Citrus Sinensis ID: 036263


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MNSPAIATILRQPFLPHQQNRNQNLKKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI
cccHHHHHHcccccccccHHHccccccccccHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHcccccHHcHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHcccHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHcHHHccccccccccccc
cHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEcc
mnspaiatilrqpflphqqnrnqnlkkrpqisiqtnnskstiDTTVQWTSSisrhcrsgcILEAALEFTRMrlygtnpshITFVTLLsgcadfpsnnvMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQisgvepdyLTIISVLNVCANVRTLGIGLwmhryvpkqdfkdnvRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMqkgvfktdevSFTGALTacshagliedGLQYFDIMKKIyrvspqiehhgci
MNSPAIATilrqpflphqqnrnqnlkkrpqisiqtnnskstidTTVQWtssisrhcrsGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPqiehhgci
MNSPAIATILRQPFLPHQQNRNQNLKKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI
*****************************************IDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQ*******
******ATILRQPFLPHQQNRNQNLKKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI
MNSPAIATILRQPFLPHQQNRNQNLKKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSP********
MNSPAIATILRQPFLPHQQNRNQNLKKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSPAIATILRQPFLPHQQNRNQNLKKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q9MA50 500 Pentatricopeptide repeat- yes no 0.914 0.558 0.504 2e-86
Q9SIL5 534 Pentatricopeptide repeat- no no 0.685 0.391 0.388 4e-45
O23337 722 Pentatricopeptide repeat- no no 0.855 0.361 0.295 1e-41
Q9ZUW3 868 Pentatricopeptide repeat- no no 0.865 0.304 0.335 3e-41
Q9LIQ7 633 Pentatricopeptide repeat- no no 0.806 0.388 0.350 3e-41
Q9SN39 871 Pentatricopeptide repeat- no no 0.859 0.300 0.329 9e-41
Q9LN01 741 Pentatricopeptide repeat- no no 0.865 0.356 0.312 2e-40
A8MQA3 595 Pentatricopeptide repeat- no no 0.678 0.347 0.396 4e-40
P93005 727 Pentatricopeptide repeat- no no 0.855 0.359 0.328 4e-40
Q9LTV8 694 Pentatricopeptide repeat- no no 0.855 0.376 0.298 2e-39
>sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana GN=PDE247 PE=2 SV=1 Back     alignment and function desciption
 Score =  319 bits (817), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 208/333 (62%), Gaps = 54/333 (16%)

Query: 26  KKRPQISIQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVT 85
           K      IQ +N +ST +TTV WTS I+   R+G + EAA EF+ M L G  P+HITF+ 
Sbjct: 18  KNHANPKIQRHN-QSTSETTVSWTSRINLLTRNGRLAEAAKEFSDMTLAGVEPNHITFIA 76

Query: 86  LLSGCADFPS--------------------NNVMVSTALLDMYAKFGRMDLATVVFDVM- 124
           LLSGC DF S                    N+VMV TA++ MY+K GR   A +VFD M 
Sbjct: 77  LLSGCGDFTSGSEALGDLLHGYACKLGLDRNHVMVGTAIIGMYSKRGRFKKARLVFDYME 136

Query: 125 --------------------------------RGCDFWTALLNGFVKRDYFEEALEYFRV 152
                                           R    WTA++NGFVK+ Y EEAL +FR 
Sbjct: 137 DKNSVTWNTMIDGYMRSGQVDNAAKMFDKMPERDLISWTAMINGFVKKGYQEEALLWFRE 196

Query: 153 MQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGC 212
           MQISGV+PDY+ II+ LN C N+  L  GLW+HRYV  QDFK+NVRV N+L+D+Y R GC
Sbjct: 197 MQISGVKPDYVAIIAALNACTNLGALSFGLWVHRYVLSQDFKNNVRVSNSLIDLYCRCGC 256

Query: 213 IEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTA 272
           +EFARQVF  M KRT+VSWNS+IVGFA NG   E+L YF  MQ+  FK D V+FTGALTA
Sbjct: 257 VEFARQVFYNMEKRTVVSWNSVIVGFAANGNAHESLVYFRKMQEKGFKPDAVTFTGALTA 316

Query: 273 CSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI 305
           CSH GL+E+GL+YF IMK  YR+SP+IEH+GC+
Sbjct: 317 CSHVGLVEEGLRYFQIMKCDYRISPRIEHYGCL 349





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protein At2g20540 OS=Arabidopsis thaliana GN=PCMP-E78 PE=2 SV=1 Back     alignment and function description
>sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H87 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
359479098 518 PREDICTED: pentatricopeptide repeat-cont 0.950 0.559 0.491 8e-93
449492842 525 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.957 0.556 0.483 6e-87
449443656 525 PREDICTED: pentatricopeptide repeat-cont 0.957 0.556 0.483 9e-87
356547111 521 PREDICTED: pentatricopeptide repeat-cont 0.862 0.504 0.514 2e-85
297843364 500 PDE247 [Arabidopsis lyrata subsp. lyrata 0.914 0.558 0.495 5e-85
145335149 500 protein pigment defective 247 [Arabidops 0.914 0.558 0.504 1e-84
255565773384 pentatricopeptide repeat-containing prot 0.875 0.695 0.514 1e-84
347954512 476 chloroplast biogenesis 19, partial [Raph 0.950 0.609 0.492 9e-84
347954510 475 chloroplast biogenesis 19, partial [Olim 0.881 0.566 0.490 3e-83
347954496 489 chloroplast biogenesis 19, partial [Caps 0.914 0.570 0.486 3e-83
>gi|359479098|ref|XP_002274209.2| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  346 bits (887), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 231/346 (66%), Gaps = 56/346 (16%)

Query: 16  PHQQNRNQNLKKRPQIS---IQTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMR 72
           P+ +        RP  +   +  +++ S ID  V WTSSI+ HCR+G + EAA EF+RM+
Sbjct: 22  PNSKPNQPTFPSRPHSTKYHLTRSHTHSPIDPIVSWTSSIALHCRNGQLPEAAAEFSRMQ 81

Query: 73  LYGTNPSHITFVTLLSGCADFP--------------------SNNVMVSTALLDMYAKFG 112
           + G  P+HITF+TLLS C DFP                    + NVMV TAL+DMY+K G
Sbjct: 82  IAGVRPNHITFLTLLSACTDFPLEGLRFGGSIHAYVRKLGLDTENVMVGTALVDMYSKCG 141

Query: 113 RMDLATVVFDVM---------------------------------RGCDFWTALLNGFVK 139
           ++DLA ++FD M                                 R    WT+++ GFVK
Sbjct: 142 QLDLAWLMFDEMHVRNSVSWNTMIDGCMRNGEVGEAIVLFDQMSERDAISWTSMIGGFVK 201

Query: 140 RDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRV 199
           +  FE+ALE+FR MQ++GVEPDY+TIISVL  CAN+  LG+GLW++R+V KQDFKDN+++
Sbjct: 202 KGCFEQALEWFREMQLAGVEPDYVTIISVLAACANLGALGLGLWINRFVMKQDFKDNIKI 261

Query: 200 CNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVF 259
            N+L+D+YSR GCI  ARQVF++M KR+LVSWNS+IVGFA+NG   EALE+FNLM+K  F
Sbjct: 262 SNSLIDMYSRCGCIRLARQVFEQMPKRSLVSWNSMIVGFALNGHAEEALEFFNLMRKEGF 321

Query: 260 KTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI 305
           + D VSFTGALTACSH+GL+++GLQ+FDIMK+  ++SP+IEH+GC+
Sbjct: 322 RPDGVSFTGALTACSHSGLVDEGLQFFDIMKRTRKISPRIEHYGCL 367




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449492842|ref|XP_004159118.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443656|ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356547111|ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297843364|ref|XP_002889563.1| PDE247 [Arabidopsis lyrata subsp. lyrata] gi|297335405|gb|EFH65822.1| PDE247 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145335149|ref|NP_172066.3| protein pigment defective 247 [Arabidopsis thaliana] gi|75191933|sp|Q9MA50.1|PPR13_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g05750, chloroplastic; AltName: Full=Protein PIGMENT DEFECTIVE 247; Flags: Precursor gi|6850304|gb|AAF29381.1|AC009999_1 Contains similarity to a hypothetical protein from Arabidopsis thaliana gb|AC007109.6, and contains two DUF17 PF|01535 domains [Arabidopsis thaliana] gi|62320576|dbj|BAD95203.1| hypothetical protein [Arabidopsis thaliana] gi|332189766|gb|AEE27887.1| protein pigment defective 247 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255565773|ref|XP_002523876.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536964|gb|EEF38602.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|347954512|gb|AEP33756.1| chloroplast biogenesis 19, partial [Raphanus sativus] Back     alignment and taxonomy information
>gi|347954510|gb|AEP33755.1| chloroplast biogenesis 19, partial [Olimarabidopsis pumila] Back     alignment and taxonomy information
>gi|347954496|gb|AEP33748.1| chloroplast biogenesis 19, partial [Capsella bursa-pastoris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
TAIR|locus:2198678 500 PDE247 "pigment defective 247" 0.685 0.418 0.599 2e-65
TAIR|locus:2054789 534 MEF21 "mitochondrial editing f 0.685 0.391 0.388 1.9e-42
TAIR|locus:4515103421 654 AT4G19191 "AT4G19191" [Arabido 0.750 0.350 0.337 9.3e-41
TAIR|locus:2124137 871 DOT4 "DEFECTIVELY ORGANIZED TR 0.685 0.239 0.358 2.5e-39
TAIR|locus:2206164 570 AT1G31430 [Arabidopsis thalian 0.681 0.364 0.372 4.2e-39
TAIR|locus:2093920 687 AT3G15930 "AT3G15930" [Arabido 0.691 0.307 0.356 6.7e-39
TAIR|locus:4010713895 595 AT4G21065 "AT4G21065" [Arabido 0.678 0.347 0.396 1.7e-38
TAIR|locus:2057574 583 AT2G33760 [Arabidopsis thalian 0.675 0.353 0.354 6.4e-38
TAIR|locus:2159602 511 AT5G08510 "AT5G08510" [Arabido 0.701 0.418 0.353 7.3e-38
TAIR|locus:2057630 727 AT2G33680 "AT2G33680" [Arabido 0.685 0.287 0.360 7.9e-38
TAIR|locus:2198678 PDE247 "pigment defective 247" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 666 (239.5 bits), Expect = 2.0e-65, P = 2.0e-65
 Identities = 127/212 (59%), Positives = 161/212 (75%)

Query:    96 NNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDF--WTALLNGFVKRDYFEEALEYFRVM 153
             N+V  +T ++D Y + G++D A  +FD M   D   WTA++NGFVK+ Y EEAL +FR M
Sbjct:   139 NSVTWNT-MIDGYMRSGQVDNAAKMFDKMPERDLISWTAMINGFVKKGYQEEALLWFREM 197

Query:   154 QISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCI 213
             QISGV+PDY+ II+ LN C N+  L  GLW+HRYV  QDFK+NVRV N+L+D+Y R GC+
Sbjct:   198 QISGVKPDYVAIIAALNACTNLGALSFGLWVHRYVLSQDFKNNVRVSNSLIDLYCRCGCV 257

Query:   214 EFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTAC 273
             EFARQVF  M KRT+VSWNS+IVGFA NG   E+L YF  MQ+  FK D V+FTGALTAC
Sbjct:   258 EFARQVFYNMEKRTVVSWNSVIVGFAANGNAHESLVYFRKMQEKGFKPDAVTFTGALTAC 317

Query:   274 SHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI 305
             SH GL+E+GL+YF IMK  YR+SP+IEH+GC+
Sbjct:   318 SHVGLVEEGLRYFQIMKCDYRISPRIEHYGCL 349


GO:0005739 "mitochondrion" evidence=ISM
GO:0009451 "RNA modification" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2054789 MEF21 "mitochondrial editing factor 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103421 AT4G19191 "AT4G19191" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206164 AT1G31430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093920 AT3G15930 "AT3G15930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057574 AT2G33760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159602 AT5G08510 "AT5G08510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057630 AT2G33680 "AT2G33680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00017500001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (518 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-41
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-38
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-37
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-35
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-28
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-24
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  151 bits (384), Expect = 3e-41
 Identities = 86/280 (30%), Positives = 150/280 (53%), Gaps = 23/280 (8%)

Query: 46  VQWTSSISRHCRSGCILEAALE-FTRMRLYGTNPSHITFVTLLSGCADFPS--------- 95
           V WT+ IS + ++G + + ALE +  M     +P  IT  ++LS CA             
Sbjct: 355 VSWTAMISGYEKNG-LPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHE 413

Query: 96  --------NNVMVSTALLDMYAKFGRMDLATVVFDVMRGCDF--WTALLNGFVKRDYFEE 145
                   + V+V+ AL++MY+K   +D A  VF  +   D   WT+++ G    +   E
Sbjct: 414 LAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFE 473

Query: 146 ALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMD 205
           AL +FR M ++ ++P+ +T+I+ L+ CA +  L  G  +H +V +     +  + N L+D
Sbjct: 474 ALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLD 532

Query: 206 VYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVS 265
           +Y R G + +A   F   H++ +VSWN ++ G+  +G    A+E FN M +     DEV+
Sbjct: 533 LYVRCGRMNYAWNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVT 591

Query: 266 FTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI 305
           F   L ACS +G++  GL+YF  M++ Y ++P ++H+ C+
Sbjct: 592 FISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACV 631


Length = 857

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.79
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.73
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.71
PF1304150 PPR_2: PPR repeat family 99.58
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.58
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.55
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.55
PF1304150 PPR_2: PPR repeat family 99.53
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.49
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.48
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.48
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.47
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.46
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.44
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.41
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.4
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.37
KOG1126638 consensus DNA-binding cell division cycle control 99.36
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.33
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.3
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.26
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.25
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.25
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.25
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.25
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.19
PRK12370553 invasion protein regulator; Provisional 99.17
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.17
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.16
PRK14574 822 hmsH outer membrane protein; Provisional 99.12
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.11
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.1
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.08
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.07
KOG2003 840 consensus TPR repeat-containing protein [General f 99.06
PRK12370553 invasion protein regulator; Provisional 99.05
KOG1126638 consensus DNA-binding cell division cycle control 99.04
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.04
PRK14574 822 hmsH outer membrane protein; Provisional 98.99
PF1285434 PPR_1: PPR repeat 98.98
KOG1129478 consensus TPR repeat-containing protein [General f 98.97
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.95
KOG2003 840 consensus TPR repeat-containing protein [General f 98.94
PRK11189296 lipoprotein NlpI; Provisional 98.92
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.91
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.91
PF1285434 PPR_1: PPR repeat 98.91
PRK11189296 lipoprotein NlpI; Provisional 98.87
KOG1129478 consensus TPR repeat-containing protein [General f 98.81
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.77
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.76
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.76
KOG0547606 consensus Translocase of outer mitochondrial membr 98.73
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.71
KOG2076 895 consensus RNA polymerase III transcription factor 98.68
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.68
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.66
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.65
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.64
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.62
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.6
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.59
KOG2076 895 consensus RNA polymerase III transcription factor 98.56
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.56
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.52
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.52
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.52
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.5
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.5
PRK10370198 formate-dependent nitrite reductase complex subuni 98.48
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.47
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.46
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.44
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.44
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.43
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.39
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.37
PRK10370198 formate-dependent nitrite reductase complex subuni 98.35
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.35
KOG0547606 consensus Translocase of outer mitochondrial membr 98.33
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.33
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.31
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.28
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.28
PRK15359144 type III secretion system chaperone protein SscB; 98.27
PLN02789320 farnesyltranstransferase 98.25
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.25
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.23
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.23
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.22
KOG1125579 consensus TPR repeat-containing protein [General f 98.22
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.19
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.16
PRK15359144 type III secretion system chaperone protein SscB; 98.15
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.13
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.13
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.13
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.13
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.11
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.09
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.09
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.06
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.06
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.03
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.02
PRK04841 903 transcriptional regulator MalT; Provisional 98.01
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.0
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.99
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.98
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.97
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.97
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.95
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.91
KOG1125579 consensus TPR repeat-containing protein [General f 97.91
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.91
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.89
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.88
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 97.85
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.84
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.83
PRK04841 903 transcriptional regulator MalT; Provisional 97.8
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.79
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.78
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.77
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.75
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.71
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.71
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.7
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.69
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.67
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.66
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.65
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.65
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.64
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.63
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.63
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.62
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.57
PF12688120 TPR_5: Tetratrico peptide repeat 97.55
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.53
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.49
PLN02789320 farnesyltranstransferase 97.48
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.45
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.4
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.4
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.38
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.37
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.36
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.34
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.31
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.29
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.27
KOG0553304 consensus TPR repeat-containing protein [General f 97.26
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.22
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.19
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.16
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.15
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.12
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.07
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.07
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.05
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.04
COG4700251 Uncharacterized protein conserved in bacteria cont 97.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.01
PF12688120 TPR_5: Tetratrico peptide repeat 96.98
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.98
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.95
KOG0553304 consensus TPR repeat-containing protein [General f 96.93
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 96.91
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.86
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.84
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.84
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.82
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.81
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.76
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.74
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.72
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.71
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.71
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.7
PRK10803263 tol-pal system protein YbgF; Provisional 96.64
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.61
KOG3941 406 consensus Intermediate in Toll signal transduction 96.59
COG4700251 Uncharacterized protein conserved in bacteria cont 96.57
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.57
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.45
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.41
PF1337173 TPR_9: Tetratricopeptide repeat 96.28
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.26
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.19
PRK10803263 tol-pal system protein YbgF; Provisional 96.17
KOG3941 406 consensus Intermediate in Toll signal transduction 96.15
PF1337173 TPR_9: Tetratricopeptide repeat 96.08
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.03
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.96
smart00299140 CLH Clathrin heavy chain repeat homology. 95.95
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.87
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.83
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.8
smart00299140 CLH Clathrin heavy chain repeat homology. 95.75
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.74
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.73
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.72
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.69
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.63
COG3898 531 Uncharacterized membrane-bound protein [Function u 95.62
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.59
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 95.56
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.48
PRK15331165 chaperone protein SicA; Provisional 94.98
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.94
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.87
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.65
KOG1585308 consensus Protein required for fusion of vesicles 94.46
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.37
PRK15331165 chaperone protein SicA; Provisional 94.31
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.18
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.12
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.12
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.07
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.01
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.81
COG3629280 DnrI DNA-binding transcriptional activator of the 93.8
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.8
PF13512142 TPR_18: Tetratricopeptide repeat 93.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.56
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.48
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.42
KOG4570 418 consensus Uncharacterized conserved protein [Funct 93.28
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.23
COG3629280 DnrI DNA-binding transcriptional activator of the 93.2
KOG1585308 consensus Protein required for fusion of vesicles 93.12
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.95
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.51
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.42
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.41
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.33
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.22
PF1342844 TPR_14: Tetratricopeptide repeat 92.11
PF1342844 TPR_14: Tetratricopeptide repeat 91.93
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.77
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 91.74
PF13929292 mRNA_stabil: mRNA stabilisation 91.71
PF1343134 TPR_17: Tetratricopeptide repeat 91.55
KOG4555175 consensus TPR repeat-containing protein [Function 91.49
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.47
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.33
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.32
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.22
PF13762145 MNE1: Mitochondrial splicing apparatus component 90.96
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.53
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 90.33
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.09
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.52
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.39
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.38
KOG2297412 consensus Predicted translation factor, contains W 89.3
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.85
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.72
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.72
COG3118304 Thioredoxin domain-containing protein [Posttransla 88.52
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.44
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.34
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.31
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.67
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.18
PF13929292 mRNA_stabil: mRNA stabilisation 87.16
TIGR01503 480 MthylAspMut_E methylaspartate mutase, E subunit. T 86.75
COG0457291 NrfG FOG: TPR repeat [General function prediction 86.74
PF13512142 TPR_18: Tetratricopeptide repeat 86.66
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 86.56
PRK11906458 transcriptional regulator; Provisional 86.16
COG3898 531 Uncharacterized membrane-bound protein [Function u 85.8
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 85.4
KOG1586288 consensus Protein required for fusion of vesicles 85.25
KOG4555175 consensus TPR repeat-containing protein [Function 84.86
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 84.73
COG3118304 Thioredoxin domain-containing protein [Posttransla 84.71
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.7
KOG1258577 consensus mRNA processing protein [RNA processing 84.67
COG1747 711 Uncharacterized N-terminal domain of the transcrip 84.66
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 84.55
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 84.54
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.36
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 84.31
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 84.24
KOG20411189 consensus WD40 repeat protein [General function pr 84.22
PRK11906458 transcriptional regulator; Provisional 83.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 83.52
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 83.32
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 83.28
COG4455273 ImpE Protein of avirulence locus involved in tempe 83.15
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.68
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.47
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 81.85
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.43
COG0457291 NrfG FOG: TPR repeat [General function prediction 81.3
KOG1550 552 consensus Extracellular protein SEL-1 and related 80.86
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-50  Score=370.08  Aligned_cols=272  Identities=31%  Similarity=0.489  Sum_probs=264.3

Q ss_pred             ccccCCCCCCchHhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHhhHHHHHHhhcCCCC-----------------C
Q 036263           34 QTNNSKSTIDTTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPS-----------------N   96 (305)
Q Consensus        34 ~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~-----------------~   96 (305)
                      ...++++++||.++||.+|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.+.                 +
T Consensus       178 ~~lf~~m~~~~~~t~n~li~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~  257 (697)
T PLN03081        178 RRLFDEMPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVG  257 (697)
T ss_pred             HHHHhcCCCCCeeeHHHHHHHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCc
Confidence            44578888999999999999999999999999999999999999999999999999998876                 8


Q ss_pred             ChhHHHHHHHHHHhcCChHHHHHHHHhcCc--cccHHHHHHHHHcCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHhcC
Q 036263           97 NVMVSTALLDMYAKFGRMDLATVVFDVMRG--CDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCAN  174 (305)
Q Consensus        97 ~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~--~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~  174 (305)
                      |..+|++|+++|++.|++++|.++|+.|+.  ..+||++|.+|++.|++++|+++|++|.+.|+.||..||++++.+|++
T Consensus       258 d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~  337 (697)
T PLN03081        258 DTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSR  337 (697)
T ss_pred             cceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHh
Confidence            999999999999999999999999999976  778999999999999999999999999999999999999999999999


Q ss_pred             cCChhHHHHHHHHHhhcCCCCChhHHHHHHHHHHhcCChHHHHHHHHhcccCchhhHHHHHHHHHhcCChHHHHHHHHHH
Q 036263          175 VRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNLM  254 (305)
Q Consensus       175 ~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m  254 (305)
                      .|++++|.+++..|.+.|+.||..+|++||++|++.|++++|.++|++|.+||+.+||.||.+|+++|+.++|.++|++|
T Consensus       338 ~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M  417 (697)
T PLN03081        338 LALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERM  417 (697)
T ss_pred             ccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHHhCCCCCccccccC
Q 036263          255 QKGVFKTDEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQIEHHGCI  305 (305)
Q Consensus       255 ~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~p~~~~y~~l  305 (305)
                      .+.|+.||..||+.++.+|++.|.+++|.++|+.|.+..|+.|+..||++|
T Consensus       418 ~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~l  468 (697)
T PLN03081        418 IAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACM  468 (697)
T ss_pred             HHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhH
Confidence            999999999999999999999999999999999999678999999999985



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG2297 consensus Predicted translation factor, contains W2 domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>TIGR01503 MthylAspMut_E methylaspartate mutase, E subunit Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 53.3 bits (126), Expect = 5e-08
 Identities = 20/132 (15%), Positives = 46/132 (34%), Gaps = 10/132 (7%)

Query: 103 ALLDMYAKFGRMDLATVVFDVMRG---------CDFWTALLNGFVKRDYFEEALEYFRVM 153
           A         ++ LA  +  V  G          D + A++ G+ ++  F+E +    ++
Sbjct: 132 AFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMV 191

Query: 154 QISGVEPDYLTIISVLNVCANV-RTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGC 212
           + +G+ PD L+  + L       +  G        + ++  K        L+    R   
Sbjct: 192 KDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATV 251

Query: 213 IEFARQVFQRMH 224
           ++   +V     
Sbjct: 252 LKAVHKVKPTFS 263


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.92
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.92
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.82
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.81
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.8
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.79
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.66
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.65
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.65
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.63
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.61
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.6
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.58
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.57
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.53
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.52
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.49
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.47
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.43
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.41
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.37
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.37
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.37
3u4t_A272 TPR repeat-containing protein; structural genomics 99.36
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.35
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.3
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.3
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.29
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.25
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.23
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.2
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.19
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.18
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.17
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.14
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.11
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.11
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.1
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.04
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.03
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.03
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.01
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.0
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.98
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.97
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.95
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.92
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.92
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.88
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.87
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.85
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.84
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.82
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.81
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.81
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.78
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.78
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.77
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.75
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.74
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.72
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.72
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.68
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.68
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.67
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.66
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.61
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.56
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.51
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.47
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.46
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.46
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.43
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.42
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.42
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.41
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.4
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.4
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.38
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.37
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.35
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.35
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.33
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.29
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.29
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.27
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.24
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.23
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.21
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.17
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.16
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.1
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.1
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.09
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.06
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.05
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.05
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.0
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.97
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.96
3k9i_A117 BH0479 protein; putative protein binding protein, 97.94
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.94
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.93
3k9i_A117 BH0479 protein; putative protein binding protein, 97.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.92
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.89
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.83
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.81
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.8
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.77
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.76
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.7
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.69
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.68
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.61
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.61
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.6
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.57
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.53
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 97.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.38
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.28
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.2
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.12
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.12
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.07
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.03
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.96
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.76
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.44
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.84
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.74
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.63
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.57
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.55
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.45
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.12
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.97
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 94.68
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.43
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.41
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.59
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.35
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.2
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.1
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.92
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.84
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.83
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 90.97
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 90.94
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.56
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.11
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.2
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.24
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 85.46
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.04
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.32
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.3
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.94
2p58_C116 Putative type III secretion protein YSCG; type III 83.87
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 82.99
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 82.25
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 81.68
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.62
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 81.09
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.46
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 80.45
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=8e-35  Score=254.69  Aligned_cols=195  Identities=12%  Similarity=0.089  Sum_probs=178.1

Q ss_pred             chHhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHhhHHHHHHhhcCCCCCChhHHHHHHHHHHhcCChHHHHHHHHh
Q 036263           44 TTVQWTSSISRHCRSGCILEAALEFTRMRLYGTNPSHITFVTLLSGCADFPSNNVMVSTALLDMYAKFGRMDLATVVFDV  123 (305)
Q Consensus        44 ~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~  123 (305)
                      +...++.+|.+|++.|++++|+++|++|.+.|++||..||+++|.+|++.                  +...++      
T Consensus        25 pe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~------------------~~~~~~------   80 (501)
T 4g26_A           25 PEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLA------------------EAATES------   80 (501)
T ss_dssp             HHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTC------------------CCCSSS------
T ss_pred             CHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhC------------------Cchhhh------
Confidence            34568899999999999999999999999999999999998888875443                  332211      


Q ss_pred             cCccccHHHHHHHHHcCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHhcCcCChhHHHHHHHHHhhcCCCCChhHHHHH
Q 036263          124 MRGCDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNVCANVRTLGIGLWMHRYVPKQDFKDNVRVCNTL  203 (305)
Q Consensus       124 ~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l  203 (305)
                                    .+.+.++.|.++|++|.+.|+.||..||+++|.+|++.|++++|.++|++|.+.|+.||..+|+++
T Consensus        81 --------------~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~l  146 (501)
T 4g26_A           81 --------------SPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPA  146 (501)
T ss_dssp             --------------SCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHH
T ss_pred             --------------hhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHH
Confidence                          234557889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCChHHHHHHHHhcc----cCchhhHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcc
Q 036263          204 MDVYSRFGCIEFARQVFQRMH----KRTLVSWNSIIVGFAVNGFVGEALEYFNLMQKGVFKTDEVSFTGALTACSHA  276 (305)
Q Consensus       204 i~~~~~~g~~~~a~~~~~~~~----~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~  276 (305)
                      |.+|++.|++++|.++|++|.    .||..+|++||.+|++.|++++|.+++++|++.|+.|+..||+.++..|...
T Consensus       147 I~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          147 LFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            999999999999999999998    4899999999999999999999999999999999999999999999998764



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.69
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.59
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.92
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.89
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.83
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.66
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.56
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.41
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.38
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.27
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.12
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.07
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.06
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.03
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.01
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.01
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.83
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.8
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.77
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.72
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.7
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.62
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.6
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.55
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.46
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.4
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.34
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.24
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.15
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.03
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.89
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.52
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.34
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.22
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.06
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.03
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.81
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.25
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.83
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.68
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.94
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.55
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.06
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 82.55
d1us7b_201 Hsp90 co-chaperone CDC37 {Human (Homo sapiens) [Ta 80.8
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 80.68
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=2.7e-14  Score=118.44  Aligned_cols=196  Identities=13%  Similarity=0.089  Sum_probs=165.7

Q ss_pred             ChhHHHHHHHHHHhcCChHHHHHHHHhcCc-----cccHHHHHHHHHcCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Q 036263           97 NVMVSTALLDMYAKFGRMDLATVVFDVMRG-----CDFWTALLNGFVKRDYFEEALEYFRVMQISGVEPDYLTIISVLNV  171 (305)
Q Consensus        97 ~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~-----~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~  171 (305)
                      +...+..+...+...|+++.|...++....     ...|..+...+...|++++|...+++....+ ..+...+..+...
T Consensus       168 ~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~  246 (388)
T d1w3ba_         168 FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACV  246 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHH
T ss_pred             hhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHH
Confidence            345677778888889999999999887643     4568888899999999999999999887754 3456778888889


Q ss_pred             hcCcCChhHHHHHHHHHhhcCCCCChhHHHHHHHHHHhcCChHHHHHHHHhccc---CchhhHHHHHHHHHhcCChHHHH
Q 036263          172 CANVRTLGIGLWMHRYVPKQDFKDNVRVCNTLMDVYSRFGCIEFARQVFQRMHK---RTLVSWNSIIVGFAVNGFVGEAL  248 (305)
Q Consensus       172 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~a~  248 (305)
                      +.+.|++++|...+++..+.. +-+..++..+...+...|++++|.+.++....   .+...+..+...+...|++++|.
T Consensus       247 ~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~  325 (388)
T d1w3ba_         247 YYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAV  325 (388)
T ss_dssp             HHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHH
T ss_pred             HHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHH
Confidence            999999999999999998875 55678899999999999999999999998774   46678888999999999999999


Q ss_pred             HHHHHHHHCCCCC-CHHHHHHHHHHHhccCcHHHHHHHHHHHHHHhCCCCCc
Q 036263          249 EYFNLMQKGVFKT-DEVSFTGALTACSHAGLIEDGLQYFDIMKKIYRVSPQI  299 (305)
Q Consensus       249 ~~~~~m~~~g~~p-~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~p~~  299 (305)
                      +.|++..+.  .| +..++..+..++.+.|++++|.+.|++..   .+.|+.
T Consensus       326 ~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al---~l~P~~  372 (388)
T d1w3ba_         326 RLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAI---RISPTF  372 (388)
T ss_dssp             HHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHH---TTCTTC
T ss_pred             HHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH---HhCCCC
Confidence            999998874  45 56778889999999999999999999887   566653



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1us7b_ a.205.1.1 (B:) Hsp90 co-chaperone CDC37 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure