Citrus Sinensis ID: 036287


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW
cHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHcccccccccHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
cHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEEcccccEcccccc
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLfdempecndvVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREmqrdnvrpnEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMInqgirptkVTFVGVLNacshgglvdLGFEIFQSMtrdygiepqiehYGCIVDLlsrvgrpeeaydfitnmkiapdhiMLGSLLSACKIHGKLQLGEQIAKRLLdcrsadsgtYVLLSNAYASSGKWKEAVQIRAKMKeagvqkepgcssievnNEIHEFilgdirhpqREQIYKKMQELKQIVKlegyspstevVLHDIEDWEKEWALAIHSERLAICYGlistkpyttirVVKNLRVCNDCHSMIKLIANITKRkiivrdrnrfhhfengtcscgdyw
egreihgqvlklglrsnrstrLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSnayassgkwKEAVQIRAKMKeagvqkepgcssiEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIanitkrkiivrdrnrfhhfengtcscgdyw
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW
********VLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAK**********GCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGD**
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRA***********GCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query488 2.2.26 [Sep-21-2011]
Q9FIF7544 Putative pentatricopeptid yes no 0.803 0.720 0.643 1e-157
Q9SZT8632 Pentatricopeptide repeat- no no 0.997 0.770 0.479 1e-139
O82380738 Pentatricopeptide repeat- no no 0.995 0.658 0.478 1e-130
Q9FJY7620 Pentatricopeptide repeat- no no 0.997 0.785 0.464 1e-128
Q9FI80646 Pentatricopeptide repeat- no no 1.0 0.755 0.443 1e-128
Q9FG16622 Pentatricopeptide repeat- no no 0.995 0.781 0.448 1e-128
Q683I9573 Pentatricopeptide repeat- no no 0.995 0.848 0.421 1e-121
Q9LN01741 Pentatricopeptide repeat- no no 1.0 0.658 0.425 1e-119
Q9FND7612 Putative pentatricopeptid no no 0.995 0.794 0.427 1e-119
Q9SUH6792 Pentatricopeptide repeat- no no 0.926 0.570 0.429 1e-119
>sp|Q9FIF7|PP435_ARATH Putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E41 PE=3 SV=1 Back     alignment and function desciption
 Score =  556 bits (1433), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 325/393 (82%), Gaps = 1/393 (0%)

Query: 3   REIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYVE 62
           REIH QVLKLG  S+RS  LK++E+YGK GE  +A ++FDEMP+  D VA+TVMINCY E
Sbjct: 143 REIHAQVLKLGFGSSRSVGLKMMEIYGKSGELVNAKKMFDEMPD-RDHVAATVMINCYSE 201

Query: 63  HGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCV 122
            G ++ A E+F  VK+KDTVCWTAMIDGLVRN EM +AL+LFREMQ +NV  NE T VCV
Sbjct: 202 CGFIKEALELFQDVKIKDTVCWTAMIDGLVRNKEMNKALELFREMQMENVSANEFTAVCV 261

Query: 123 LSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERDV 182
           LSACS LGALELGRW+HS++   R++L++ VG ALINMYSRCGDI++A +VF  M+++DV
Sbjct: 262 LSACSDLGALELGRWVHSFVENQRMELSNFVGNALINMYSRCGDINEARRVFRVMRDKDV 321

Query: 183 TTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQS 242
            +YN++I+GLAMHG S+EA+  FR+M+N+G RP +VT V +LNACSHGGL+D+G E+F S
Sbjct: 322 ISYNTMISGLAMHGASVEAINEFRDMVNRGFRPNQVTLVALLNACSHGGLLDIGLEVFNS 381

Query: 243 MTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQ 302
           M R + +EPQIEHYGCIVDLL RVGR EEAY FI N+ I PDHIMLG+LLSACKIHG ++
Sbjct: 382 MKRVFNVEPQIEHYGCIVDLLGRVGRLEEAYRFIENIPIEPDHIMLGTLLSACKIHGNME 441

Query: 303 LGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEVN 362
           LGE+IAKRL +  + DSGTYVLLSN YASSGKWKE+ +IR  M+++G++KEPGCS+IEV+
Sbjct: 442 LGEKIAKRLFESENPDSGTYVLLSNLYASSGKWKESTEIRESMRDSGIEKEPGCSTIEVD 501

Query: 363 NEIHEFILGDIRHPQREQIYKKMQELKQIVKLE 395
           N+IHEF++GDI HP +E IY+++QEL +I++ +
Sbjct: 502 NQIHEFLVGDIAHPHKEAIYQRLQELNRILRFK 534





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein At4g37380, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H48 PE=3 SV=1 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1 Back     alignment and function description
>sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protein At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
224069701 621 predicted protein [Populus trichocarpa] 0.971 0.763 0.747 0.0
359495698 650 PREDICTED: putative pentatricopeptide re 0.995 0.747 0.739 0.0
359495599 650 PREDICTED: putative pentatricopeptide re 0.995 0.747 0.733 0.0
296080932 607 unnamed protein product [Vitis vinifera] 0.942 0.757 0.706 0.0
297744892 614 unnamed protein product [Vitis vinifera] 0.942 0.749 0.700 0.0
356545004 629 PREDICTED: putative pentatricopeptide re 0.995 0.772 0.648 0.0
225438894 628 PREDICTED: pentatricopeptide repeat-cont 0.995 0.773 0.521 1e-157
147790932575 hypothetical protein VITISV_001089 [Viti 0.995 0.845 0.519 1e-156
334188487544 pentatricopeptide repeat-containing prot 0.803 0.720 0.643 1e-156
449448280 645 PREDICTED: pentatricopeptide repeat-cont 0.995 0.753 0.517 1e-152
>gi|224069701|ref|XP_002303023.1| predicted protein [Populus trichocarpa] gi|222844749|gb|EEE82296.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/488 (74%), Positives = 427/488 (87%), Gaps = 14/488 (2%)

Query: 1   EGREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCY 60
           EGRE+H QVLKLGL SNRS R+KL+ELYGKCG F+DA ++FDEMPE  DVVASTVMIN Y
Sbjct: 148 EGREVHSQVLKLGLSSNRSIRIKLIELYGKCGAFEDARRVFDEMPE-RDVVASTVMINYY 206

Query: 61  VEHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIV 120
            +HG             +KDTVCWTAMIDGLVRNGE  RAL++FR MQR++V PNEVTIV
Sbjct: 207 FDHG-------------IKDTVCWTAMIDGLVRNGESNRALEVFRNMQREDVMPNEVTIV 253

Query: 121 CVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKER 180
           CVLSACS+LGAL+LGRW+ SYM KHRI+LNH VGGALINMYSRCGDID+A +VFE+MKE+
Sbjct: 254 CVLSACSELGALQLGRWVRSYMDKHRIELNHFVGGALINMYSRCGDIDEAQRVFEQMKEK 313

Query: 181 DVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIF 240
           +V TYNS+I G A+HG+S+EAVE+FR +I QG  P+ VTFVGVLNACSHGGL +LGFEIF
Sbjct: 314 NVITYNSMIMGFALHGKSVEAVELFRGLIKQGFTPSSVTFVGVLNACSHGGLAELGFEIF 373

Query: 241 QSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGK 300
            SM +DYGIEPQIEHYGC+VDLL R+GR EEAY FI  MK+APDH+MLG+LLSACKIHG 
Sbjct: 374 HSMAKDYGIEPQIEHYGCMVDLLGRLGRLEEAYSFIRMMKVAPDHVMLGALLSACKIHGN 433

Query: 301 LQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIE 360
           L+L E++AK L+ C++ADSGTY+LLSNAY+SSGKWKEA ++R  M+E G++KEPGCSSIE
Sbjct: 434 LELAERVAKSLVACKNADSGTYILLSNAYSSSGKWKEAAEVRTNMREEGIEKEPGCSSIE 493

Query: 361 VNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIH 420
           VNNEIHEF+LGD+RHPQ+E+IYKK++EL QI++LEGY+P+TEVVLHDIE  EKEWALAIH
Sbjct: 494 VNNEIHEFLLGDLRHPQKEKIYKKLEELNQILRLEGYTPATEVVLHDIEKSEKEWALAIH 553

Query: 421 SERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENG 480
           SERLAICYGLISTKP TT+RVVKNLRVCNDCH  IKLI+NIT+RKI+VRDRNRFHHFENG
Sbjct: 554 SERLAICYGLISTKPLTTLRVVKNLRVCNDCHLTIKLISNITRRKIVVRDRNRFHHFENG 613

Query: 481 TCSCGDYW 488
            CSCGDYW
Sbjct: 614 VCSCGDYW 621




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359495698|ref|XP_003635064.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495599|ref|XP_003635033.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296080932|emb|CBI18728.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744892|emb|CBI38389.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356545004|ref|XP_003540936.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225438894|ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147790932|emb|CAN77232.1| hypothetical protein VITISV_001089 [Vitis vinifera] Back     alignment and taxonomy information
>gi|334188487|ref|NP_200728.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170817|sp|Q9FIF7.1|PP435_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic; Flags: Precursor gi|9759241|dbj|BAB09765.1| unnamed protein product [Arabidopsis thaliana] gi|332009773|gb|AED97156.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449448280|ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] gi|449513125|ref|XP_004164238.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
TAIR|locus:2126352632 AT4G37380 [Arabidopsis thalian 0.995 0.768 0.480 9.6e-128
TAIR|locus:2060640738 OTP81 "ORGANELLE TRANSCRIPT PR 0.995 0.658 0.478 1.2e-120
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.997 0.785 0.464 6.9e-118
TAIR|locus:2154389646 LPA66 "LOW PSII ACCUMULATION 6 1.0 0.755 0.443 1.1e-117
TAIR|locus:2144143622 AT5G06540 [Arabidopsis thalian 0.995 0.781 0.448 1.1e-117
TAIR|locus:2081635573 AT3G62890 [Arabidopsis thalian 0.995 0.848 0.423 5.8e-114
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 1.0 0.658 0.425 5.2e-113
TAIR|locus:2125899990 AT4G33170 [Arabidopsis thalian 0.901 0.444 0.445 8.9e-113
TAIR|locus:4010713776659 AT3G26782 [Arabidopsis thalian 0.899 0.666 0.427 5.5e-111
TAIR|locus:1009023396612 AT5G40405 "AT5G40405" [Arabido 0.995 0.794 0.427 1.4e-110
TAIR|locus:2126352 AT4G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1254 (446.5 bits), Expect = 9.6e-128, P = 9.6e-128
 Identities = 235/489 (48%), Positives = 338/489 (69%)

Query:     2 GREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYV 61
             G+ IH  VLK GL  +      LV++Y K G+   A ++FD MPE   +V+ST MI CY 
Sbjct:   145 GKLIHTHVLKFGLGIDPYVATGLVDVYAKGGDVVSAQKVFDRMPE-RSLVSSTAMITCYA 203

Query:    62 EHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNV-RPNEVTIV 120
             + G VE A  +F  +  +D V W  MIDG  ++G    AL LF+++  +   +P+E+T+V
Sbjct:   204 KQGNVEAARALFDSMCERDIVSWNVMIDGYAQHGFPNDALMLFQKLLAEGKPKPDEITVV 263

Query:   121 CVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKER 180
               LSACSQ+GALE GRWIH ++   RI LN  V   LI+MYS+CG +++A+ VF +   +
Sbjct:   264 AALSACSQIGALETGRWIHVFVKSSRIRLNVKVCTGLIDMYSKCGSLEEAVLVFNDTPRK 323

Query:   181 DVTTYNSLIAGLAMHGRSIEAVEMFREMIN-QGIRPTKVTFVGVLNACSHGGLVDLGFEI 239
             D+  +N++IAG AMHG S +A+ +F EM    G++PT +TF+G L AC+H GLV+ G  I
Sbjct:   324 DIVAWNAMIAGYAMHGYSQDALRLFNEMQGITGLQPTDITFIGTLQACAHAGLVNEGIRI 383

Query:   240 FQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHG 299
             F+SM ++YGI+P+IEHYGC+V LL R G+ + AY+ I NM +  D ++  S+L +CK+HG
Sbjct:   384 FESMGQEYGIKPKIEHYGCLVSLLGRAGQLKRAYETIKNMNMDADSVLWSSVLGSCKLHG 443

Query:   300 KLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSI 359
                LG++IA+ L+     +SG YVLLSN YAS G ++   ++R  MKE G+ KEPG S+I
Sbjct:   444 DFVLGKEIAEYLIGLNIKNSGIYVLLSNIYASVGDYEGVAKVRNLMKEKGIVKEPGISTI 503

Query:   360 EVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAI 419
             E+ N++HEF  GD  H + ++IY  ++++ + +K  GY P+T  VL D+E+ EKE +L +
Sbjct:   504 EIENKVHEFRAGDREHSKSKEIYTMLRKISERIKSHGYVPNTNTVLQDLEETEKEQSLQV 563

Query:   420 HSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFEN 479
             HSERLAI YGLISTKP + +++ KNLRVC+DCH++ KLI+ IT RKI++RDRNRFHHF +
Sbjct:   564 HSERLAIAYGLISTKPGSPLKIFKNLRVCSDCHTVTKLISKITGRKIVMRDRNRFHHFTD 623

Query:   480 GTCSCGDYW 488
             G+CSCGD+W
Sbjct:   624 GSCSCGDFW 632


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009062 "fatty acid catabolic process" evidence=RCA
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081635 AT3G62890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713776 AT3G26782 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023396 AT5G40405 "AT5G40405" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FIF7PP435_ARATHNo assigned EC number0.64370.80320.7205yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_II002404
hypothetical protein (621 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-138
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-128
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-45
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-36
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-35
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-29
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-22
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-21
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 2e-21
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-15
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-13
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-11
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-09
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-06
pfam0153531 pfam01535, PPR, PPR repeat 7e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-05
pfam0153531 pfam01535, PPR, PPR repeat 7e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 9e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-04
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  413 bits (1062), Expect = e-138
 Identities = 180/487 (36%), Positives = 279/487 (57%), Gaps = 32/487 (6%)

Query: 2   GREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCYV 61
           G+++H  VLK G+  +      L+++Y KCG+ +DA  +FD MPE               
Sbjct: 243 GQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPE--------------- 287

Query: 62  EHGLVENAFEVFSRVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVC 121
                            K TV W +M+ G   +G    AL L+ EM+   V  ++ T   
Sbjct: 288 -----------------KTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSI 330

Query: 122 VLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKERD 181
           ++   S+L  LE  +  H+ + +    L+ +   AL+++YS+ G ++ A  VF+ M  ++
Sbjct: 331 MIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKN 390

Query: 182 VTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQ 241
           + ++N+LIAG   HGR  +AVEMF  MI +G+ P  VTF+ VL+AC + GL + G+EIFQ
Sbjct: 391 LISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQ 450

Query: 242 SMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKL 301
           SM+ ++ I+P+  HY C+++LL R G  +EAY  I      P   M  +LL+AC+IH  L
Sbjct: 451 SMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNL 510

Query: 302 QLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKEAGVQKEPGCSSIEV 361
           +LG   A++L          YV+L N Y SSG+  EA ++   +K  G+   P C+ IEV
Sbjct: 511 ELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEV 570

Query: 362 NNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDWEKEWALAIHS 421
             + H F  GD  HPQ  +IY+K+ EL + +   GY      +L D+++ E++ +   HS
Sbjct: 571 KKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHS 630

Query: 422 ERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGT 481
           E+LAI +GLI+T  +T +++ ++ R+C DCH +IK IA +TKR+I+VRD +RFHHF+ G 
Sbjct: 631 EKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGK 690

Query: 482 CSCGDYW 488
           CSCGDYW
Sbjct: 691 CSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 488
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.83
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.81
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.81
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.79
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.71
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.68
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.68
PRK14574 822 hmsH outer membrane protein; Provisional 99.64
KOG2076 895 consensus RNA polymerase III transcription factor 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.55
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.55
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.55
KOG2003840 consensus TPR repeat-containing protein [General f 99.54
KOG1915677 consensus Cell cycle control protein (crooked neck 99.54
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
KOG1126638 consensus DNA-binding cell division cycle control 99.51
KOG1126638 consensus DNA-binding cell division cycle control 99.5
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.49
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.49
KOG2003840 consensus TPR repeat-containing protein [General f 99.48
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.43
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.41
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.4
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.4
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.38
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.37
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.37
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.35
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.35
KOG0547606 consensus Translocase of outer mitochondrial membr 99.35
PRK12370553 invasion protein regulator; Provisional 99.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.34
PF1304150 PPR_2: PPR repeat family 99.34
PF1304150 PPR_2: PPR repeat family 99.31
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.3
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
KOG2076 895 consensus RNA polymerase III transcription factor 99.28
PRK12370553 invasion protein regulator; Provisional 99.27
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.25
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.25
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.2
KOG1129478 consensus TPR repeat-containing protein [General f 99.18
KOG1915677 consensus Cell cycle control protein (crooked neck 99.17
PRK11189296 lipoprotein NlpI; Provisional 99.16
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
KOG0547606 consensus Translocase of outer mitochondrial membr 99.11
PRK11189296 lipoprotein NlpI; Provisional 99.11
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.09
KOG1129478 consensus TPR repeat-containing protein [General f 99.08
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.07
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.04
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.04
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.95
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.95
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.94
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.92
KOG1125579 consensus TPR repeat-containing protein [General f 98.91
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.89
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.85
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.84
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.83
KOG2376652 consensus Signal recognition particle, subunit Srp 98.82
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.8
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.8
PF1285434 PPR_1: PPR repeat 98.75
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.75
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.75
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.75
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.74
PRK04841903 transcriptional regulator MalT; Provisional 98.7
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.67
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.67
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.65
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.64
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.62
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.62
PF1285434 PPR_1: PPR repeat 98.59
PRK04841903 transcriptional regulator MalT; Provisional 98.59
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.58
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.55
KOG1128777 consensus Uncharacterized conserved protein, conta 98.54
PRK10370198 formate-dependent nitrite reductase complex subuni 98.54
KOG1128777 consensus Uncharacterized conserved protein, conta 98.5
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.49
KOG1125579 consensus TPR repeat-containing protein [General f 98.49
PLN02789320 farnesyltranstransferase 98.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.44
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.44
PRK15359144 type III secretion system chaperone protein SscB; 98.41
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.4
PRK10370198 formate-dependent nitrite reductase complex subuni 98.4
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.39
PRK15359144 type III secretion system chaperone protein SscB; 98.37
PLN02789320 farnesyltranstransferase 98.36
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.34
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.34
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.32
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.32
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.3
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.29
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.28
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.28
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.25
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.24
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.22
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.21
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.21
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.19
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.19
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.18
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.16
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.16
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.16
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.09
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.08
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.97
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.89
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.89
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.87
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.8
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.78
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.76
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.75
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.74
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.71
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.68
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.68
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.63
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.58
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.56
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.56
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.55
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.55
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.52
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.51
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.5
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.5
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.48
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.45
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.44
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.43
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.43
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.42
PF12688120 TPR_5: Tetratrico peptide repeat 97.42
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.41
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.38
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.31
KOG0553304 consensus TPR repeat-containing protein [General f 97.27
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.27
PF1337173 TPR_9: Tetratricopeptide repeat 97.23
PRK15331165 chaperone protein SicA; Provisional 97.23
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.23
KOG0553304 consensus TPR repeat-containing protein [General f 97.22
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.22
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.21
COG4700251 Uncharacterized protein conserved in bacteria cont 97.21
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.19
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.18
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.16
KOG20411189 consensus WD40 repeat protein [General function pr 97.14
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.12
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.12
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.11
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.07
COG3898531 Uncharacterized membrane-bound protein [Function u 97.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.05
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.03
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.98
COG4700251 Uncharacterized protein conserved in bacteria cont 96.94
PRK10803263 tol-pal system protein YbgF; Provisional 96.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.83
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.8
PF12688120 TPR_5: Tetratrico peptide repeat 96.8
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.8
PF1343134 TPR_17: Tetratricopeptide repeat 96.75
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.69
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.6
PF1342844 TPR_14: Tetratricopeptide repeat 96.54
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.48
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.47
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.47
PF1337173 TPR_9: Tetratricopeptide repeat 96.44
COG3898531 Uncharacterized membrane-bound protein [Function u 96.36
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.33
PRK10803263 tol-pal system protein YbgF; Provisional 96.29
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.28
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.15
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.13
KOG1585308 consensus Protein required for fusion of vesicles 96.02
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.02
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.0
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 95.99
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.94
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.86
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.81
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.8
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.7
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.67
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.65
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.45
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.44
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.26
KOG3941406 consensus Intermediate in Toll signal transduction 95.16
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.14
smart00299140 CLH Clathrin heavy chain repeat homology. 94.97
PRK15331165 chaperone protein SicA; Provisional 94.9
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.83
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.77
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.76
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.73
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.62
PRK11906458 transcriptional regulator; Provisional 94.56
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 94.48
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.42
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.36
KOG3941406 consensus Intermediate in Toll signal transduction 94.24
PF13512142 TPR_18: Tetratricopeptide repeat 94.23
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.2
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.18
PRK11906458 transcriptional regulator; Provisional 94.11
smart00299140 CLH Clathrin heavy chain repeat homology. 94.0
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.98
COG3629280 DnrI DNA-binding transcriptional activator of the 93.95
KOG4555175 consensus TPR repeat-containing protein [Function 93.88
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.7
PRK11619 644 lytic murein transglycosylase; Provisional 93.69
KOG4555175 consensus TPR repeat-containing protein [Function 93.47
KOG2610491 consensus Uncharacterized conserved protein [Funct 93.26
PF13512142 TPR_18: Tetratricopeptide repeat 93.2
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.87
KOG1585308 consensus Protein required for fusion of vesicles 92.85
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.84
PF1342844 TPR_14: Tetratricopeptide repeat 92.81
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.79
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.66
PRK09687280 putative lyase; Provisional 92.37
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.25
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.18
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.98
KOG1941518 consensus Acetylcholine receptor-associated protei 91.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.94
COG3629280 DnrI DNA-binding transcriptional activator of the 91.93
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.91
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.75
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.63
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.53
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.53
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.52
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.3
COG3947361 Response regulator containing CheY-like receiver a 91.05
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.97
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.3
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.01
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 89.9
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 89.88
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.85
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.53
KOG4234271 consensus TPR repeat-containing protein [General f 89.42
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.26
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 88.8
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.73
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.21
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.02
KOG1586288 consensus Protein required for fusion of vesicles 87.96
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 87.47
KOG1258577 consensus mRNA processing protein [RNA processing 87.3
PF1343134 TPR_17: Tetratricopeptide repeat 87.0
COG1747 711 Uncharacterized N-terminal domain of the transcrip 86.8
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 86.67
COG1747 711 Uncharacterized N-terminal domain of the transcrip 86.59
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.59
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.41
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.34
PRK09687280 putative lyase; Provisional 85.75
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 85.62
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.38
KOG4570418 consensus Uncharacterized conserved protein [Funct 85.37
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.21
COG2976207 Uncharacterized protein conserved in bacteria [Fun 85.2
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.02
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 84.95
KOG4570418 consensus Uncharacterized conserved protein [Funct 84.87
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.68
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 84.54
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.18
PF06552186 TOM20_plant: Plant specific mitochondrial import r 84.06
KOG1258577 consensus mRNA processing protein [RNA processing 83.88
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.81
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.8
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.36
KOG1586288 consensus Protein required for fusion of vesicles 83.17
KOG4648 536 consensus Uncharacterized conserved protein, conta 82.78
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 82.71
PF13929292 mRNA_stabil: mRNA stabilisation 82.65
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.4
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.34
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 82.2
KOG4234271 consensus TPR repeat-containing protein [General f 81.06
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 80.49
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.16
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.08
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1e-109  Score=867.75  Aligned_cols=486  Identities=38%  Similarity=0.671  Sum_probs=471.5

Q ss_pred             HhHHHHHHHHhCCCCchhhHHHHHHHHHhcCChHHHHHHHhhCCCCCceeeHHHHHHHH---------------------
Q 036287            2 GREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPECNDVVASTVMINCY---------------------   60 (488)
Q Consensus         2 ~~~i~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~~~~~~~~~~~li~~~---------------------   60 (488)
                      |+++|..|++.|+.||..++|.|+++|+++|++++|.++|++|++++ .++||++|.+|                     
T Consensus       142 a~~l~~~m~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~~-~~t~n~li~~~~~~g~~~~A~~lf~~M~~~g~  220 (697)
T PLN03081        142 VKAVYWHVESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDEMPERN-LASWGTIIGGLVDAGNYREAFALFREMWEDGS  220 (697)
T ss_pred             HHHHHHHHHHhCCCcchHHHHHHHHHHhcCCCHHHHHHHHhcCCCCC-eeeHHHHHHHHHHCcCHHHHHHHHHHHHHhCC
Confidence            68999999999999999999999999999999999999999999876 77777777666                     


Q ss_pred             -------------------------------------------------HHcCCHHHHHHHHhhcCCCCHHHHHHHHHHH
Q 036287           61 -------------------------------------------------VEHGLVENAFEVFSRVKVKDTVCWTAMIDGL   91 (488)
Q Consensus        61 -------------------------------------------------~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~   91 (488)
                                                                       +++|++++|.++|+.|+++|+++||+||.+|
T Consensus       221 ~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y  300 (697)
T PLN03081        221 DAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGY  300 (697)
T ss_pred             CCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHH
Confidence                                                             5566666666677777778999999999999


Q ss_pred             HHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCchHHHHHHHHHHHHcCCCCcHhHHHHHHHHHHhcCCHHHHH
Q 036287           92 VRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALINMYSRCGDIDKAL  171 (488)
Q Consensus        92 ~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~  171 (488)
                      +++|++++|+++|++|.+.|+.||..||++++.+|++.|++++|.++|..|.+.|++||..++++|+++|+++|++++|.
T Consensus       301 ~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~  380 (697)
T PLN03081        301 ALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDAR  380 (697)
T ss_pred             HhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcccCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCCHHHHHHHHHhcccccCccc
Q 036287          172 QVFEEMKERDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEP  251 (488)
Q Consensus       172 ~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p  251 (488)
                      ++|++|.++|+++||+||.+|+++|+.++|+++|++|.+.|+.||..||+.++.+|++.|++++|.++|+.|.+++|+.|
T Consensus       381 ~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p  460 (697)
T PLN03081        381 NVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKP  460 (697)
T ss_pred             HHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998789999


Q ss_pred             ChhhHHHHHHHHHhcCChHHHHHHHHhCCCCCCHHHHHHHHHHHHHhCChhHHHHHHHHHHhcCCCCchhHHHHHHHHhc
Q 036287          252 QIEHYGCIVDLLSRVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYAS  331 (488)
Q Consensus       252 ~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~  331 (488)
                      +..+|++|+++|++.|++++|.+++++|++.|+..+|++|+.+|..+|+++.|..+++++.+.+|.+..+|..|+++|++
T Consensus       461 ~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~  540 (697)
T PLN03081        461 RAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNS  540 (697)
T ss_pred             CccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHHHhCCCccCCceeEEEECCEEEEEEeCCCCCccHHHHHHHHHHHHHHHHHcCccCCCcccccccchh
Q 036287          332 SGKWKEAVQIRAKMKEAGVQKEPGCSSIEVNNEIHEFILGDIRHPQREQIYKKMQELKQIVKLEGYSPSTEVVLHDIEDW  411 (488)
Q Consensus       332 ~g~~~~a~~~~~~m~~~g~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~m~~~g~~pd~~~~~~~~~~~  411 (488)
                      .|+|++|.+++++|+++|+++.|++||+++++.+|.|++||.+||+.++++++++++..+|++.||.||+..++|+++++
T Consensus       541 ~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~gy~~~~~~~~~~~~~~  620 (697)
T PLN03081        541 SGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDED  620 (697)
T ss_pred             CCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHHHHHHHHHHcCCCCCcchhhccccHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhchHHHHHHHhhcCCCCCCcEEEEccccccCCcchhhHHHhhhcCceEEEecCCcccccccCccCCCCCC
Q 036287          412 EKEWALAIHSERLAICYGLISTKPYTTIRVVKNLRVCNDCHSMIKLIANITKRKIIVRDRNRFHHFENGTCSCGDYW  488 (488)
Q Consensus       412 ~~~~~~~~~~e~la~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~s~~~~~~i~~~d~~~~h~~~~g~csc~~~w  488 (488)
                      +|+..+.+||||||+||||+++|||+||||+||||+|+|||+++|+||++++|+|||||.+|||||+||+|||+|||
T Consensus       621 ~~~~~~~~hsekla~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        621 EEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             HHHHHHHhccHHHHHHhhCccCCCCCeEEEecCCEECCCchhhHHHHhhhcceEEEEecCCccccCCCCcccccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 3e-05
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 41/200 (20%), Positives = 89/200 (44%), Gaps = 18/200 (9%) Query: 158 INMYSRCGDIDKALQVFEEMKERDVTT----YNSLIAGLAMHGRSIEA---------VEM 204 ++M S+ GD+ +AL++++E + V YN L+ ++ + E+ ++ Sbjct: 33 LDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDI 92 Query: 205 FREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLS 264 F++MI + P + TF ++ F++ + M + +GI+P++ YG + Sbjct: 93 FKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQM-KAFGIQPRLRSYGPALFGFC 151 Query: 265 RVGRPEEAYDFITNMKIAPDHIMLGSLLSACKIHGKLQLGEQIAK---RLLD-CRSADSG 320 R G ++AY+ +M + L + K+ + +++ K RL D R Sbjct: 152 RKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKS 211 Query: 321 TYVLLSNAYASSGKWKEAVQ 340 T+ ++ + S K V+ Sbjct: 212 TFDMIEEWFKSEVATKTGVK 231

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 74.9 bits (182), Expect = 3e-14
 Identities = 23/192 (11%), Positives = 55/192 (28%), Gaps = 7/192 (3%)

Query: 100 ALDLFREMQRDNVRPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRIDLNHIVGGALIN 159
           A  L    ++    P E  +  +L       +L++ +       + ++        A   
Sbjct: 76  AGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFK 135

Query: 160 MYSRCGDIDKALQVFEEMKER-------DVTTYNSLIAGLAMHGRSIEAVEMFREMINQG 212
                  +  A  +      +        +  YN+++ G A  G   E V +   + + G
Sbjct: 136 CCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAG 195

Query: 213 IRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEA 272
           + P  +++   L             E         G++ Q      ++    R    +  
Sbjct: 196 LTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAV 255

Query: 273 YDFITNMKIAPD 284
           +       + P 
Sbjct: 256 HKVKPTFSLPPQ 267


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.76
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.75
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.58
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.58
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.58
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.58
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.57
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.55
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.51
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.48
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.43
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.36
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.35
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.26
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.26
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.21
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.17
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.17
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.12
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.11
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.06
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.03
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.0
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.0
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.97
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.97
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.97
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.96
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.91
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.91
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.91
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.86
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.84
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.79
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.78
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.77
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.72
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.71
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.7
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.66
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.65
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.63
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.57
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.55
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.49
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.49
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.49
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.49
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.48
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.47
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.45
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.43
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.39
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.36
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.35
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.35
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.34
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.32
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.29
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.29
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.27
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.25
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.21
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.21
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.2
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.16
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.13
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.11
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.09
3k9i_A117 BH0479 protein; putative protein binding protein, 98.08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.06
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.99
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.92
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.91
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.9
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.87
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.85
3k9i_A117 BH0479 protein; putative protein binding protein, 97.83
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.83
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.78
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.77
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.73
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.73
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.63
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.55
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.5
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.5
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.46
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.42
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.4
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.39
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.32
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.17
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.16
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.1
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.98
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.93
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.91
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.89
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.75
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.49
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.49
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.36
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.22
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.07
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.97
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.85
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 95.75
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.95
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.19
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.92
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.47
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.46
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.19
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.98
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.91
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 91.61
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.43
2uwj_G115 Type III export protein PSCG; virulence, chaperone 89.82
2p58_C116 Putative type III secretion protein YSCG; type III 89.46
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.05
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.98
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 87.84
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 87.22
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 86.7
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.51
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.2
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 85.15
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.13
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.96
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 84.47
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 84.12
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 83.78
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.71
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 82.66
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.17
2p58_C116 Putative type III secretion protein YSCG; type III 80.19
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=6.6e-32  Score=278.50  Aligned_cols=342  Identities=11%  Similarity=0.023  Sum_probs=272.9

Q ss_pred             HhHHHHHHHHhCCCCchhhHHHHHHHHHhcCChHHHHHHHhhCCC-CCceeeHHHHHHHHHHcCCHHHHHHHHhhcCCC-
Q 036287            2 GREIHGQVLKLGLRSNRSTRLKLVELYGKCGEFKDAMQLFDEMPE-CNDVVASTVMINCYVEHGLVENAFEVFSRVKVK-   79 (488)
Q Consensus         2 ~~~i~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~~-~~~~~~~~~li~~~~~~g~~~~A~~~f~~~~~~-   79 (488)
                      |.+++..+++  ..|+..++..++.+|.+.|++++|..+|+.+.. ++++.+|+.++.+|.++|++++|.++|+++.+. 
T Consensus       103 A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  180 (597)
T 2xpi_A          103 AAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFR  180 (597)
T ss_dssp             HHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC
T ss_pred             HHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHHHHhhHHHHHHHHhccCCcc
Confidence            4456666653  345667777777777777777777777777643 234677777777777777777777777754332 


Q ss_pred             ------------------CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCC-----------------------------
Q 036287           80 ------------------DTVCWTAMIDGLVRNGEMARALDLFREMQRDNV-----------------------------  112 (488)
Q Consensus        80 ------------------~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~-----------------------------  112 (488)
                                        +..+|+.++.+|.+.|++++|+++|++|.+.+.                             
T Consensus       181 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~  260 (597)
T 2xpi_A          181 KDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNY  260 (597)
T ss_dssp             ----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCT
T ss_pred             ccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCC
Confidence                              366777777777777777777777777654321                             


Q ss_pred             -----------------------------------------CCCHHHHHHHHHHHHhcCchHHHHHHHHHHHHcCC----
Q 036287          113 -----------------------------------------RPNEVTIVCVLSACSQLGALELGRWIHSYMGKHRI----  147 (488)
Q Consensus       113 -----------------------------------------~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~----  147 (488)
                                                               +++..++..++.++.+.|++++|.++++.+.+.+.    
T Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~  340 (597)
T 2xpi_A          261 STYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLD  340 (597)
T ss_dssp             HHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCT
T ss_pred             cccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHH
Confidence                                                     15666667777777777777777777777765431    


Q ss_pred             -----------------------------CCcHhHHHHHHHHHHhcCCHHHHHHHHHhccc---CCHHHHHHHHHHHHhc
Q 036287          148 -----------------------------DLNHIVGGALINMYSRCGDIDKALQVFEEMKE---RDVTTYNSLIAGLAMH  195 (488)
Q Consensus       148 -----------------------------~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~  195 (488)
                                                   +.+..+++.++.+|.++|++++|.++|+++.+   .+..+|+.++.+|.+.
T Consensus       341 ~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~  420 (597)
T 2xpi_A          341 VYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIE  420 (597)
T ss_dssp             THHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHc
Confidence                                         34577888899999999999999999998764   4678999999999999


Q ss_pred             CChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCCHHHHHHHHHhcccccCcccChhhHHHHHHHHHhcCChHHHHHH
Q 036287          196 GRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIEPQIEHYGCIVDLLSRVGRPEEAYDF  275 (488)
Q Consensus       196 g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~  275 (488)
                      |++++|+++|+++.+.+ +++..++..++.+|.+.|++++|.++|+.+.+.  .+.+..+|+.++.+|.+.|++++|.++
T Consensus       421 g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~  497 (597)
T 2xpi_A          421 GEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINH  497 (597)
T ss_dssp             TCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHH
Confidence            99999999999998863 457888999999999999999999999999853  244688999999999999999999999


Q ss_pred             HHhC-------CCCCC--HHHHHHHHHHHHHhCChhHHHHHHHHHHhcCCCCchhHHHHHHHHhcCCChHHHHHHHHHHH
Q 036287          276 ITNM-------KIAPD--HIMLGSLLSACKIHGKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMK  346 (488)
Q Consensus       276 ~~~m-------~~~p~--~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~  346 (488)
                      |+++       +..|+  ..+|..++.+|...|++++|...++++.+.+|+++.+|..++.+|.+.|++++|.+.++++.
T Consensus       498 ~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l  577 (597)
T 2xpi_A          498 FQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESL  577 (597)
T ss_dssp             HHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             HHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHH
Confidence            9988       45777  78999999999999999999999999999999999999999999999999999999999997


Q ss_pred             hC
Q 036287          347 EA  348 (488)
Q Consensus       347 ~~  348 (488)
                      +.
T Consensus       578 ~~  579 (597)
T 2xpi_A          578 AI  579 (597)
T ss_dssp             HH
T ss_pred             hc
Confidence            74



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 488
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-06
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.2 bits (108), Expect = 5e-06
 Identities = 48/333 (14%), Positives = 101/333 (30%), Gaps = 13/333 (3%)

Query: 17  NRSTRLKLVELYGKCGEFKDAMQLFDEMPECN--DVVASTVMINCYVEHGLVENAFEVFS 74
           N    L L  ++ +C     +        + N     A + + N Y E G ++ A E + 
Sbjct: 32  NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYR 91

Query: 75  RVKVKDTVCWTAMIDGLVRNGEMARALDLFREMQRDNVRPNEVTIVCVLSACSQLGALEL 134
                        I+               +          ++  V             L
Sbjct: 92  HALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRL 151

Query: 135 GRWIHSYMGKHRIDLNH-IVGGALINMYSRCGDIDKALQVFE---EMKERDVTTYNSLIA 190
                 Y+       N  +    L  +++  G+I  A+  FE    +    +  Y +L  
Sbjct: 152 EEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGN 211

Query: 191 GLAMHGRSIEAVEMFREMINQGIRPTKVTFVGVLNACSHGGLVDLGFEIFQSMTRDYGIE 250
            L        AV  +   ++            +       GL+DL  + ++       ++
Sbjct: 212 VLKEARIFDRAVAAYLRALSLSPNHAV-VHGNLACVYYEQGLIDLAIDTYRRAIE---LQ 267

Query: 251 PQI-EHYGCIVDLLSRVGRPEEAYDFITN--MKIAPDHIMLGSLLSACKIHGKLQLGEQI 307
           P   + Y  + + L   G   EA D               L +L +  +  G ++   ++
Sbjct: 268 PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRL 327

Query: 308 AKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQ 340
            ++ L+     +  +  L++     GK +EA+ 
Sbjct: 328 YRKALEVFPEFAAAHSNLASVLQQQGKLQEALM 360


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.25
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.19
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.13
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.12
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.09
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.09
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.02
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.0
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.96
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.59
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.56
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.51
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.41
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.39
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.35
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.34
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.32
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.3
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.24
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.13
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.08
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.06
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.04
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.99
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.98
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.93
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.89
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.79
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.77
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.75
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.73
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.5
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.35
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.34
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.22
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.2
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.02
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.79
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.47
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.95
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.45
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.06
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.14
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.42
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.98
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.56
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.47
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.33
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1.2e-20  Score=180.03  Aligned_cols=318  Identities=14%  Similarity=0.118  Sum_probs=251.9

Q ss_pred             HHHHHHhcCChHHHHHHHhhCCC--CCceeeHHHHHHHHHHcCCHHHHHHHHhhcC---CCCHHHHHHHHHHHHHcCCHH
Q 036287           24 LVELYGKCGEFKDAMQLFDEMPE--CNDVVASTVMINCYVEHGLVENAFEVFSRVK---VKDTVCWTAMIDGLVRNGEMA   98 (488)
Q Consensus        24 li~~y~~~g~~~~A~~~~~~m~~--~~~~~~~~~li~~~~~~g~~~~A~~~f~~~~---~~~~~~~~~li~~~~~~g~~~   98 (488)
                      +...+.+.|++++|.+.|+++.+  |+++.+|..+...|.+.|++++|...|++..   +.+..+|..+...|.+.|+++
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccc
Confidence            45667788888888888888754  4457788888888888888888888888764   335678888888888888888


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHH----------------------------------HHHhcCchHHHHHHHHHHHH
Q 036287           99 RALDLFREMQRDNVRPNEVTIVCVLS----------------------------------ACSQLGALELGRWIHSYMGK  144 (488)
Q Consensus        99 ~A~~~~~~m~~~g~~p~~~t~~~ll~----------------------------------~~~~~~~~~~a~~~~~~~~~  144 (488)
                      +|+..+....... +.+.........                                  .....+....+...+.....
T Consensus        85 ~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (388)
T d1w3ba_          85 EAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIE  163 (388)
T ss_dssp             HHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHH
T ss_pred             ccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhc
Confidence            8888888877653 222222222222                                  22233333444444444444


Q ss_pred             cCCCCcHhHHHHHHHHHHhcCCHHHHHHHHHhccc---CCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHH
Q 036287          145 HRIDLNHIVGGALINMYSRCGDIDKALQVFEEMKE---RDVTTYNSLIAGLAMHGRSIEAVEMFREMINQGIRPTKVTFV  221 (488)
Q Consensus       145 ~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~  221 (488)
                      .. +.+...+..+...+...|++++|...+++..+   .+..+|..+...+...|++++|+..|++....+ +.+...+.
T Consensus       164 ~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~  241 (388)
T d1w3ba_         164 TQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHG  241 (388)
T ss_dssp             HC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             cC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHH
Confidence            33 34566778888999999999999999987654   466789999999999999999999999998863 44566777


Q ss_pred             HHHHHHhccCCHHHHHHHHHhcccccCccc-ChhhHHHHHHHHHhcCChHHHHHHHHhC--CCCCCHHHHHHHHHHHHHh
Q 036287          222 GVLNACSHGGLVDLGFEIFQSMTRDYGIEP-QIEHYGCIVDLLSRVGRPEEAYDFITNM--KIAPDHIMLGSLLSACKIH  298 (488)
Q Consensus       222 ~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p-~~~~~~~li~~~~~~g~~~~A~~~~~~m--~~~p~~~~~~~ll~~~~~~  298 (488)
                      .+..++...|++++|...|+.+.+   +.| +...+..+...|...|++++|.+.++..  ..+.+...+..+...+...
T Consensus       242 ~l~~~~~~~~~~~~A~~~~~~al~---~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~  318 (388)
T d1w3ba_         242 NLACVYYEQGLIDLAIDTYRRAIE---LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQ  318 (388)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHH---TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHH---hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHC
Confidence            788899999999999999999874   244 4678889999999999999999999887  3344678889999999999


Q ss_pred             CChhHHHHHHHHHHhcCCCCchhHHHHHHHHhcCCChHHHHHHHHHHHh
Q 036287          299 GKLQLGEQIAKRLLDCRSADSGTYVLLSNAYASSGKWKEAVQIRAKMKE  347 (488)
Q Consensus       299 g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~  347 (488)
                      |++++|...++++++..|.++.++..++.+|...|++++|.+.+++..+
T Consensus       319 ~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         319 GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             TCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999998865



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure