758 "embryo defective 2758 0.980 0.715 0.330 1.9e-90
TAIR|locus:2032840 937 AT1G16480 "AT1G16480" [Arabido 0.993 0.637 0.313 2.5e-90
TAIR|locus:2148101 850 AT5G16860 "AT5G16860" [Arabido 0.687 0.485 0.342 9e-90
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.985 0.683 0.323 1.7e-89
TAIR|locus:2057630 AT2G33680 "AT2G33680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 958 (342.3 bits), Expect = 2.2e-96, P = 2.2e-96
 Identities = 200/601 (33%), Positives = 328/601 (54%)

Query:     4 AKRVFKSMPELNVVSWNALLNGYAESG---DGQKVMHLFCSMKDMEKKFSKFSLSTVLKG 60
             A  +F ++   +VVSWN+L+ GY+++G       VM LF  M+  +   + ++L+ + K 
Sbjct:    68 AHSIFNAIICKDVVSWNSLITGYSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKA 127

Query:    61 FANSGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAW 120
              ++      G+  HA+ +++    D ++  SLV MY K GL ++ LKVF  + + +   W
Sbjct:   128 ESSLQSSTVGRQAHALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTW 187

Query:   121 GAIITCLDQQGCCQEAAKIFNL-MRESSV-KPNQFVLTSLVRATTETGDQRCGESIHAVI 178
               +++    +G  +EA K+FNL +RE      + +V T+++ +   T     G  IH + 
Sbjct:   188 STMVSGYATRGRVEEAIKVFNLFLREKEEGSDSDYVFTAVLSSLAATIYVGLGRQIHCIT 247

Query:   179 CKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGL 238
              K G      + NALV+MY +   ++   ++F++   ++S++W+A+ + +       + +
Sbjct:   248 IKNGLLGFVALSNALVTMYSKCESLNEACKMFDSSGDRNSITWSAMVTGYSQNGESLEAV 307

Query:   239 RIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMY 298
             ++F +M   G KP+  T + +L ACS +  +  GKQLH+  +K   + +    T+LVDMY
Sbjct:   308 KLFSRMFSAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVDMY 367

Query:   299 DKSGCLEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLA 358
              K+GCL DA   FD L  +D+  +T++I+ Y Q  + E AL  +R+M+  GI  N+ T+A
Sbjct:   368 AKAGCLADARKGFDCLQERDVALWTSLISGYVQNSDNEEALILYRRMKTAGIIPNDPTMA 427

Query:   359 SCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALR 418
             S L  CS +ATL  G+ +H   +K G  L++ + +AL  MY+KCGS++D   VF+ +  +
Sbjct:   428 SVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNK 487

Query:   419 DTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHF 478
             D  SWN MI G   +G G++ALE F  ML EG  PD++TFV ++SACSH G +E G  +F
Sbjct:   488 DVVSWNAMISGLSHNGQGDEALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERGWFYF 547

Query:   479 SSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGN 538
             + +    G+ P + H+ACM+D+L RAG+  E + FI    +     +W  LL AC  HG 
Sbjct:   548 NMMSDQIGLDPKVDHYACMVDLLSRAGQLKEAKEFIESANIDHGLCLWRILLSACKNHGK 607

Query:   539 IXXXXXXXXXXXXXXPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIE 598
                             +  S YV  S I    GR  D   V   + + G+ KE  CSWIE
Sbjct:   608 CELGVYAGEKLMALGSRESSTYVQLSGIYTALGRMRDVERVWKHMRANGVSKEVGCSWIE 667

Query:   599 V 599
             +
Sbjct:   668 L 668


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2095289 AT3G09040 "AT3G09040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148101 AT5G16860 "AT5G16860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query601
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-136
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-97
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-70
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-50
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-41
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-39
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-37
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-22
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-09
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-06
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  416 bits (1071), Expect = e-136
 Identities = 209/598 (34%), Positives = 331/598 (55%), Gaps = 2/598 (0%)

Query: 4   AKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFAN 63
           A  VF  MPE ++ SWN L+ GYA++G   + + L+  M     +   ++   VL+    
Sbjct: 140 AWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGG 199

Query: 64  SGYIKAGQVVHAMAIRLGCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAI 123
              +  G+ VHA  +R G  LD  +  +L+ MY KCG   +A  VF R+   D ++W A+
Sbjct: 200 IPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAM 259

Query: 124 ITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIHAVICKYGF 183
           I+   + G C E  ++F  MRE SV P+   +TS++ A    GD+R G  +H  + K GF
Sbjct: 260 ISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGF 319

Query: 184 ESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRIFYQ 243
             D  V N+L+ MY+  G      +VF  +  +D+VSW A+ S ++    PD+ L  +  
Sbjct: 320 AVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYAL 379

Query: 244 MLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGC 303
           M      P+  T   +L AC+ L D+  G +LH    +  L    VV  +L++MY K  C
Sbjct: 380 MEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKC 439

Query: 304 LEDAGVAFDSLANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNG 363
           ++ A   F ++  KD+ ++T+II           AL  FR+M L  +K N  TL + L+ 
Sbjct: 440 IDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLT-LKPNSVTLIAALSA 498

Query: 364 CSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYAKCGSIDDAEAVFKGSALRDTASW 423
           C+ +  L  G+ +H+  ++TG   D F+  AL+ +Y +CG ++ A   F     +D  SW
Sbjct: 499 CARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSHE-KDVVSW 557

Query: 424 NMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKK 483
           N+++ GYV HG G  A+E F  M++ G  PDE+TF+ +L ACS  G++ +G ++F S+++
Sbjct: 558 NILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEE 617

Query: 484 IYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDE 543
            Y ITP +KH+AC++D+LGRAGK TE  NFI +  +TP+  VW  LL AC  H ++EL E
Sbjct: 618 KYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGE 677

Query: 544 KDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG 601
             A+ + EL+P     Y+   ++ A  G+W++ + VR  +   G+  +P CSW+EV G
Sbjct: 678 LAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKG 735


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 601
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.85
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
KOG2003 840 consensus TPR repeat-containing protein [General f 99.79
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.78
KOG2076895 consensus RNA polymerase III transcription factor 99.75
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.74
KOG2076895 consensus RNA polymerase III transcription factor 99.73
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.71
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.68
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
KOG2003 840 consensus TPR repeat-containing protein [General f 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.6
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.6
KOG1126638 consensus DNA-binding cell division cycle control 99.59
KOG1915677 consensus Cell cycle control protein (crooked neck 99.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.59
KOG1126638 consensus DNA-binding cell division cycle control 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.54
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.53
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.52
KOG0547606 consensus Translocase of outer mitochondrial membr 99.52
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.51
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.51
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.5
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.42
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.42
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.41
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.41
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.37
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.37
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.36
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.35
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.34
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.33
PF1304150 PPR_2: PPR repeat family 99.33
KOG1129478 consensus TPR repeat-containing protein [General f 99.32
PF1304150 PPR_2: PPR repeat family 99.32
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.31
PRK12370553 invasion protein regulator; Provisional 99.31
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.29
KOG1129478 consensus TPR repeat-containing protein [General f 99.29
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.28
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.28
PRK11189296 lipoprotein NlpI; Provisional 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
KOG2376652 consensus Signal recognition particle, subunit Srp 99.23
PRK12370553 invasion protein regulator; Provisional 99.21
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.21
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.2
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.19
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.18
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.17
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.15
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.13
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.12
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.11
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.08
PRK11189296 lipoprotein NlpI; Provisional 99.07
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.06
KOG1125579 consensus TPR repeat-containing protein [General f 99.06
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.06
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.04
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.03
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.01
PRK10370198 formate-dependent nitrite reductase complex subuni 99.0
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.99
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.93
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.9
PRK15359144 type III secretion system chaperone protein SscB; 98.89
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.89
PRK15359144 type III secretion system chaperone protein SscB; 98.88
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.86
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.85
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.84
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.77
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.76
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.76
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.75
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.75
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.72
PRK10370198 formate-dependent nitrite reductase complex subuni 98.72
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.71
PLN02789320 farnesyltranstransferase 98.71
PRK04841 903 transcriptional regulator MalT; Provisional 98.7
PLN02789320 farnesyltranstransferase 98.69
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.66
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.65
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.64
PRK04841903 transcriptional regulator MalT; Provisional 98.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.63
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.59
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.59
PF1285434 PPR_1: PPR repeat 98.57
PF1285434 PPR_1: PPR repeat 98.57
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.53
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.45
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.45
KOG1125579 consensus TPR repeat-containing protein [General f 98.43
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.4
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.38
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.35
KOG0553304 consensus TPR repeat-containing protein [General f 98.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.28
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.28
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.26
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.25
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.23
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.21
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.21
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.21
PRK15331165 chaperone protein SicA; Provisional 98.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.18
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.17
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.17
KOG0553304 consensus TPR repeat-containing protein [General f 98.17
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.16
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.1
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.1
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.09
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.09
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.07
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.06
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.05
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.02
COG4700251 Uncharacterized protein conserved in bacteria cont 98.01
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.0
PF1337173 TPR_9: Tetratricopeptide repeat 97.97
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.95
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.95
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.93
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.93
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.91
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.89
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.87
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.75
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.75
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.74
PRK10803263 tol-pal system protein YbgF; Provisional 97.74
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.72
KOG20411189 consensus WD40 repeat protein [General function pr 97.72
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.71
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.69
PF1343134 TPR_17: Tetratricopeptide repeat 97.66
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.65
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.62
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.61
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.6
PF12688120 TPR_5: Tetratrico peptide repeat 97.58
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.56
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.56
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.55
COG4700251 Uncharacterized protein conserved in bacteria cont 97.54
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.54
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.49
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.48
PF1337173 TPR_9: Tetratricopeptide repeat 97.48
PF1342844 TPR_14: Tetratricopeptide repeat 97.45
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.45
PRK10803263 tol-pal system protein YbgF; Provisional 97.44
PF12688120 TPR_5: Tetratrico peptide repeat 97.43
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.4
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.38
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.35
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.34
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.33
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.3
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.26
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.19
PF13512142 TPR_18: Tetratricopeptide repeat 97.16
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.16
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.1
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.08
PRK11906458 transcriptional regulator; Provisional 97.06
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.04
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.03
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.02
KOG20411189 consensus WD40 repeat protein [General function pr 97.02
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.99
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.9
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.81
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.76
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.76
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.75
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.73
KOG4555175 consensus TPR repeat-containing protein [Function 96.71
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.71
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.7
PRK11906458 transcriptional regulator; Provisional 96.68
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.68
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.67
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.67
KOG1258577 consensus mRNA processing protein [RNA processing 96.66
PRK15331165 chaperone protein SicA; Provisional 96.61
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.6
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.59
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.57
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.54
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.47
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.45
PF13512142 TPR_18: Tetratricopeptide repeat 96.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.35
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.27
KOG3941406 consensus Intermediate in Toll signal transduction 96.06
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.99
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.97
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.77
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.71
KOG1585308 consensus Protein required for fusion of vesicles 95.65
smart00299140 CLH Clathrin heavy chain repeat homology. 95.61
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 95.52
PRK11619 644 lytic murein transglycosylase; Provisional 95.51
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.5
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.39
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.39
smart00299140 CLH Clathrin heavy chain repeat homology. 95.31
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.27
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.22
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.13
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.06
KOG4234271 consensus TPR repeat-containing protein [General f 95.06
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.05
KOG3941406 consensus Intermediate in Toll signal transduction 95.01
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.96
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.92
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.75
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.72
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.71
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.66
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.38
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.37
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.33
PF1342844 TPR_14: Tetratricopeptide repeat 94.3
KOG4234271 consensus TPR repeat-containing protein [General f 94.16
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.93
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.92
KOG4555175 consensus TPR repeat-containing protein [Function 93.9
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 93.86
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.77
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.76
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.68
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.67
COG3629280 DnrI DNA-binding transcriptional activator of the 93.52
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.48
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.34
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.15
COG3947361 Response regulator containing CheY-like receiver a 93.14
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.13
KOG1258577 consensus mRNA processing protein [RNA processing 92.86
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.86
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.81
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 92.79
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.73
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.53
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.38
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.34
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.29
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.09
KOG3364149 consensus Membrane protein involved in organellar 92.05
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.02
KOG1585308 consensus Protein required for fusion of vesicles 91.87
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.85
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.55
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.39
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.37
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.29
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.0
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.9
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.67
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.49
PRK09687280 putative lyase; Provisional 90.46
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.46
COG3629280 DnrI DNA-binding transcriptional activator of the 90.3
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 90.26
COG4455 273 ImpE Protein of avirulence locus involved in tempe 90.16
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.02
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.98
PF1343134 TPR_17: Tetratricopeptide repeat 89.89
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.66
PRK10941269 hypothetical protein; Provisional 89.24
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.09
PRK09687280 putative lyase; Provisional 89.03
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.89
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.76
PF06552186 TOM20_plant: Plant specific mitochondrial import r 88.48
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 88.45
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.32
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.84
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.54
KOG4507 886 consensus Uncharacterized conserved protein, conta 87.38
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 87.32
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.24
KOG4570 418 consensus Uncharacterized conserved protein [Funct 86.97
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 86.82
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.46
KOG4570418 consensus Uncharacterized conserved protein [Funct 86.45
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.86
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.69
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.11
KOG3364149 consensus Membrane protein involved in organellar 84.3
PRK11619 644 lytic murein transglycosylase; Provisional 84.02
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 83.92
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.86
KOG1586288 consensus Protein required for fusion of vesicles 83.53
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.35
KOG1550552 consensus Extracellular protein SEL-1 and related 83.34
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.18
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.97
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.73
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 82.7
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.65
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 82.38
PRK12798421 chemotaxis protein; Reviewed 82.16
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 81.65
COG4455 273 ImpE Protein of avirulence locus involved in tempe 81.61
PRK10941269 hypothetical protein; Provisional 81.47
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 81.4
KOG4507 886 consensus Uncharacterized conserved protein, conta 80.88
COG4976 287 Predicted methyltransferase (contains TPR repeat) 80.46
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.4e-96  Score=776.41  Aligned_cols=599  Identities=35%  Similarity=0.656  Sum_probs=591.2

Q ss_pred             CchHHHHhccCCCCCcccHHHHHHHHhhCCChhhHHHHHHhhhhcCCCCCcchHHHHHHHHhccCchhhhHHHHHHHHHh
Q 036160            1 MELAKRVFKSMPELNVVSWNALLNGYAESGDGQKVMHLFCSMKDMEKKFSKFSLSTVLKGFANSGYIKAGQVVHAMAIRL   80 (601)
Q Consensus         1 ~~~a~~~f~~~~~~~~~~y~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~   80 (601)
                      ++.|.++|+.|++||..+||++|.+|++.|++++|+++|++|...|+.||..||+.++++|+..+++..+.+++..+.+.
T Consensus       137 ~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~  216 (857)
T PLN03077        137 LVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRF  216 (857)
T ss_pred             hHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHc
Confidence            36799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCChhHHhhHHHHhhcCCChhHHHHHHhcCCCCCccchHHHHHHHHhcCChhHHHHHHHHHHHcCCCCChhhHHHHHH
Q 036160           81 GCALDKFLSCSLVDMYSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVR  160 (601)
Q Consensus        81 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~  160 (601)
                      |+.||..++|+|+.+|++.|++++|.++|++|++||..+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.
T Consensus       217 g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~  296 (857)
T PLN03077        217 GFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVIS  296 (857)
T ss_pred             CCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccCCcchhhHHHHHHHHHCCCCchhHHHHHHHHHHhcCCccHHHHHHhhcCCCCcccHHHHHHHHhcCCCchhHHHH
Q 036160          161 ATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQDSVSWNALFSRFQDYESPDQGLRI  240 (601)
Q Consensus       161 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~  240 (601)
                      +|++.|+++.+.+++..+.+.|+.||..+|+.|+.+|++.|++++|.++|++|..+|..+||.+|.+|++.|++++|+++
T Consensus       297 a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~l  376 (857)
T PLN03077        297 ACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALET  376 (857)
T ss_pred             HHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHCCCCCCHhhHHHHHHHhcCCCChhHHHHHHHHHHHccCCCCcchhhHHHHHHHhcCCHHHHHHHHhhCCCCCcc
Q 036160          241 FYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSLANKDLF  320 (601)
Q Consensus       241 ~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~  320 (601)
                      |++|...|+.||..||+.++.+|++.|+++.+.++++.+.+.|+.|+..+++.|+++|++.|++++|.++|++|.++|+.
T Consensus       377 f~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~v  456 (857)
T PLN03077        377 YALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVI  456 (857)
T ss_pred             HHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHhhcCCCchhhHHHHHHHHHHhCCCCchhHHHHHHHHHH
Q 036160          321 AYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALVAMYA  400 (601)
Q Consensus       321 ~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~  400 (601)
                      +|+.+|.+|++.|+.++|+.+|++|.. ++.||..||+.++.+|++.|+++.+.+++..+.+.|+.++..++++|+++|+
T Consensus       457 s~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~  535 (857)
T PLN03077        457 SWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYV  535 (857)
T ss_pred             eHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHH
Confidence            999999999999999999999999986 6999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCHHHHHHHHcCCCCCCHhHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHhhHHHHHHHhhccCcHHHHHHHHHH
Q 036160          401 KCGSIDDAEAVFKGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHMGLIEEGKKHFSS  480 (601)
Q Consensus       401 ~~~~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~  480 (601)
                      ++|++++|.++|+.+ .+|..+||++|.+|+++|+.++|+++|++|.+.|+.||..||+.++.+|++.|++++|.++|+.
T Consensus       536 k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~  614 (857)
T PLN03077        536 RCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHS  614 (857)
T ss_pred             HcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHH
Confidence            999999999999999 8999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCChhHHHHHHHHHHhcCChHHHHHHhHhcCCCCcHHHHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCCcce
Q 036160          481 IKKIYGITPTIKHFACMIDILGRAGKFTEIENFITETKLTPNALVWENLLGACSWHGNIELDEKDAEKLLELEPKMESNY  560 (601)
Q Consensus       481 ~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~  560 (601)
                      |.+.+|+.|+..+|++++++|++.|++++|.+++++|+++||..+|+.|+.+|..+|+.+.++.+.+++++++|+++..|
T Consensus       615 M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y  694 (857)
T PLN03077        615 MEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYY  694 (857)
T ss_pred             HHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchH
Confidence            99777999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eehhhhhhhcCChhhHHHHHHHHHhcCCcCCCceeEEEecC
Q 036160          561 VFPSDISATQGRWNDFSGVRALLSSQGIKKEPSCSWIEVDG  601 (601)
Q Consensus       561 ~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~  601 (601)
                      ..++++|...|+|++|.++++.|++.|++|+||++|++|+|
T Consensus       695 ~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~  735 (857)
T PLN03077        695 ILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKG  735 (857)
T ss_pred             HHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECC
Confidence            99999999999999999999999999999999999999987



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query601
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 68.7 bits (166), Expect = 4e-12
 Identities = 26/194 (13%), Positives = 49/194 (25%), Gaps = 7/194 (3%)

Query: 337 MALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTALV 396
           MA       R       E  LA  L       +L   +       +           A  
Sbjct: 75  MAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF 134

Query: 397 AMYAKCGSIDDAEAVF-------KGSALRDTASWNMMIGGYVKHGLGEKALEAFRMMLDE 449
                   +  A  +        +   L     +N ++ G+ + G  ++ +    M+ D 
Sbjct: 135 KCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDA 194

Query: 450 GYVPDEITFVVVLSACSHMGLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTE 509
           G  PD +++   L             +         G+       A ++    RA     
Sbjct: 195 GLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKA 254

Query: 510 IENFITETKLTPNA 523
           +        L P  
Sbjct: 255 VHKVKPTFSLPPQL 268


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query601
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.76
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.71
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.61
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.56
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.54
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.54
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.52
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.51
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.46
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.43
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.4
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.39
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.39
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.38
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.34
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.29
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.27
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.27
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.26
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.25
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.17
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.17
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.16
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.15
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.15
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.1
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.1
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.09
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.04
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.01
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.98
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.98
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.96
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.95
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.94
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.94
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.94
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.92
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.92
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.91
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.9
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.87
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.86
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.83
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.82
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.82
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.8
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.8
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.8
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.8
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.79
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.79
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.77
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.76
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.74
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.71
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.7
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.7
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.68
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.67
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.67
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.65
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.63
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.63
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.61
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.6
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.58
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.57
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.57
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.56
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.55
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.54
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.54
3k9i_A117 BH0479 protein; putative protein binding protein, 98.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.54
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.53
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.52
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.51
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.49
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.48
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.47
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.42
3k9i_A117 BH0479 protein; putative protein binding protein, 98.42
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.41
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.4
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.38
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.36
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.32
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.32
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.31
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.29
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.27
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.21
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.21
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.18
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.13
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.11
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.11
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.01
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.95
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.89
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.83
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.81
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.72
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.72
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.67
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.55
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.53
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.5
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.5
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.39
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.37
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.24
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.24
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.12
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.06
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.99
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.9
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.87
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.68
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.64
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.61
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.55
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.33
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.27
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.24
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.98
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.9
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.46
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.3
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.93
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.76
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.65
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.39
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.38
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.84
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.46
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.3
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.53
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.52
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.5
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.32
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.93
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 91.51
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 91.36
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.72
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.67
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 89.16
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.1
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.03
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 86.34
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.46
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.3
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 83.73
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 83.27
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 82.45
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.4
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.16
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 81.87
2p58_C116 Putative type III secretion protein YSCG; type III 81.83
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4e-42  Score=356.43  Aligned_cols=484  Identities=10%  Similarity=-0.067  Sum_probs=402.4

Q ss_pred             hhcCCChhHHHHHHhcCCCCCccchHHHHHHHHhcCChhHHHHHHHHHHHcCCCCChhhHHHHHHHHhccCCcchhhHHH
Q 036160           96 YSKCGLADNALKVFYRIKDPDVVAWGAIITCLDQQGCCQEAAKIFNLMRESSVKPNQFVLTSLVRATTETGDQRCGESIH  175 (601)
Q Consensus        96 ~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~  175 (601)
                      +.+.|....+...+..++.+++..|+.++..+.+.|++++|+.+|++|.+  ..|+..++..++.++.+.|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            45567777888888888878899999999999999999999999999985  4688899999999999999999999999


Q ss_pred             HHHHHHCCCCchhHHHHHHHHHHhcCCccHHHHHHhhcCCC-------------------CcccHHHHHHHHhcCCCchh
Q 036160          176 AVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAHQ-------------------DSVSWNALFSRFQDYESPDQ  236 (601)
Q Consensus       176 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~-------------------~~~~~~~li~~~~~~~~~~~  236 (601)
                      +.+...  +++..+++.++.+|.+.|++++|.++|+++...                   +..+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            987643  788999999999999999999999999965433                   36789999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCHhhHHHHHHHhcCCCChhHHH--HH-HHHHHHccCCCCcchhhHHHHHHHhcCCHHHHHHHHhh
Q 036160          237 GLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGK--QL-HAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDS  313 (601)
Q Consensus       237 a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~--~~-~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~  313 (601)
                      |.+.|++|...+ +.+...+..+...+...+..+...  .+ +..+...+..+...+++.++..|.+.|++++|.++|++
T Consensus       219 A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~  297 (597)
T 2xpi_A          219 AKECYKEALMVD-AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSS  297 (597)
T ss_dssp             HHHHHHHHHHHC-TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhC-chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHH
Confidence            999999999863 223445555554444433322211  11 44444445555566677778889999999999999999


Q ss_pred             CCC--CCcccHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHhhcCCCchhhHHHHHHHHHHhCCCCchhH
Q 036160          314 LAN--KDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFV  391 (601)
Q Consensus       314 ~~~--~~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~  391 (601)
                      +.+  +++.+|+.++..|.+.|++++|.++|+++...+ +.+..++..++.++.+.|+.++|..+++.+.+.. +.+..+
T Consensus       298 ~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~  375 (597)
T 2xpi_A          298 INGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVT  375 (597)
T ss_dssp             STTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHH
T ss_pred             hhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHH
Confidence            987  788999999999999999999999999999875 3467789999999999999999999999998654 557889


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHcCCC---CCCHhHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHhhHHHHHHHhhcc
Q 036160          392 STALVAMYAKCGSIDDAEAVFKGSA---LRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPDEITFVVVLSACSHM  468 (601)
Q Consensus       392 ~~~l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~~l~~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~  468 (601)
                      +..++.+|.+.|++++|.++|+++.   +.+..+|+.++.+|.+.|++++|+++|+++.+.+ +++..+|..++.+|.+.
T Consensus       376 ~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~  454 (597)
T 2xpi_A          376 WLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQL  454 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHc
Confidence            9999999999999999999999764   5578899999999999999999999999999863 45678999999999999


Q ss_pred             CcHHHHHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCChHHHHHHhHhc-------CCCCc--HHHHHHHHHHHHhcCCh
Q 036160          469 GLIEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITET-------KLTPN--ALVWENLLGACSWHGNI  539 (601)
Q Consensus       469 ~~~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~-------~~~p~--~~~~~~l~~~~~~~g~~  539 (601)
                      |++++|.++|+++.+.  .+.+..+|..++.+|.+.|++++|.++|+++       +..|+  ..+|..++.+|.+.|++
T Consensus       455 g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~  532 (597)
T 2xpi_A          455 GNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMY  532 (597)
T ss_dssp             TCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCH
T ss_pred             CCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCH
Confidence            9999999999999876  3446889999999999999999999999984       45786  78999999999999999


Q ss_pred             hHHHHHHHHHHhcCCCCCcceeehhhhhhhcCChhhHHHHHHHHHhcCCc
Q 036160          540 ELDEKDAEKLLELEPKMESNYVFPSDISATQGRWNDFSGVRALLSSQGIK  589 (601)
Q Consensus       540 ~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~  589 (601)
                      ++|++.++++++..|+++.++..++.+|...|++++|.++++++.+..+.
T Consensus       533 ~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          533 DAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             HHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999886654



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query601
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.64
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.28
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.16
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.12
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.1
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.08
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.07
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.07
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.96
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.9
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.82
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.81
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.79
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.77
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.75
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.61
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.53
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.5
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.49
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.47
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.43
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.34
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.33
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.33
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.28
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.27
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.2
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.15
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.14
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.1
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.02
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.02
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.93
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.88
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.86
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.65
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.56
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.49
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.04
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.53
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.45
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.9
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.9
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.57
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.17
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.65
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.7
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.11
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=9e-22  Score=189.38  Aligned_cols=375  Identities=12%  Similarity=0.101  Sum_probs=266.6

Q ss_pred             HHHHHhccCCcchhhHHHHHHHHHCCCCchhHHHHHHHHHHhcCCccHHHHHHhhcCC--C-CcccHHHHHHHHhcCCCc
Q 036160          158 LVRATTETGDQRCGESIHAVICKYGFESDTLVGNALVSMYMENGRVSYGSRVFEAIAH--Q-DSVSWNALFSRFQDYESP  234 (601)
Q Consensus       158 ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~-~~~~~~~li~~~~~~~~~  234 (601)
                      +...+.+.|++++|.+.++.+.+.. |.+..++..+..+|.+.|++++|...|++..+  | +..+|..+...+...|++
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccc
Confidence            3455667788888888888887764 44566777778888888888888888877654  2 344677777777777777


Q ss_pred             hhHHHHHHHHHHCCCCCCHhhHHHHHHHhcCCCChhHHHHHHHHHHHccCCCCcchhhHHHHHHHhcCCHHHHHHHHhhC
Q 036160          235 DQGLRIFYQMLLKGFKPNMCTFIVILKACSSLSDVGFGKQLHAHTIKHSLDGNHVVGTSLVDMYDKSGCLEDAGVAFDSL  314 (601)
Q Consensus       235 ~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~  314 (601)
                      ++|+..+........ .+..............+................                               
T Consensus        84 ~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------  131 (388)
T d1w3ba_          84 QEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-------------------------------  131 (388)
T ss_dssp             HHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-------------------------------
T ss_pred             ccccccccccccccc-ccccccccccccccccccccccccccccccccc-------------------------------
Confidence            777777777766532 222222222222222222222222222222211                               


Q ss_pred             CCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHhhcCCCchhhHHHHHHHHHHhCCCCchhHHHH
Q 036160          315 ANKDLFAYTAIITSYAQAGEAEMALKCFRKMRLEGIKSNEFTLASCLNGCSPVATLANGRLLHSIAVKTGHLLDMFVSTA  394 (601)
Q Consensus       315 ~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  394 (601)
                       .................+....+...+.+..... +-+...+..+...+...|+.+.|...+....+.. +.+...+..
T Consensus       132 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~  208 (388)
T d1w3ba_         132 -PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYIN  208 (388)
T ss_dssp             -TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHH
T ss_pred             -cccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHH
Confidence             1122223333444445555666666665555432 2234455555666666777777777776666543 224566777


Q ss_pred             HHHHHHhcCCHHHHHHHHcCCC---CCCHhHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCC-HhhHHHHHHHhhccCc
Q 036160          395 LVAMYAKCGSIDDAEAVFKGSA---LRDTASWNMMIGGYVKHGLGEKALEAFRMMLDEGYVPD-EITFVVVLSACSHMGL  470 (601)
Q Consensus       395 l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~~l~~~~~~~~~~~~A~~~~~~m~~~~~~p~-~~~~~~l~~~~~~~~~  470 (601)
                      +...+...|++++|...+++..   ..+...+..+...+.+.|++++|+..|++..+.  .|+ ..++..+..++...|+
T Consensus       209 l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~  286 (388)
T d1w3ba_         209 LGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGS  286 (388)
T ss_dssp             HHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSC
T ss_pred             HhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCC
Confidence            7888888888888888877544   456677888889999999999999999999885  555 4688889999999999


Q ss_pred             HHHHHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCChHHHHHHhHh-cCCCC-cHHHHHHHHHHHHhcCChhHHHHHHHH
Q 036160          471 IEEGKKHFSSIKKIYGITPTIKHFACMIDILGRAGKFTEIENFITE-TKLTP-NALVWENLLGACSWHGNIELDEKDAEK  548 (601)
Q Consensus       471 ~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~-~~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~  548 (601)
                      +++|.+.++.....  .+.+...+..++.++.+.|++++|++.+++ +.+.| +..++..++.++.+.|++++|+..+++
T Consensus       287 ~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~  364 (388)
T d1w3ba_         287 VAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             HHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHH
T ss_pred             HHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            99999999998775  455678888999999999999999999998 56677 677899999999999999999999999


Q ss_pred             HHhcCCCCCcceeehhhhhhhcCC
Q 036160          549 LLELEPKMESNYVFPSDISATQGR  572 (601)
Q Consensus       549 ~~~~~p~~~~~~~~l~~~~~~~g~  572 (601)
                      +++++|+++.++..++.+|.+.||
T Consensus       365 al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         365 AIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure