Citrus Sinensis ID: 036185

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------106
RGSNDHRLTLQVPPGRGRVNEGFARSAIRSPQSGKKENMSFEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGSSVSSKDEHQNCGDLTKNVDGPPGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTGGVLLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCRQIQT
ccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccEEccccccEEEEEEcccccccccEEEEEEcccccHHHHHHHccccccccccccccccEEEEEEccEEEEEcccHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccEEEcccEEEcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEEcccccccEEEEEccccccccccccccEEEEEccccEEEEEccccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEEEccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEEEEcccccccccccccEEEEccEEEEEcccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEccccccccccccEEEEEccEEEEEEcccccccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEccHHHHccHHHHHHcccccccccccccccccEEEccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHccccccccHHHHHHHHHHHHHccccHHHHccccccEEEEccEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEccccEEEEEEccEEEEEEcEEEEEccccHHHHHHcccccccccEEEEEcccccccHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccccEEEEEEEEEEEccc
ccccccEEEEEcccccccccccHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccEccccccEEEEEccccccccccEEEEEEcccccHHHHHHHHcccccccccccccccEEEEEccEEEEEEEccHHHHHHHHHHHHHcccccccccHHcHEEEEEEEccEEEEcccccccEEEEccccEEEEccHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccEcccccccccccccccEEEEccccccccccccccccEEEEEEEEEccEEEEEEccccccccccccEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEEccccccccccEEEEccccccEEEEcccccccccccccEEEEEccEEEEEEccccccccccEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccccccEEEccccccccccccccccccccEEEEcccEEEEccccccccccEEEEccccccccccccccccccccccHHHccccEEEEHcHHcccccccHHHHcccEEccccccccccccccccccccEEEEEEHcHHHHcccccccccccccEEEcccccccccccHHHHHHHHHccccccccccccHHccccccHHHHHHHHHHHHHHHccccHHHHHHcccccEEEccEEEEcccHccHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccccccEEEEEEccccEEEEEcccEEEEEEEEEEEEccccccHHHHHHcccccccEEEEEEccccHcHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEcccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccEEEEEEEEEEEEccc
rgsndhrltlqvppgrgrvnegfarsairspqsgkkenmSFEQRKAATLASlsssatdkspkgtldtpiipllnainshpnyyttsscsgrisifshpvnkpkggtwlfithdpadvdsvlsllffpthttpssptrdqlvfrfepliVAVECRDVESAEALVSIAVSSglresgvtsVKKRVIVGIRCslrlevplgesgnvlvsQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMvgssvsskdehqncgdltknvdgppgvpscglsvsriviagepvEKLFLWGHSacilgnsindsqilvfggfggmgrharrndlflldplqgTIKAihtegspsprlghtssligdhmfiiggradplnilSDVWVFNMAKSKWTLlecsgsvfqprhRHAAAVIGSKIyvfgglnndtifsslhvldtdtLQWKELLingegpcarhshsmlaygsrlymfggyngekalgdlytfDVHAclwkkediaarspharfsHTMFLYKNYlglfggcpvrqnyqelSLLDLQLHIWKHLKLNYVCKELFVrstanvvdddlimiGGGAACYAfgtkfsepvkinlssvplmslddcnippemgeKLVTHhyegvtgeknVNFQALElgntqtltessdfnseakhpvndghqmAASHWVVELDKKYAKFGKDILKKfgwlhlgrkphqqedgkricfpVTEKFCAIFQEkqlhsggeseglntidlskpytggvlldeTSCATALHFLKEcgatkqmdeavevkrapkspfKAMTEAVASLIEQKGLSARLLEQLPSRwerlgdivvlpvtsfkdpvwdsiggeLWPAVAKILNTShlarqgrvaptgtrdsALEIlvgdngwvkhcengilysfdatkcmfswgNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHnlqansvsdhcivlegdnrftapkgvanrvclgliptsensWVTAVQALRseggtlhvhgnvkdseEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADvgcrqiqt
rgsndhrltlqvppgrgrvnegfarsairspqsgkkenMSFEQRKAATLAslsssatdkspkgtlDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFPThttpssptrdqlVFRFEPLIVAVECRDVESAEALVSIavssglresgvtsvkkrVIVGIRCSlrlevplgesgnvlVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGSSVSSKDEHQNCGDLtknvdgppgvPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIhtegspsprLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWlhlgrkphqqedgkrICFPVTEKFCAIFQEKQlhsggeseglntIDLSKPYTGGVLLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTShlarqgrvaptgtrdSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGdnrftapkgVANRVCLGLIPTSENSWVTAVQALRSeggtlhvhgnvkdseeklWAEHVSKSIYEIarseghrwEVTIEHIERVKWYAPHIRHLVAdvgcrqiqt
RGSNDHRLTLQVPPGRGRVNEGFARSAIRSPQSGKKENMSFEQRKaatlaslsssatDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFpthttpssptRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGSSVSSKDEHQNCGDLTKNVDGPPGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTGGVLLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCRQIQT
******************************************************************TPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFPTHTT****TRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVG************************VPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHT**********TSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALEL**************************AASHWVVELDKKYAKFGKDILKKFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLH******GLNTIDLSKPYTGGVLLDETSCATALHFLKECGAT**********************AVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCR****
*****HR***QVPPGRGRVN*******************************************TLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLF**************LVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGSSVSSKDEHQNCGDLTKNVDGPPGVPSCGLSVSRIVIA*EP****FLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKL******LFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLM***************VTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGW******************PVTEKFCA******************IDLSKP**********************************************EAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCRQI**
********TLQVPPGRGRVNEGFARSAI**********************************GTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGS**********CGDLTKNVDGPPGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTGGVLLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCRQIQT
****DHRLTLQVPPGRGRVNEGFARS*I**********************************GTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFPT********RDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGSSVSSKDEHQNCGDLTKNVDGPPGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTGGVLLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCRQIQT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RGSNDHRLTLQVPPGRGRVNEGFARSAIRSPQSGKKENMSFEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNKPKGGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFMVGSSVSSKDEHQNCGDLTKNVDGPPGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTGGVLLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADVGCRQIQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1057 2.2.26 [Sep-21-2011]
Q8W4K1995 tRNA wybutosine-synthesiz yes no 0.921 0.978 0.586 0.0
Q8H4D41043 tRNA wybutosine-synthesiz yes no 0.938 0.951 0.486 0.0
Q4R3U8448 tRNA wybutosine-synthesiz N/A no 0.284 0.671 0.415 2e-68
Q53H54448 tRNA wybutosine-synthesiz yes no 0.284 0.671 0.418 2e-68
Q58D65438 tRNA wybutosine-synthesiz yes no 0.290 0.700 0.407 7e-68
Q8BG71446 tRNA wybutosine-synthesiz yes no 0.294 0.697 0.395 2e-66
Q4V8B8437 tRNA wybutosine-synthesiz yes no 0.290 0.702 0.399 6e-66
Q0P466408 tRNA wybutosine-synthesiz yes no 0.293 0.759 0.409 8e-63
Q9UTA5237 tRNA wybutosine-synthesiz yes no 0.205 0.915 0.349 7e-32
Q641F8251 tRNA wybutosine-synthesiz N/A no 0.160 0.677 0.396 1e-30
>sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 Back     alignment and function desciption
 Score = 1192 bits (3083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1036 (58%), Positives = 760/1036 (73%), Gaps = 62/1036 (5%)

Query: 39   MSFEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHP 98
            M FE+RKAATLAS+ SS TDKSPKG LD PIIPLL  IN HP+Y+TTSSCSGRISI S P
Sbjct: 1    MDFEKRKAATLASIRSSVTDKSPKGFLDEPIIPLLETINHHPSYFTTSSCSGRISILSQP 60

Query: 99   V--------NKPKGGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRD--QLVFRFEPLI 148
                      K +GG+WL+ITHDPAD D V+SLLF P+ +    P     +LVFRFEPLI
Sbjct: 61   KPKSNDSTKKKARGGSWLYITHDPADSDLVISLLF-PSKSNQIDPIDQPSELVFRFEPLI 119

Query: 149  VAVECRDVESAEALVSIAVSSGLRESGVTSVK--KRVIVGIRCSLRLEVPLGESGNVLVS 206
            +AVEC+D+ SA+ LV++A+S+G RESG+TS    KRVI+ IRCS+R+EVP+G++  ++VS
Sbjct: 120  IAVECKDLGSAQFLVALAISAGFRESGITSCGDGKRVIIAIRCSIRMEVPIGDTEKLMVS 179

Query: 207  QDYVRFLVGIANQKLEANSRRIDGFLQAF--NFMVGSSVSSKDEHQNCGDLTKNVDGP-- 262
             +YV+FLV IAN+K++AN +R DGF  A   N       +  DE  N  +L  N D    
Sbjct: 180  PEYVKFLVDIANEKMDANRKRTDGFSVALASNGFKNPDENDVDEDDNYENLAANHDSSIN 239

Query: 263  -----PGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHA 317
                 PGV    + + ++ I GEPVEKL LWGHSAC +  S +  +++VFGGFGG GRHA
Sbjct: 240  NGNLYPGVQKELIPLEKLSIVGEPVEKLHLWGHSACTIDES-DRKEVIVFGGFGGFGRHA 298

Query: 318  RRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNM 377
            RRN+  LL+P  GT+K I    SPS RLGHT+S++GD MF+IGGRADPLNIL+DVW  ++
Sbjct: 299  RRNESLLLNPSCGTLKLIAVNESPSARLGHTASMVGDFMFVIGGRADPLNILNDVWRLDI 358

Query: 378  AKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLI 437
            +  +W+   C GS F PRHRHAAA +G+K+Y+FGGL ND I SS+H+LDT  LQWKE+  
Sbjct: 359  STGEWSSQRCVGSEFPPRHRHAAASVGTKVYIFGGLYNDKIVSSMHILDTKDLQWKEVEQ 418

Query: 438  NGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFS 497
             G+ PCARHSH+M+AYGS+ +MFGGYNGE  L DLY+FDV +C WK E I+ + PHARFS
Sbjct: 419  QGQWPCARHSHAMVAYGSQSFMFGGYNGENVLNDLYSFDVQSCSWKLEVISGKWPHARFS 478

Query: 498  HTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDL 557
            H+MF+YK+ +G+ GGCPV QN QEL+LLDL+  +W+ ++L ++ KELFVRSTA+++ DDL
Sbjct: 479  HSMFVYKHTIGIIGGCPVSQNCQELTLLDLKHRLWRSVRLEFMNKELFVRSTASILGDDL 538

Query: 558  IMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVTGEKNVN 617
            I+IGGGAACYAFGTKFSEPVKINL  V  +++ + ++PP+          E V+ E N N
Sbjct: 539  IVIGGGAACYAFGTKFSEPVKINL--VQSVTMSENHLPPQP---------EDVSLESNKN 587

Query: 618  FQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILKKFGWLH 677
                   N    TE+S                 +  WV++L++KYAKFGKDILK FGWL 
Sbjct: 588  -------NADLKTETS----------------LSQPWVIQLERKYAKFGKDILKSFGWLD 624

Query: 678  LGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTGGVLLDETSC 737
            L RK +  E G  ICFPVTE F  +F EKQL  G + E     +L+K    G+ L + SC
Sbjct: 625  LERKVYSNEKGLCICFPVTENFSELFHEKQLL-GKDFERSEENNLTK----GLSLKDISC 679

Query: 738  ATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQLPSRWER 797
            + AL+ LKE GA K ++ A E K+  KSP + M E + S+++QKGL   LL++LP +WER
Sbjct: 680  SAALNLLKEHGAKKLINVAFEAKKVAKSPLQRMREDITSILKQKGLPEELLDELPQKWER 739

Query: 798  LGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDN 857
            LGDIVV+P TSFKDP W SI  E+W AV+K L+ + LARQGRV P GTRDS LEILVGDN
Sbjct: 740  LGDIVVVPATSFKDPTWSSINDEVWCAVSKSLSANRLARQGRVEPNGTRDSTLEILVGDN 799

Query: 858  GWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRA 917
            GWV H ENGILYSFDATKCMFSWGNLSEKLRM  + C++EV+VDLFAGIGYFVLPFLVRA
Sbjct: 800  GWVNHRENGILYSFDATKCMFSWGNLSEKLRMGNMACENEVVVDLFAGIGYFVLPFLVRA 859

Query: 918  KARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSEN 977
            KA+LVYACEWNP A+EAL+ N++ANSVS+ CI+LEGDNR TAPKGVA+RV LGLIP+SE 
Sbjct: 860  KAKLVYACEWNPHAIEALRRNVEANSVSERCIILEGDNRITAPKGVADRVNLGLIPSSEG 919

Query: 978  SWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVK 1037
            SWVTA+QALR EGG LHVHGNVKDS+E  W EHV+K++ +IAR+EG  WEVT+EHIE+VK
Sbjct: 920  SWVTAIQALRPEGGILHVHGNVKDSDESSWGEHVTKTLSDIARAEGRSWEVTVEHIEKVK 979

Query: 1038 WYAPHIRHLVADVGCR 1053
            WYAP IRHLVADV CR
Sbjct: 980  WYAPRIRHLVADVRCR 995
S-adenosyl-L-methionine-dependent transferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 Back     alignment and function description
>sp|Q4R3U8|TYW2_MACFA tRNA wybutosine-synthesizing protein 2 homolog OS=Macaca fascicularis GN=TRMT12 PE=2 SV=2 Back     alignment and function description
>sp|Q53H54|TYW2_HUMAN tRNA wybutosine-synthesizing protein 2 homolog OS=Homo sapiens GN=TRMT12 PE=1 SV=1 Back     alignment and function description
>sp|Q58D65|TYW2_BOVIN tRNA wybutosine-synthesizing protein 2 homolog OS=Bos taurus GN=TRMT12 PE=2 SV=1 Back     alignment and function description
>sp|Q8BG71|TYW2_MOUSE tRNA wybutosine-synthesizing protein 2 homolog OS=Mus musculus GN=Trmt12 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8B8|TYW2_RAT tRNA wybutosine-synthesizing protein 2 homolog OS=Rattus norvegicus GN=Trmt12 PE=2 SV=2 Back     alignment and function description
>sp|Q0P466|TYW2_DANRE tRNA wybutosine-synthesizing protein 2 homolog OS=Danio rerio GN=trmt12 PE=2 SV=1 Back     alignment and function description
>sp|Q9UTA5|TYW3_SCHPO tRNA wybutosine-synthesizing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw3 PE=3 SV=1 Back     alignment and function description
>sp|Q641F8|TYW3_XENLA tRNA wybutosine-synthesizing protein 3 homolog OS=Xenopus laevis GN=tyw3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1057
2254445191018 PREDICTED: tRNA wybutosine-synthesizing 0.935 0.971 0.667 0.0
3021441381013 unnamed protein product [Vitis vinifera] 0.930 0.971 0.666 0.0
2240762211031 predicted protein [Populus trichocarpa] 0.935 0.959 0.638 0.0
2555548871050 signal transducer, putative [Ricinus com 0.927 0.933 0.643 0.0
3565219891068 PREDICTED: tRNA wybutosine-synthesizing 0.960 0.950 0.607 0.0
3574802971046 tRNA wybutosine-synthesizing protein 2/3 0.956 0.966 0.599 0.0
4494794531035 PREDICTED: tRNA wybutosine-synthesizing 0.941 0.961 0.597 0.0
4494339521034 PREDICTED: LOW QUALITY PROTEIN: tRNA wyb 0.940 0.961 0.595 0.0
297809639996 hypothetical protein ARALYDRAFT_490107 [ 0.920 0.976 0.589 0.0
22328346995 tRNA wybutosine synthesizing protein 2-l 0.921 0.978 0.586 0.0
>gi|225444519|ref|XP_002268884.1| PREDICTED: tRNA wybutosine-synthesizing protein 2/3/4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1397 bits (3617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1046 (66%), Positives = 814/1046 (77%), Gaps = 57/1046 (5%)

Query: 39   MSFEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHP 98
            M FE+RKAATLAS+ S+  DKSPKGT+D  I+PLL+AIN H +Y+TTSSCSGRISI S P
Sbjct: 1    MEFEKRKAATLASMGSTEPDKSPKGTIDRHIVPLLSAINRHNSYFTTSSCSGRISILSQP 60

Query: 99   V-------NKPKGGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAV 151
                     K +GG+WLFITHD AD +SVL+LLF    TT  S   D LVFRFEP IVAV
Sbjct: 61   SPAATNAHKKARGGSWLFITHDLADPNSVLALLF---PTTGCSSQHDDLVFRFEPFIVAV 117

Query: 152  ECRDVESAEALVSIAVSSGLRESGVTSVKKRVIVGIRCSLRLEVPLGESGNVLVSQDYVR 211
            EC+DV +A+ LVS AVS G RESG+TSV KRV+V +RCS+RLEVPLG  G VLVS +YVR
Sbjct: 118  ECKDVAAAQLLVSTAVSCGFRESGITSVSKRVMVAVRCSIRLEVPLGGGGRVLVSPEYVR 177

Query: 212  FLVGIANQKLEANSRRIDGFLQAF-------NFMVGSSVSSK---DEH--QNCGDLTKNV 259
            +LVGIAN K+E N RR +GFLQA        +F  G+ +      DEH   +C D   N 
Sbjct: 178  YLVGIANDKMETNRRRTEGFLQALQSSGFVESFNGGAGLDGAMGGDEHGCSDCKDGDANS 237

Query: 260  D--------GPPGVPSCGLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFG 311
            +        G  GV  C LS+ ++ I  EPVEKLFLWGHSAC L ++IN  +++VFGGFG
Sbjct: 238  ERIIAEKESGSVGVLGCSLSIVQMEIIDEPVEKLFLWGHSACTL-DTINHKKVIVFGGFG 296

Query: 312  GMGRHARRNDLFLLDPLQGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSD 371
            GMGRHARRND F+LDPL GT+KA++ EG+PSPRLGHTSS++GD MFIIGGRADP NIL +
Sbjct: 297  GMGRHARRNDAFVLDPLHGTLKAVNAEGTPSPRLGHTSSMVGDLMFIIGGRADPENILDN 356

Query: 372  VWVFNMAKSKWTLLECSGSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQ 431
            VWV + AK++W  LEC+GSVF PRHRHAAAV+GSKIYVFGGLNND I SSLHVLDTD LQ
Sbjct: 357  VWVLDTAKNEWRRLECTGSVFPPRHRHAAAVLGSKIYVFGGLNNDAISSSLHVLDTDNLQ 416

Query: 432  WKELLINGEGPCARHSHSMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARS 491
            W E+ ++GE PCARHSHS++AYGS+L+MFGG N  KALGDLY+FDV  CLWKKE  + R+
Sbjct: 417  WNEIRVHGEWPCARHSHSLVAYGSKLFMFGGCNDGKALGDLYSFDVQTCLWKKEVASGRT 476

Query: 492  PHARFSHTMFLYKNYLGLFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTAN 551
            P+ARFSH+MF+YKNYLG+ GGCPVRQ+ QEL+LLDLQ H+W++  L+ V K LFVRSTA+
Sbjct: 477  PYARFSHSMFIYKNYLGIIGGCPVRQHCQELALLDLQHHVWRNEILDSVFKVLFVRSTAS 536

Query: 552  VVDDDLIMIGGGAACYAFGTKFSEPVKINLSSVPLMSLDDCNIPPEMGEKLVTHHYEGVT 611
            VV DDLIMIGGGA+CYAFGTKFS P+KINL  + L+SL D  +P EM EK   H YEGV 
Sbjct: 537  VVGDDLIMIGGGASCYAFGTKFSGPMKINL--LQLVSLHDTLVPSEMEEKHAIHQYEGVK 594

Query: 612  GEKNVNFQALELGNTQTLTESSDFNSEAKHPVNDGHQMAASHWVVELDKKYAKFGKDILK 671
             +KN +                         V+   QM A +WV++L++KYAK GKDILK
Sbjct: 595  EKKNGDLH-----------------------VDVEKQMVAVYWVLQLERKYAKLGKDILK 631

Query: 672  KFGWLHLGRKPHQQEDGKRICFPVTEKFCAIFQEKQLHSGGESEGLNTIDLSKPYTG-GV 730
            KFGWL LGRK H +ED + ICFPVTEKFC IF EK   S    E  N + L KP TG GV
Sbjct: 632  KFGWLDLGRKVHSREDRRHICFPVTEKFCTIFNEKDHDSSDAFEVPNELHLYKPSTGEGV 691

Query: 731  LLDETSCATALHFLKECGATKQMDEAVEVKRAPKSPFKAMTEAVASLIEQKGLSARLLEQ 790
            LL++ S  TAL  LKECGATK  DE VEV+R P SP K M+EAVASLI+ +GLS++LLEQ
Sbjct: 692  LLNDISFVTALRLLKECGATKLADEVVEVRRTPSSPLKIMSEAVASLIKHRGLSSQLLEQ 751

Query: 791  LPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQGRVAPTGTRDSAL 850
            LP+RWERLGDIVVLPVTSFKDP+WDSIG ELWP +AK LNT  LARQGRVAP+GTRDS L
Sbjct: 752  LPTRWERLGDIVVLPVTSFKDPIWDSIGDELWPIIAKSLNTCRLARQGRVAPSGTRDSTL 811

Query: 851  EILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDEVIVDLFAGIGYFV 910
            EILVGDNGWV HCENGILYSFDATKCMFSWGNLSEKLRM  L+C+DEVIVDLFAGIGYFV
Sbjct: 812  EILVGDNGWVDHCENGILYSFDATKCMFSWGNLSEKLRMGCLNCRDEVIVDLFAGIGYFV 871

Query: 911  LPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRFTAPKGVANRVCLG 970
            LPFLV AKA+LVYACEWNP AVEAL+HNL ANSV+D CI+LEGDNR TAPKGVA+RVCLG
Sbjct: 872  LPFLVSAKAKLVYACEWNPHAVEALQHNLLANSVADRCIILEGDNRLTAPKGVADRVCLG 931

Query: 971  LIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYEIARSEGHRWEVTI 1030
            L+P+SE SW TAV+ALR+EGG LHVHGN KDSEE  W+EHVSKSI ++ARSEG+ WEV++
Sbjct: 932  LLPSSEGSWATAVRALRTEGGMLHVHGNAKDSEEGSWSEHVSKSICDLARSEGYDWEVSV 991

Query: 1031 EHIERVKWYAPHIRHLVADVGCRQIQ 1056
            EH+ERVKWYAPHIRHLVADV CRQIQ
Sbjct: 992  EHVERVKWYAPHIRHLVADVRCRQIQ 1017

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302144138|emb|CBI23243.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224076221|ref|XP_002304908.1| predicted protein [Populus trichocarpa] gi|222847872|gb|EEE85419.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255554887|ref|XP_002518481.1| signal transducer, putative [Ricinus communis] gi|223542326|gb|EEF43868.1| signal transducer, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356521989|ref|XP_003529632.1| PREDICTED: tRNA wybutosine-synthesizing protein 2/3/4-like [Glycine max] Back     alignment and taxonomy information
>gi|357480297|ref|XP_003610434.1| tRNA wybutosine-synthesizing protein 2/3/4 [Medicago truncatula] gi|355511489|gb|AES92631.1| tRNA wybutosine-synthesizing protein 2/3/4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449479453|ref|XP_004155603.1| PREDICTED: tRNA wybutosine-synthesizing protein 2/3/4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449433952|ref|XP_004134760.1| PREDICTED: LOW QUALITY PROTEIN: tRNA wybutosine-synthesizing protein 2/3/4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297809639|ref|XP_002872703.1| hypothetical protein ARALYDRAFT_490107 [Arabidopsis lyrata subsp. lyrata] gi|297318540|gb|EFH48962.1| hypothetical protein ARALYDRAFT_490107 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22328346|ref|NP_567268.2| tRNA wybutosine synthesizing protein 2-like protein [Arabidopsis thaliana] gi|75162488|sp|Q8W4K1.1|TYW23_ARATH RecName: Full=tRNA wybutosine-synthesizing protein 2/3/4; Includes: RecName: Full=tRNA wybutosine-synthesizing protein 3 homolog; Includes: RecName: Full=tRNA wybutosine synthesizing protein 2 homolog gi|17064868|gb|AAL32588.1| Unknown protein [Arabidopsis thaliana] gi|30725408|gb|AAP37726.1| At4g04670 [Arabidopsis thaliana] gi|332657010|gb|AEE82410.1| tRNA wybutosine synthesizing protein 2-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1057
TAIR|locus:2135069995 AT4G04670 [Arabidopsis thalian 0.467 0.496 0.555 2e-301
MGI|MGI:1915510446 Trmt12 "tRNA methyltranferase 0.245 0.580 0.473 5.2e-69
UNIPROTKB|A6QQ88438 TRMT12 "tRNA wybutosine-synthe 0.240 0.579 0.478 9e-69
UNIPROTKB|Q58D65438 TRMT12 "tRNA wybutosine-synthe 0.240 0.579 0.478 9e-69
RGD|1307127437 Trmt12 "tRNA methyltransferase 0.245 0.592 0.473 1.6e-68
UNIPROTKB|I3LK40439 LOC100736636 "Uncharacterized 0.240 0.578 0.474 1.4e-67
UNIPROTKB|I3LKG7446 LOC100736636 "Uncharacterized 0.240 0.569 0.474 1.4e-67
UNIPROTKB|F1PKC3439 TRMT12 "Uncharacterized protei 0.240 0.578 0.474 2.5e-67
ZFIN|ZDB-GENE-060825-182408 zgc:153361 "zgc:153361" [Danio 0.288 0.747 0.415 1.2e-62
UNIPROTKB|Q53H54448 TRMT12 "tRNA wybutosine-synthe 0.251 0.593 0.492 2.6e-62
TAIR|locus:2135069 AT4G04670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1489 (529.2 bits), Expect = 2.0e-301, Sum P(2) = 2.0e-301
 Identities = 283/509 (55%), Positives = 376/509 (73%)

Query:   101 KPKGGTWLFITHDPADVDSVLSLLFFXXXXXXXXXXR-DQLVFRFEPLIVAVECRDVESA 159
             K +GG+WL+ITHDPAD D V+SLLF           +  +LVFRFEPLI+AVEC+D+ SA
Sbjct:    71 KARGGSWLYITHDPADSDLVISLLFPSKSNQIDPIDQPSELVFRFEPLIIAVECKDLGSA 130

Query:   160 EALVSIAVSSGLRESGVTSVK--KRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIA 217
             + LV++A+S+G RESG+TS    KRVI+ IRCS+R+EVP+G++  ++VS +YV+FLV IA
Sbjct:   131 QFLVALAISAGFRESGITSCGDGKRVIIAIRCSIRMEVPIGDTEKLMVSPEYVKFLVDIA 190

Query:   218 NQKLEANSRRIDGFLQAF--NFMVGSSVSSKDEHQNCGDLTKNVDGP-------PGVPSC 268
             N+K++AN +R DGF  A   N       +  DE  N  +L  N D         PGV   
Sbjct:   191 NEKMDANRKRTDGFSVALASNGFKNPDENDVDEDDNYENLAANHDSSINNGNLYPGVQKE 250

Query:   269 GLSVSRIVIAGEPVEKLFLWGHSACILGNSINDSQILVFGGFGGMGRHARRNDLFLLDPL 328
              + + ++ I GEPVEKL LWGHSAC +  S +  +++VFGGFGG GRHARRN+  LL+P 
Sbjct:   251 LIPLEKLSIVGEPVEKLHLWGHSACTIDES-DRKEVIVFGGFGGFGRHARRNESLLLNPS 309

Query:   329 QGTIKAIHTEGSPSPRLGHTSSLIGDHMFIIGGRADPLNILSDVWVFNMAKSKWTLLECS 388
              GT+K I    SPS RLGHT+S++GD MF+IGGRADPLNIL+DVW  +++  +W+   C 
Sbjct:   310 CGTLKLIAVNESPSARLGHTASMVGDFMFVIGGRADPLNILNDVWRLDISTGEWSSQRCV 369

Query:   389 GSVFQPRHRHAAAVIGSKIYVFGGLNNDTIFSSLHVLDTDTLQWKELLINGEGPCARHSH 448
             GS F PRHRHAAA +G+K+Y+FGGL ND I SS+H+LDT  LQWKE+   G+ PCARHSH
Sbjct:   370 GSEFPPRHRHAAASVGTKVYIFGGLYNDKIVSSMHILDTKDLQWKEVEQQGQWPCARHSH 429

Query:   449 SMLAYGSRLYMFGGYNGEKALGDLYTFDVHACLWKKEDIAARSPHARFSHTMFLYKNYLG 508
             +M+AYGS+ +MFGGYNGE  L DLY+FDV +C WK E I+ + PHARFSH+MF+YK+ +G
Sbjct:   430 AMVAYGSQSFMFGGYNGENVLNDLYSFDVQSCSWKLEVISGKWPHARFSHSMFVYKHTIG 489

Query:   509 LFGGCPVRQNYQELSLLDLQLHIWKHLKLNYVCKELFVRSTANVVDDDLIMIGGGAACYA 568
             + GGCPV QN QEL+LLDL+  +W+ ++L ++ KELFVRSTA+++ DDLI+IGGGAACYA
Sbjct:   490 IIGGCPVSQNCQELTLLDLKHRLWRSVRLEFMNKELFVRSTASILGDDLIVIGGGAACYA 549

Query:   569 FGTKFSEPVKINLSSVPLMSLDDCNIPPE 597
             FGTKFSEPVKINL  V  +++ + ++PP+
Sbjct:   550 FGTKFSEPVKINL--VQSVTMSENHLPPQ 576
GO:0005737 "cytoplasm" evidence=ISM
GO:0016740 "transferase activity" evidence=IEA
GO:0031591 "wybutosine biosynthetic process" evidence=ISS
GO:0006310 "DNA recombination" evidence=RCA
GO:0006869 "lipid transport" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0032204 "regulation of telomere maintenance" evidence=RCA
GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA
MGI|MGI:1915510 Trmt12 "tRNA methyltranferase 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQ88 TRMT12 "tRNA wybutosine-synthesizing protein 2 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D65 TRMT12 "tRNA wybutosine-synthesizing protein 2 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1307127 Trmt12 "tRNA methyltransferase 12 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LK40 LOC100736636 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKG7 LOC100736636 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKC3 TRMT12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060825-182 zgc:153361 "zgc:153361" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q53H54 TRMT12 "tRNA wybutosine-synthesizing protein 2 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H4D4TYW23_ORYSJ2, ., 1, ., 1, ., -0.48680.93850.9511yesno
Q8W4K1TYW23_ARATH2, ., 1, ., 1, ., -0.58680.92140.9788yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010754001
SubName- Full=Chromosome chr10 scaffold_282, whole genome shotgun sequence; (999 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00014617001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (654 aa)
      • 0.480
GSVIVG00031573001
SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (462 aa)
   •  • 0.428

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1057
pfam02676190 pfam02676, TYW3, Methyltransferase TYW3 2e-66
COG2520341 COG2520, COG2520, Predicted methyltransferase [Gen 8e-55
COG1590208 COG1590, COG1590, Uncharacterized conserved protei 3e-49
PRK04235196 PRK04235, PRK04235, hypothetical protein; Provisio 8e-46
pfam02475199 pfam02475, Met_10, Met-10+ like-protein 5e-36
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 8e-14
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 4e-13
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 9e-12
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-09
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-08
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-07
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 2e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 1e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-06
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 9e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-05
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 2e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 3e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 4e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-05
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases re 1e-04
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 3e-04
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 5e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 7e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-04
pfam1385442 pfam13854, Kelch_5, Kelch motif 9e-04
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 0.001
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.001
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.001
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 0.002
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 0.003
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 0.003
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 0.003
>gnl|CDD|217179 pfam02676, TYW3, Methyltransferase TYW3 Back     alignment and domain information 
 Score =  221 bits (565), Expect = 2e-66
 Identities = 93/199 (46%), Positives = 125/199 (62%), Gaps = 17/199 (8%)

Query: 42  EQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIF---SHP 98
           EQRK   L  L     D SPKG++D  IIPLL+ INS P+Y TTSSCSGRIS+F     P
Sbjct: 1   EQRKRKILEELE----DASPKGSVDEDIIPLLDLINSLPDYVTTSSCSGRISVFDEGKKP 56

Query: 99  VNKPKGGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVES 158
             K   G WLF +HDP +++ VL  L             D++  +FEP I+ V+CRD+E 
Sbjct: 57  GAK-GNGRWLFKSHDPVELEEVLEALKK--------AKGDRIWLKFEPPILHVQCRDLED 107

Query: 159 AEALVSIAVSSGLRESGVTSVK-KRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIA 217
           A+ L+S A  SG RESG+ S+  KRVIV IR + RL+VP+G +G +LV ++Y++FLV IA
Sbjct: 108 AQKLLSAARESGFRESGIKSISGKRVIVEIRSTERLDVPIGYNGKLLVDEEYLKFLVEIA 167

Query: 218 NQKLEANSRRIDGFLQAFN 236
           N+KL  N  R++   +A  
Sbjct: 168 NEKLLENKERLERLREALE 186

The methyltransferase TYW3 (tRNA-yW- synthesising protein 3) has been identified in yeast to be involved in wybutosine (yW) biosynthesis. yW is a complexly modified guanosine residue that contains a tricyclic base and is found at the 3' position adjacent the anticodon of phenylalanine tRNA. TYW3 is an N-4 methylase that methylates yW-86 to yield yW-72 in an Ado-Met-dependent manner. Length = 190
>gnl|CDD|225318 COG2520, COG2520, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224506 COG1590, COG1590, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|235262 PRK04235, PRK04235, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|202251 pfam02475, Met_10, Met-10+ like-protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|225174 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1057
KOG1228256 consensus Uncharacterized conserved protein [Funct 100.0
PRK04235196 hypothetical protein; Provisional 100.0
PF02676205 TYW3: Methyltransferase TYW3; InterPro: IPR003827 100.0
COG1590208 Uncharacterized conserved protein [Function unknow 100.0
COG2520341 Predicted methyltransferase [General function pred 100.0
KOG1227351 consensus Putative methyltransferase [General func 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.98
KOG4152830 consensus Host cell transcription factor HCFC1 [Ce 99.97
PHA03098534 kelch-like protein; Provisional 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.97
KOG1230521 consensus Protein containing repeated kelch motifs 99.97
PHA03098534 kelch-like protein; Provisional 99.97
PHA02790480 Kelch-like protein; Provisional 99.96
KOG1230521 consensus Protein containing repeated kelch motifs 99.96
KOG2078495 consensus tRNA modification enzyme [RNA processing 99.95
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.95
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.95
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.94
PHA02790480 Kelch-like protein; Provisional 99.94
KOG4152830 consensus Host cell transcription factor HCFC1 [Ce 99.94
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.92
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.92
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.9
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.83
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.75
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.65
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.64
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.62
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.6
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 99.6
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.55
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.54
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.54
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 99.52
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 99.47
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 99.47
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.46
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.38
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.37
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.37
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.37
COG4123248 Predicted O-methyltransferase [General function pr 99.35
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.35
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.35
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.33
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.33
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.32
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.32
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.31
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.3
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.29
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.29
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.27
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.25
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.23
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.22
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.22
COG2890280 HemK Methylase of polypeptide chain release factor 99.22
PRK14967223 putative methyltransferase; Provisional 99.21
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.21
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.21
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 99.19
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.19
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.17
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.17
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.16
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.15
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.11
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.11
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 99.1
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.1
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.07
PRK07402196 precorrin-6B methylase; Provisional 99.07
PRK14902444 16S rRNA methyltransferase B; Provisional 99.03
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.03
PRK14904445 16S rRNA methyltransferase B; Provisional 99.02
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.01
PRK04266226 fibrillarin; Provisional 99.01
PRK14901434 16S rRNA methyltransferase B; Provisional 99.0
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 99.0
PRK14903431 16S rRNA methyltransferase B; Provisional 99.0
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.99
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.99
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.99
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.99
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.98
PRK10901427 16S rRNA methyltransferase B; Provisional 98.98
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.96
PRK14968188 putative methyltransferase; Provisional 98.95
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.95
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.95
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.94
PF1396450 Kelch_6: Kelch motif 98.91
COG2521287 Predicted archaeal methyltransferase [General func 98.91
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.9
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.88
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.87
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.86
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.86
PLN02476278 O-methyltransferase 98.83
PLN02233261 ubiquinone biosynthesis methyltransferase 98.82
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.82
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.81
PLN02244340 tocopherol O-methyltransferase 98.81
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.8
PHA03411279 putative methyltransferase; Provisional 98.8
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.79
PLN02672 1082 methionine S-methyltransferase 98.79
KOG2904328 consensus Predicted methyltransferase [General fun 98.78
PTZ00146293 fibrillarin; Provisional 98.77
PHA03412241 putative methyltransferase; Provisional 98.76
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.75
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.74
PRK04457262 spermidine synthase; Provisional 98.73
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.73
PRK11207197 tellurite resistance protein TehB; Provisional 98.72
PLN02772398 guanylate kinase 98.69
PF1396450 Kelch_6: Kelch motif 98.69
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.68
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.67
PRK12335287 tellurite resistance protein TehB; Provisional 98.65
COG1041347 Predicted DNA modification methylase [DNA replicat 98.65
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.64
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.64
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.64
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.64
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.64
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.62
PRK00811283 spermidine synthase; Provisional 98.62
PF1341549 Kelch_3: Galactose oxidase, central domain 98.61
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.61
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.6
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.6
COG4076252 Predicted RNA methylase [General function predicti 98.57
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.57
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.56
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.56
PLN02772398 guanylate kinase 98.56
PRK01581374 speE spermidine synthase; Validated 98.55
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.55
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.54
PRK03612521 spermidine synthase; Provisional 98.54
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.53
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.51
PLN02490340 MPBQ/MSBQ methyltransferase 98.51
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.5
PF1341549 Kelch_3: Galactose oxidase, central domain 98.5
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.5
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.49
TIGR00452314 methyltransferase, putative. Known examples to dat 98.49
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.49
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.48
TIGR00438188 rrmJ cell division protein FtsJ. 98.47
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.47
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.46
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 98.46
COG4122219 Predicted O-methyltransferase [General function pr 98.45
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.45
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.44
PLN02366308 spermidine synthase 98.42
PLN02336475 phosphoethanolamine N-methyltransferase 98.42
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.41
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.41
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.41
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.4
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.4
KOG2730263 consensus Methylase [General function prediction o 98.4
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.39
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.39
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.38
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.37
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.36
PRK10742250 putative methyltransferase; Provisional 98.35
PRK06922677 hypothetical protein; Provisional 98.35
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.35
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.34
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.34
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.34
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.32
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.31
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 98.31
PLN03075296 nicotianamine synthase; Provisional 98.3
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.3
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.29
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.27
PF1385442 Kelch_5: Kelch motif 98.26
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.25
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.24
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.23
PRK08317241 hypothetical protein; Provisional 98.22
PLN02589247 caffeoyl-CoA O-methyltransferase 98.21
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.21
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.2
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.2
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.18
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.18
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 98.17
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.16
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.16
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.15
COG3897218 Predicted methyltransferase [General function pred 98.15
PLN02336 475 phosphoethanolamine N-methyltransferase 98.15
PF1385442 Kelch_5: Kelch motif 98.12
TIGR03438301 probable methyltransferase. This model represents 98.12
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.12
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.11
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.1
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 98.08
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.07
smart0061247 Kelch Kelch domain. 98.05
PLN02823336 spermine synthase 98.05
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.03
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.99
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.97
smart0061247 Kelch Kelch domain. 97.95
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.95
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 97.92
PRK05785226 hypothetical protein; Provisional 97.9
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.9
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.88
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.84
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.81
KOG1663237 consensus O-methyltransferase [Secondary metabolit 97.81
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.8
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.79
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.79
KOG1271227 consensus Methyltransferases [General function pre 97.77
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.76
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.76
PRK06202232 hypothetical protein; Provisional 97.73
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.69
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.68
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.66
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.66
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.65
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.64
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 97.59
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.58
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.56
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.55
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.52
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.52
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.51
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.42
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.41
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.38
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.38
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.37
KOG4300252 consensus Predicted methyltransferase [General fun 97.28
PHA01634156 hypothetical protein 97.26
COG2384226 Predicted SAM-dependent methyltransferase [General 97.24
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 97.22
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.22
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 97.2
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.14
KOG2899288 consensus Predicted methyltransferase [General fun 97.12
KOG3010261 consensus Methyltransferase [General function pred 97.11
COG4262508 Predicted spermidine synthase with an N-terminal m 97.09
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.09
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.08
PRK04148134 hypothetical protein; Provisional 97.07
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.05
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.04
KOG2198375 consensus tRNA cytosine-5-methylases and related e 97.02
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.98
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 96.95
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.94
PRK10458 467 DNA cytosine methylase; Provisional 96.91
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.75
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.7
KOG2361264 consensus Predicted methyltransferase [General fun 96.68
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.65
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.64
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.61
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.6
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 96.6
KOG2671421 consensus Putative RNA methylase [Replication, rec 96.55
KOG2055514 consensus WD40 repeat protein [General function pr 96.5
PLN02232160 ubiquinone biosynthesis methyltransferase 96.5
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.5
PF13679141 Methyltransf_32: Methyltransferase domain 96.4
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.35
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.23
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.21
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.19
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 96.18
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 96.1
PRK00536262 speE spermidine synthase; Provisional 96.05
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 96.01
COG0286 489 HsdM Type I restriction-modification system methyl 95.94
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 95.91
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 95.91
KOG1501 636 consensus Arginine N-methyltransferase [General fu 95.91
KOG4058199 consensus Uncharacterized conserved protein [Funct 95.9
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.87
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 95.68
PRK13699227 putative methylase; Provisional 95.57
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 95.57
PRK11524284 putative methyltransferase; Provisional 95.57
COG1568354 Predicted methyltransferases [General function pre 95.56
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.51
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.19
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 95.05
PF12768281 Rax2: Cortical protein marker for cell polarity 94.69
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 94.24
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 94.1
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 94.08
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 94.06
PRK10611287 chemotaxis methyltransferase CheR; Provisional 93.53
PF12768281 Rax2: Cortical protein marker for cell polarity 93.47
KOG3045325 consensus Predicted RNA methylase involved in rRNA 93.37
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 93.26
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.23
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.12
PRK05137435 tolB translocation protein TolB; Provisional 93.11
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 93.01
KOG0310487 consensus Conserved WD40 repeat-containing protein 93.01
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.77
KOG3115249 consensus Methyltransferase-like protein [General 92.71
PRK04792448 tolB translocation protein TolB; Provisional 92.13
KOG2055514 consensus WD40 repeat protein [General function pr 92.01
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 91.86
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 91.8
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 91.78
PTZ00357 1072 methyltransferase; Provisional 91.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 91.71
PRK04792448 tolB translocation protein TolB; Provisional 91.61
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 91.52
PRK00178430 tolB translocation protein TolB; Provisional 91.48
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 91.3
PRK04043419 tolB translocation protein TolB; Provisional 91.2
PRK04922433 tolB translocation protein TolB; Provisional 91.19
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.15
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 91.04
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 90.38
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 90.21
PRK04922433 tolB translocation protein TolB; Provisional 90.02
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 89.97
PRK00178430 tolB translocation protein TolB; Provisional 89.92
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 89.85
PRK13684334 Ycf48-like protein; Provisional 89.67
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 89.41
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 88.93
COG2961279 ComJ Protein involved in catabolism of external DN 88.85
COG4798238 Predicted methyltransferase [General function pred 88.73
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 88.71
TIGR00497 501 hsdM type I restriction system adenine methylase ( 88.71
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.55
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 88.38
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 88.28
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 88.21
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 88.05
PRK05137435 tolB translocation protein TolB; Provisional 87.91
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 87.66
PRK13684334 Ycf48-like protein; Provisional 87.54
KOG3924419 consensus Putative protein methyltransferase invol 87.07
PRK09880343 L-idonate 5-dehydrogenase; Provisional 86.97
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 86.79
PRK03629429 tolB translocation protein TolB; Provisional 86.72
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 86.32
COG3129292 Predicted SAM-dependent methyltransferase [General 86.18
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 85.99
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 85.93
KOG1709271 consensus Guanidinoacetate methyltransferase and r 85.93
PF02086260 MethyltransfD12: D12 class N6 adenine-specific DNA 85.39
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 85.32
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 85.03
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 84.62
PLN00033398 photosystem II stability/assembly factor; Provisio 84.6
COG1520370 FOG: WD40-like repeat [Function unknown] 84.58
KOG3201201 consensus Uncharacterized conserved protein [Funct 84.35
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 84.28
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 84.19
PRK02889427 tolB translocation protein TolB; Provisional 84.1
KOG2912 419 consensus Predicted DNA methylase [Function unknow 83.9
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 83.43
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 82.9
COG1743 875 Adenine-specific DNA methylase containing a Zn-rib 82.85
PRK13699 227 putative methylase; Provisional 81.87
PRK02889427 tolB translocation protein TolB; Provisional 81.84
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 81.78
PRK03629429 tolB translocation protein TolB; Provisional 81.68
COG0863302 DNA modification methylase [DNA replication, recom 81.46
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 80.92
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 80.86
PF12217367 End_beta_propel: Catalytic beta propeller domain o 80.22
>KOG1228 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-61  Score=471.33  Aligned_cols=201  Identities=45%  Similarity=0.816  Sum_probs=182.8

Q ss_pred             ccccHHHHHHHHHHhccCCCCCCCCCCCCCCCcHHHHHHHhcCCCeEEecCccceeEEeecCCC----CCCCcEEEEEEc
Q 036185           37 ENMSFEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVN----KPKGGTWLFITH  112 (1057)
Q Consensus        37 ~~~~f~~~k~~~l~~l~~~~~d~s~~g~vD~~i~~l~~~in~~~~~~TtSSCsGRi~~~~~~~~----~~~~~~~l~~~H  112 (1057)
                      ++|+|+++|++||+.|.+..+|+||||+||++|+|||+.||.||+|||||||||||||++++..    |++||.||||+|
T Consensus         3 ~~~~Fek~Kaa~L~~i~Ssv~D~SpKG~~Depi~plld~IN~hpd~fTTSSCSGRIsvl~qg~N~~~~k~qgg~WLyVTH   82 (256)
T KOG1228|consen    3 RSAEFEKWKAAILNEIDSSVPDLSPKGSVDEPIVPLLDFINMHPDFFTTSSCSGRISVLDQGINGFEVKGQGGCWLYVTH   82 (256)
T ss_pred             chhhHHHHHHHHHHhhcccCCCCCCCCCCCcchhHHHHHhhcCCceEEcccccceEEEEeeccCcccccCCCceEEEEec
Confidence            5789999999999999999999999999999999999999999999999999999999999865    566899999999


Q ss_pred             cCCChhhHHhhhcCCCCCCCCC--CCCceEEEEEcCcEEEEEeCCHHHHHHHHHHHHHcCccccCccccC-CceEEEEec
Q 036185          113 DPADVDSVLSLLFFPTHTTPSS--PTRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVK-KRVIVGIRC  189 (1057)
Q Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~ep~ilhv~~~~~~~a~~ll~~a~~~Gfr~Sgi~~~~-~~~~v~ir~  189 (1057)
                      ++.-.+|+..+|..+...++..  .+.+.+.||||||||||+||||.+||.|+++|++||||||||++++ +++|||||+
T Consensus        83 d~~a~ddl~~~lef~~~sgkippv~g~rei~ykfEP~IlhVqcrdlq~Aq~L~~~Ais~GFReSGIt~~~~~k~ivAIR~  162 (256)
T KOG1228|consen   83 DLCAKDDLIVALEFAELSGKIPPVNGIREITYKFEPFILHVQCRDLQDAQILHSMAISCGFRESGITVGKRGKTIVAIRS  162 (256)
T ss_pred             ccchhcccchhhhhHHhhCCCCCCCCchhheeeccceEEEEehhhhhhHHHHHHHHHhcCccccccccccCCcEEEEEEe
Confidence            9987777776654332222211  1246999999999999999999999999999999999999999987 789999999


Q ss_pred             cceeeeeeccCCceecCHhHHHHHHHHHHHHHHHhHHHHHHHHHHHHh
Q 036185          190 SLRLEVPLGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNF  237 (1057)
Q Consensus       190 ~~~l~~pl~~~~~~~v~~~yl~~lv~~~N~~l~~n~~rl~r~~~~l~~  237 (1057)
                      +++||+||+..++++|++||+.+|+++||++|.+|++||+||++++++
T Consensus       163 sirleVPlg~s~kLmVTpEYv~fL~~~anekmdeN~krm~~L~~~ler  210 (256)
T KOG1228|consen  163 SIRLEVPLGHSGKLMVTPEYVDFLLNVANEKMDENKKRMERLQHALER  210 (256)
T ss_pred             eceeeeccCCCccEEecHHHHHHHHHHHHHHHhhhHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999875

>PRK04235 hypothetical protein; Provisional Back     alignment and domain information
>PF02676 TYW3: Methyltransferase TYW3; InterPro: IPR003827 The methyltransferase TYW3 (tRNA-yW- synthesising protein 3) has been identified in yeast to be involved in wybutosine (yW) biosynthesis [] Back     alignment and domain information
>COG1590 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG3924 consensus Putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1) [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2912 consensus Predicted DNA methylase [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1057
3a25_A301 Crystal Structure Of P. Horikoshii Tyw2 In Complex 1e-28
3k6r_A278 Crystal Structure Of Putative Transferase Ph0793 Fr 8e-26
3a27_A272 Crystal Structure Of M. Jannaschii Tyw2 In Complex 6e-25
2drv_A200 Structure Of Ph1069 Protein From Pyrococcus Horikos 7e-20
2zzn_A336 The Complex Structure Of Atrm5 And Trnacys Length = 2e-13
2zzm_A336 The Complex Structure Of Atrm5 And Trnaleu Length = 1e-12
2yx1_A336 Crystal Structure Of M.Jannaschii Trna M1g37 Methyl 1e-12
2qg3_A208 Crystal Structure Of A Tyw3 Methyltransferase-Like 4e-12
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 9e-08
1tlj_A213 Crystal Structure Of Conserved Protein Of Unknown F 3e-07
2dvk_A188 Crystal Structure Of Hypothetical Protein From Aero 7e-05
2zw9_A695 Crystal Structure Of Trna Wybutosine Synthesizing E 1e-04
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-04
>pdb|3A25|A Chain A, Crystal Structure Of P. Horikoshii Tyw2 In Complex With Adomet Length = 301 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (315), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 89/290 (30%), Positives = 147/290 (50%), Gaps = 15/290 (5%)
Query: 764  KSPFKAMTEAVASLIEQ---KGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGE 820
            + P    T+ +   I +   K L   L++ LP RW R+GD+++LP+    +P    I  E
Sbjct: 19   QGPLHMRTQGIKPRIREILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIA-E 77
Query: 821  LWPAVAKILNTSHLARQGRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSW 880
            ++   A++L    + R+G +    TR    E+L G +    H ENGI Y  D  K MFS 
Sbjct: 78   VY---AEVLGVKTVLRKGHIHGE-TRKPDYELLYGSDTVTVHVENGIKYKLDVAKIMFSP 133
Query: 881  GNLSEKLRMARLDCKDEVIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQ 940
             N+ E++RMA++   DE++VD+FAGIG+  LP  V  KA+++ A E +P   + L  N+ 
Sbjct: 134  ANVKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVI-AIEKDPYTFKFLVENIH 192
Query: 941  ANSVSDHCIVLEGDNRFTAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVK 1000
             N V D       DNR    + +A+R+ +G +    + ++    ++  +G  +H H  V 
Sbjct: 193  LNKVEDRMSAYNMDNRDFPGENIADRILMGYV-VRTHEFIPKALSIAKDGAIIHYHNTVP 251
Query: 1001 DSEEKLWAEHVSKSIYEIARSEGHRWEVTIEHIERVKWYAPHIRHLVADV 1050
               EKL      ++   I +  G+  E   E   ++K YAP + H+V D+
Sbjct: 252  ---EKLMPREPFETFKRITKEYGYDVEKLNEL--KIKRYAPGVWHVVLDL 296
>pdb|3K6R|A Chain A, Crystal Structure Of Putative Transferase Ph0793 From Pyrococcus Horikoshii Length = 278 Back     alignment and structure
>pdb|3A27|A Chain A, Crystal Structure Of M. Jannaschii Tyw2 In Complex With Adomet Length = 272 Back     alignment and structure
>pdb|2DRV|A Chain A, Structure Of Ph1069 Protein From Pyrococcus Horikoshii Ot3 Length = 200 Back     alignment and structure
>pdb|2ZZN|A Chain A, The Complex Structure Of Atrm5 And Trnacys Length = 336 Back     alignment and structure
>pdb|2ZZM|A Chain A, The Complex Structure Of Atrm5 And Trnaleu Length = 336 Back     alignment and structure
>pdb|2YX1|A Chain A, Crystal Structure Of M.Jannaschii Trna M1g37 Methyltransferase Length = 336 Back     alignment and structure
>pdb|2QG3|A Chain A, Crystal Structure Of A Tyw3 Methyltransferase-Like Protein (Af_2059) From Archaeoglobus Fulgidus Dsm 4304 At 1.95 A Resolution Length = 208 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|1TLJ|A Chain A, Crystal Structure Of Conserved Protein Of Unknown Function Sso0622 From Sulfolobus Solfataricus Length = 213 Back     alignment and structure
>pdb|2DVK|A Chain A, Crystal Structure Of Hypothetical Protein From Aeropyrum Pernix Length = 188 Back     alignment and structure
>pdb|2ZW9|A Chain A, Crystal Structure Of Trna Wybutosine Synthesizing Enzyme Tyw4 Length = 695 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1057
2frn_A278 Hypothetical protein PH0793; structural genomics, 4e-70
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 5e-65
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 2e-64
2it2_A200 UPF0130 protein PH1069; hypothetical protein, NPPS 3e-63
2dvk_A188 UPF0130 protein APE0816; hypothetical protein, str 3e-61
2qg3_A208 UPF0130 protein AF_2059; TYW3 methyltransferase-li 2e-60
1tlj_A213 Hypothetical UPF0130 protein SSO0622; midwest cent 2e-59
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-55
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-08
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-26
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-20
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-18
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-13
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-26
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-18
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-11
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-23
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-18
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-22
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-22
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-20
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-18
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-22
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-19
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-20
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-20
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 1e-06
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 2e-05
3ll7_A 410 Putative methyltransferase; methytransferase, stru 3e-05
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 7e-05
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 1e-04
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 1e-04
3me5_A 482 Cytosine-specific methyltransferase; structural ge 1e-04
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 1e-04
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 2e-04
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 2e-04
1dct_A 324 Protein (modification methylase HAEIII); enzyme, c 3e-04
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 3e-04
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 5e-04
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 7e-04
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 9e-04
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A* Length = 278 Back     alignment and structure
 Score =  234 bits (598), Expect = 4e-70
 Identities = 83/273 (30%), Positives = 134/273 (49%), Gaps = 12/273 (4%)

Query: 778  IEQKGLSARLLEQLPSRWERLGDIVVLPVTSFKDPVWDSIGGELWPAVAKILNTSHLARQ 837
            I  K L   L++ LP RW R+GD+++LP+    +P    I        A++L    + R+
Sbjct: 13   ILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRI----AEVYAEVLGVKTVLRK 68

Query: 838  GRVAPTGTRDSALEILVGDNGWVKHCENGILYSFDATKCMFSWGNLSEKLRMARLDCKDE 897
            G +     R    E+L G +    H ENGI Y  D  K MFS  N+ E++RMA++   DE
Sbjct: 69   GHIHGET-RKPDYELLYGSDTVTVHVENGIKYKLDVAKIMFSPANVKERVRMAKVAKPDE 127

Query: 898  VIVDLFAGIGYFVLPFLVRAKARLVYACEWNPCAVEALKHNLQANSVSDHCIVLEGDNRF 957
            ++VD+FAGIG+  LP  V  KA+ V A E +P   + L  N+  N V D       DNR 
Sbjct: 128  LVVDMFAGIGHLSLPIAVYGKAK-VIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRD 186

Query: 958  TAPKGVANRVCLGLIPTSENSWVTAVQALRSEGGTLHVHGNVKDSEEKLWAEHVSKSIYE 1017
               + +A+R+ +G +  +      A+   + +G  +H H  V +           ++   
Sbjct: 187  FPGENIADRILMGYVVRTHEFIPKALSIAK-DGAIIHYHNTVPEKLMPREPF---ETFKR 242

Query: 1018 IARSEGHRWEVTIEHIERVKWYAPHIRHLVADV 1050
            I +  G  ++V   +  ++K YAP + H+V D+
Sbjct: 243  ITKEYG--YDVEKLNELKIKRYAPGVWHVVLDL 273
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Length = 272 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336 Back     alignment and structure
>2it2_A UPF0130 protein PH1069; hypothetical protein, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2drv_A 2it3_A Length = 200 Back     alignment and structure
>2dvk_A UPF0130 protein APE0816; hypothetical protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aeropyrum pernix} Length = 188 Back     alignment and structure
>2qg3_A UPF0130 protein AF_2059; TYW3 methyltransferase-like prrotein, structural genomics, J center for structural genomics, JCSG; HET: MSE; 1.95A {Archaeoglobus fulgidus dsm 4304} Length = 208 Back     alignment and structure
>1tlj_A Hypothetical UPF0130 protein SSO0622; midwest center for structural genomics, PSI, protein structure initiative, MCSG; 2.80A {Sulfolobus solfataricus} SCOP: d.282.1.1 Length = 213 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Length = 433 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 Back     alignment and structure
>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Length = 349 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1057
2it2_A200 UPF0130 protein PH1069; hypothetical protein, NPPS 100.0
2qg3_A208 UPF0130 protein AF_2059; TYW3 methyltransferase-li 100.0
1tlj_A213 Hypothetical UPF0130 protein SSO0622; midwest cent 100.0
2dvk_A188 UPF0130 protein APE0816; hypothetical protein, str 100.0
3k6r_A278 Putative transferase PH0793; structural genomics, 100.0
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2frn_A278 Hypothetical protein PH0793; structural genomics, 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.98
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.96
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.95
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.9
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.9
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.88
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.88
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.85
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.83
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.82
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.81
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.69
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.68
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.59
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.57
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.5
3lpm_A259 Putative methyltransferase; structural genomics, p 99.37
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.35
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.34
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.32
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.31
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.31
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.29
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.27
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.26
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.25
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.24
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.23
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.23
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.22
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.22
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.22
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.2
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.2
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.19
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.19
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.18
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.17
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.17
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.17
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.17
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.16
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.15
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.15
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.15
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.15
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.14
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.14
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.12
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.12
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.12
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.12
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.11
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.09
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.09
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.09
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.08
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.08
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.07
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.07
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.07
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.06
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.05
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.04
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.04
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.04
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.03
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.03
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.02
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.02
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.01
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.01
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.01
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.0
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.99
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.99
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.99
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.99
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.98
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.98
2h00_A254 Methyltransferase 10 domain containing protein; st 98.97
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.97
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.97
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.97
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.96
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.96
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.95
3f4k_A257 Putative methyltransferase; structural genomics, P 98.94
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.94
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.93
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.92
3ocj_A305 Putative exported protein; structural genomics, PS 98.92
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.92
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.92
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.92
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.92
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.91
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.91
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.91
2b25_A336 Hypothetical protein; structural genomics, methyl 98.9
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.9
2o07_A304 Spermidine synthase; structural genomics, structur 98.9
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.9
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.9
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.9
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.89
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.89
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.89
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.88
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.88
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.88
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.87
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.87
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.87
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.86
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.86
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.86
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.85
2pt6_A321 Spermidine synthase; transferase, structural genom 98.85
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.85
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.85
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.85
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.84
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.84
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.84
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.83
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.83
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.82
3lcc_A235 Putative methyl chloride transferase; halide methy 98.82
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.82
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.81
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.81
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.8
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.8
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.8
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.79
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.79
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.79
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.78
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.77
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.75
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.75
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.74
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.74
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.74
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.74
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.73
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.73
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.73
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.72
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.72
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.72
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.71
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.7
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.7
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.7
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.7
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.7
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.7
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.69
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.69
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.69
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.69
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.69
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.68
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.68
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.68
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.67
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.66
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.66
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.65
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.65
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.65
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.64
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.64
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.64
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.63
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.63
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.63
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.63
2oo3_A283 Protein involved in catabolism of external DNA; st 98.62
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.62
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.62
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.62
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.62
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.62
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.61
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.61
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.61
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.61
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.6
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.6
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.59
2i7c_A283 Spermidine synthase; transferase, structural genom 98.58
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.58
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.57
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.57
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.57
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.55
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.55
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.54
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.54
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.54
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.53
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.53
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.52
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.52
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.51
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.51
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.5
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.5
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.5
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.49
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.49
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.49
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.49
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.48
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.48
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.48
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.47
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.46
3lkd_A 542 Type I restriction-modification system methyltrans 98.46
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.44
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.44
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.44
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.43
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.42
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.41
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.39
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.39
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.38
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.38
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.36
3khk_A544 Type I restriction-modification system methylation 98.35
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.34
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.34
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.33
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.33
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.32
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.31
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.31
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.31
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.3
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.27
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.27
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.26
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.22
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.19
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.19
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 98.19
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.18
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.16
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.15
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.13
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.12
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.12
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.11
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.11
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.1
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.1
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 98.09
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.09
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.08
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.07
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.99
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 97.96
3cc8_A230 Putative methyltransferase; structural genomics, j 97.95
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 97.94
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 97.9
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.89
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.88
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.88
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.87
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 97.84
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.8
3ufb_A 530 Type I restriction-modification system methyltran 97.77
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.74
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 97.74
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.73
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 97.72
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.72
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 97.7
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.69
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.66
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.65
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.58
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.55
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.47
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.46
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 97.32
2zig_A297 TTHA0409, putative modification methylase; methylt 97.31
3me5_A 482 Cytosine-specific methyltransferase; structural ge 97.31
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.3
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 97.25
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.23
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.23
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.2
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.19
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.16
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.15
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.03
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.0
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 96.99
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 96.95
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.95
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 96.81
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.76
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 96.74
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.69
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 96.67
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.63
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 96.57
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.5
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.49
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.49
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.48
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.45
3jrp_A379 Fusion protein of protein transport protein SEC13 96.44
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 96.38
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.35
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.33
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.29
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 96.2
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 96.19
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.18
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.02
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.98
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.93
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 95.88
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 95.85
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.84
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.73
2px2_A269 Genome polyprotein [contains: capsid protein C (co 95.67
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.6
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.5
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.44
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 95.42
3jro_A753 Fusion protein of protein transport protein SEC13 95.34
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.19
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.13
3jrp_A379 Fusion protein of protein transport protein SEC13 95.11
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 95.07
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.06
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.03
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.68
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.36
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.31
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.21
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.19
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.17
4a2l_A795 BT_4663, two-component system sensor histidine kin 94.05
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.99
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 93.98
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.88
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.82
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.8
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.79
3v9f_A781 Two-component system sensor histidine kinase/RESP 93.65
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.58
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.56
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.46
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.42
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.39
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.39
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.24
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.19
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.16
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 93.12
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.72
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 92.63
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 92.61
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.58
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 92.54
2pm7_B297 Protein transport protein SEC13, protein transport 92.46
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 92.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.35
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.14
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 92.05
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.01
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 92.0
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 91.98
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 91.84
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.8
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.79
4g56_B357 MGC81050 protein; protein arginine methyltransfera 91.78
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.74
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.71
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 91.63
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.55
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.45
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 91.43
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 91.39
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.38
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 91.37
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.26
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 91.11
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.1
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 90.99
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 90.85
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 90.63
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 90.53
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 90.39
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 90.28
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 90.27
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 90.23
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 90.19
3ott_A758 Two-component system sensor histidine kinase; beta 90.16
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 90.15
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 90.11
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 90.1
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 90.05
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 90.05
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 89.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 89.93
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 89.82
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 89.78
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 89.69
2pm7_B297 Protein transport protein SEC13, protein transport 89.64
3jro_A753 Fusion protein of protein transport protein SEC13 89.5
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 89.5
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 89.41
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 89.31
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 89.29
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 89.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.17
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.08
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 88.93
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 88.91
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 88.75
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 88.65
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 88.52
4g56_B357 MGC81050 protein; protein arginine methyltransfera 88.51
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 88.47
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 88.47
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 88.4
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 88.38
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 88.34
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 88.31
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 88.3
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.26
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 88.23
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 88.13
4e54_B435 DNA damage-binding protein 2; beta barrel, double 88.11
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 87.97
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 87.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 87.76
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 87.75
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 87.72
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 87.46
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 87.43
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 87.17
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 87.16
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 87.05
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 86.84
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 86.68
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 86.67
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 86.56
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 86.48
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 86.45
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 86.41
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 86.37
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 86.16
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 85.97
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 85.93
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 85.71
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 85.46
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 85.45
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 85.22
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 85.21
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 85.02
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 84.97
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 84.94
>2it2_A UPF0130 protein PH1069; hypothetical protein, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2drv_A 2it3_A Back     alignment and structure
Probab=100.00  E-value=5.6e-61  Score=489.93  Aligned_cols=188  Identities=36%  Similarity=0.544  Sum_probs=171.1

Q ss_pred             ccHHHHHHHHHHhccCCCCCCCCCCCCCCCcHHHHHHHhcCCCeEEecCccceeEEeecCCCC-CCCcEEEEEEccCCCh
Q 036185           39 MSFEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNAINSHPNYYTTSSCSGRISIFSHPVNK-PKGGTWLFITHDPADV  117 (1057)
Q Consensus        39 ~~f~~~k~~~l~~l~~~~~d~s~~g~vD~~i~~l~~~in~~~~~~TtSSCsGRi~~~~~~~~~-~~~~~~l~~~H~~~~~  117 (1057)
                      .+|+++|+++|++|.    |+||||+||++|+|||++||+|++|||||||||||+||++|.++ +++|+||||||+|++.
T Consensus         9 ~~F~~~K~~~L~~l~----~~s~kG~VD~~i~~ll~~INs~~~~~TTSSCSGRIsv~~~~~~~~K~~g~wl~~sH~~~~~   84 (200)
T 2it2_A            9 ENFERAKKEALMSLE----IALRKGEVDEDIIPLLKKINSIENYFTTSSCSGRISVMEMPHFGDKVNAKWLGKWHREVSL   84 (200)
T ss_dssp             TTHHHHHHHHHHHHH----HHHHHTCSCTTTHHHHHHHHHSTTEEECSCBCCEEEEEEEC-------CEEEEEESSCCCH
T ss_pred             HHHHHHHHHHHHHHH----hhcccCCCChHHHHHHHHHhCCCCcEEccCCCccEEEEecCCcCCCCCCEEEEEECCCCCH
Confidence            479999999999997    47899999999999999999999999999999999999998874 3478999999999999


Q ss_pred             hhHHhhhcCCCCCCCCCCCCceEEEEEcCcEEEEEeCCHHHHHHHHHHHHHcCccccCccccC-CceEEEEeccceeeee
Q 036185          118 DSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVK-KRVIVGIRCSLRLEVP  196 (1057)
Q Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~ep~ilhv~~~~~~~a~~ll~~a~~~Gfr~Sgi~~~~-~~~~v~ir~~~~l~~p  196 (1057)
                      +|+.+++. .       ...+.+|||||||||||+|+|+++|++||++|++||||||||++++ +++||||||+++||+|
T Consensus        85 ~e~~~~l~-~-------~~~~~l~~kfep~IlHV~~~~l~~A~~Ll~~A~~~GFr~SGi~s~~~~~~iVaIrs~~~levP  156 (200)
T 2it2_A           85 YEVLEAIK-K-------HRSGQLWFLVRSPILHVGAKTLEDAVKLVNLAVSCGFKYSNIKSISNKKLIVEIRSTERMDVL  156 (200)
T ss_dssp             HHHHHHHT-T-------CCSSEEEEEEECCEEEEEESSHHHHHHHHHHHHHTTCTTCEEECC----CEEEEECSCCEEEE
T ss_pred             HHHHHHhh-c-------cCCceEEEEecCCEEEEeeCCHHHHHHHHHHHHHcCcCccCcEecCCCceEEEEeccccEEEE
Confidence            99999987 2       1237999999999999999999999999999999999999999987 7999999999999999


Q ss_pred             eccCCceecCHhHHHHHHHHHHHHHHHhHHHHHHHHHHHHhh
Q 036185          197 LGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAFNFM  238 (1057)
Q Consensus       197 l~~~~~~~v~~~yl~~lv~~~N~~l~~n~~rl~r~~~~l~~~  238 (1057)
                      |+.+|+.+|+++||++|+++||++|.+|++||.||+++|+++
T Consensus       157 l~~~g~~lV~~eyl~~Lv~~aN~kl~~n~~rl~rl~~~l~~l  198 (200)
T 2it2_A          157 LGENGEIFVGEEYLNKIVEIANDQMRRFKEKLKRLESKINAL  198 (200)
T ss_dssp             EEETTEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGG
T ss_pred             EeeCCeEecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999875
>2qg3_A UPF0130 protein AF_2059; TYW3 methyltransferase-like prrotein, structural genomics, J center for structural genomics, JCSG; HET: MSE; 1.95A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>1tlj_A Hypothetical UPF0130 protein SSO0622; midwest center for structural genomics, PSI, protein structure initiative, MCSG; 2.80A {Sulfolobus solfataricus} SCOP: d.282.1.1 Back     alignment and structure
>2dvk_A UPF0130 protein APE0816; hypothetical protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1057
d1tlja_189 d.282.1.1 (A:) Hypothetical protein SSo0622 {Sulfo 2e-62
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 6e-56
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-11
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-11
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-10
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 8e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-04
d2c7pa1 327 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu 3e-05
d2dula1 375 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR 8e-05
d1dcta_ 324 c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a 1e-04
d2fyta1 311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 5e-04
d1g55a_ 343 c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 5e-04
d1g6q1_ 328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 0.004
>d1tlja_ d.282.1.1 (A:) Hypothetical protein SSo0622 {Sulfolobus solfataricus [TaxId: 2287]} Length = 189 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SSo0622-like
superfamily: SSo0622-like
family: SSo0622-like
domain: Hypothetical protein SSo0622
species: Sulfolobus solfataricus [TaxId: 2287]

 Score =  208 bits (531), Expect = 2e-62
 Identities = 45/199 (22%), Positives = 86/199 (43%), Gaps = 15/199 (7%)

Query: 41  FEQRKAATLASLSSSATDKSPKGTLDTPIIPLLNA-INSHPNYYTTSSCSGRISIFSHPV 99
           +E+ +   L  +          G LD  I+  L A   +  + YT SSCSGRI+I    +
Sbjct: 3   WEELREKALNKIYHD----KEIGYLDPDILGFLLAFYRNRNDVYTQSSCSGRITIVDAEM 58

Query: 100 NKPK-GGTWLFITHDPADVDSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVES 158
              +   T +F  H       +  +L        S     +L    +  I+ +  +++E+
Sbjct: 59  PWDRKNSTIIFKNHLRITEQDLEDVL--------SKNQVRRLWLIVQGPIIHIYAKNIET 110

Query: 159 AEALVSIAVSSGLRESGVTSVK-KRVIVGIRCSLRLEVPLGESGNVLVSQDYVRFLVGIA 217
              ++ IA  +G + SG+ +   K V+V +R  +R+   L ES    V +D ++ LV + 
Sbjct: 111 GWDILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVC 170

Query: 218 NQKLEANSRRIDGFLQAFN 236
           N+ L    ++++      +
Sbjct: 171 NEVLARGKQKMNLLKDLLS 189
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1057
d1tlja_189 Hypothetical protein SSo0622 {Sulfolobus solfatari 100.0
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.92
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.92
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.92
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.91
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.85
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.81
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.64
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.59
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.52
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.48
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.47
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.47
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.42
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.4
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.39
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.39
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.34
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.29
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.27
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.18
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.11
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.11
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.09
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.09
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.08
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.07
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.06
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.04
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.01
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.0
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.99
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.94
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.93
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.9
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.88
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.87
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.86
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.86
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.84
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.81
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.81
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.8
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.79
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.78
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.78
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.78
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.77
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.76
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.75
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.74
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.73
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.69
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.6
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.58
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.56
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.56
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.55
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.53
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.51
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.45
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.45
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.41
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.4
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.38
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.36
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.33
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.33
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.33
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.3
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.29
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.28
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.27
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.24
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.2
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.09
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.0
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.96
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.96
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.88
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.87
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.85
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.82
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.76
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.75
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.74
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.71
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.68
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 97.56
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.51
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 97.49
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.48
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.44
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.37
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 97.3
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.29
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.22
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.08
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.06
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.02
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.43
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 96.3
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 95.86
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 95.84
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 95.76
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.49
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.38
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 95.29
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.85
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.75
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 94.69
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.62
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.56
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 94.53
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.49
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.4
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.12
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.07
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.72
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.44
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.29
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.22
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 93.05
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 92.86
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.4
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.69
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.54
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 91.52
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.38
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 91.38
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 90.84
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 90.69
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.36
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 89.62
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 89.38
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 89.23
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 88.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 88.72
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 88.12
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 88.07
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 87.82
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 87.51
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.45
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 87.0
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 86.85
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 86.72
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 86.72
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 86.68
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 86.67
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 86.12
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.9
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 85.74
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 85.66
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 84.68
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 84.64
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 84.58
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 83.97
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 83.53
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 83.39
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 82.89
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 82.29
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 80.22
>d1tlja_ d.282.1.1 (A:) Hypothetical protein SSo0622 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SSo0622-like
superfamily: SSo0622-like
family: SSo0622-like
domain: Hypothetical protein SSo0622
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=100.00  E-value=1.6e-59  Score=472.65  Aligned_cols=184  Identities=24%  Similarity=0.375  Sum_probs=172.5

Q ss_pred             cHHHHHHHHHHhccCCCCCCCCCCCCCCCcHHHH-HHHhcCCCeEEecCccceeEEeecCCCC-CCCcEEEEEEccCCCh
Q 036185           40 SFEQRKAATLASLSSSATDKSPKGTLDTPIIPLL-NAINSHPNYYTTSSCSGRISIFSHPVNK-PKGGTWLFITHDPADV  117 (1057)
Q Consensus        40 ~f~~~k~~~l~~l~~~~~d~s~~g~vD~~i~~l~-~~in~~~~~~TtSSCsGRi~~~~~~~~~-~~~~~~l~~~H~~~~~  117 (1057)
                      .|+++|+++|++|+.    ..++|+||++|+||| ++||+||+|||||||||||+||+++.++ +++|+||||||+|++.
T Consensus         2 ~~~~~K~~~l~~l~~----~~~~G~vD~~i~~ll~~~iN~~~~~~TTSSCSGRIsvf~~~~~~~k~~~~wlf~sH~~~~~   77 (189)
T d1tlja_           2 VWEELREKALNKIYH----DKEIGYLDPDILGFLLAFYRNRNDVYTQSSCSGRITIVDAEMPWDRKNSTIIFKNHLRITE   77 (189)
T ss_dssp             HHHHHHHHHHHHHHH----HHHTTCSCGGGHHHHHHHHHTCSSEEEEEEECCEEEEEEESSTTCSTTCEEEEEESSCCCH
T ss_pred             chHHHHHHHHHHHHH----HHHCCCCChhHHHHHHHHhcCCCCeEECCCccceEEEEEcCCCCCCCCceEEEEEcccCCH
Confidence            599999999999987    358899999999977 6689999999999999999999999884 4579999999999999


Q ss_pred             hhHHhhhcCCCCCCCCCCCCceEEEEEcCcEEEEEeCCHHHHHHHHHHHHHcCccccCccccC-CceEEEEeccceeeee
Q 036185          118 DSVLSLLFFPTHTTPSSPTRDQLVFRFEPLIVAVECRDVESAEALVSIAVSSGLRESGVTSVK-KRVIVGIRCSLRLEVP  196 (1057)
Q Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~ep~ilhv~~~~~~~a~~ll~~a~~~Gfr~Sgi~~~~-~~~~v~ir~~~~l~~p  196 (1057)
                      +|+.+++. .       ...+.+|||||||||||+|+|+++|++||++|++||||||||++.+ +++||||||+++||+|
T Consensus        78 ~e~~~~l~-~-------~~~~~l~fk~ep~ILHV~cr~le~A~~Ll~~A~~~Gfk~SGI~s~~~~r~iVaIrss~~le~P  149 (189)
T d1tlja_          78 QDLEDVLS-K-------NQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHL  149 (189)
T ss_dssp             HHHHHHHH-S-------CCSSEEEEEEECCEEEEEESSHHHHHHHHHHHHHHTCTTCEEEEEETTEEEEEECCCCEEEEE
T ss_pred             HHHHHHHh-c-------cCcCeEEEEecCcEEEEEeCCHHHHHHHHHHHHHcCcchhcceecCCCcEEEEEeccCcEEee
Confidence            99999987 2       2236899999999999999999999999999999999999999986 8999999999999999


Q ss_pred             eccCCceecCHhHHHHHHHHHHHHHHHhHHHHHHHHHHH
Q 036185          197 LGESGNVLVSQDYVRFLVGIANQKLEANSRRIDGFLQAF  235 (1057)
Q Consensus       197 l~~~~~~~v~~~yl~~lv~~~N~~l~~n~~rl~r~~~~l  235 (1057)
                      |+..++.+|+++||++|+++||++|.+|++||.||+++|
T Consensus       150 l~~~~~~lV~~eyL~~lv~~aN~kl~~n~~rl~rl~~~l  188 (189)
T d1tlja_         150 LRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKDLL  188 (189)
T ss_dssp             EESSTTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             eccCCcCccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999986
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure