Citrus Sinensis ID: 036531

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWNNNSTSSSPPAPTPSIMVPNFNEFYSEDANANVNANVSSILDADHPLHQMDITLPNNRPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENSESGSTLFAEFFAFPQYSTSSSRSESEAIMSNETQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN
cccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccc
ccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcc
MALEAVVYQQDflsyngskdinnllgcpfddhhflenqtesfldgdywnnnstsssppaptpsimvpnfnefysedanaNVNANVSsildadhplhqmditlpnnrpkrrraksRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSlmpdsyvqrgdqasiIGGAINFVKELEQRLQSLGARKeikensesgsTLFAEffafpqystsssrsesEAIMSNETQNSIADIEVNMVESHANlkirskrrPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVkveddcnltsgdDIATAVYQLLGRiqedasln
MALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWNNNSTSSSPPAPTPSIMVPNFNEFYSEDANANVNANVSSILDADHPlhqmditlpnnrpkrrraksrknqeeienqrmthiavernrRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENSESGSTLFAEFFAFPQYSTSSSRSESEAIMSNETQNSIADIEVNMVESHAnlkirskrrpkQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN
MALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWnnnstsssppaptpsIMVPNFNEFYSEDananvnanvSSILDADHPLHQMDITLPNNRPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENSESGSTLFAEFFAFPQYstsssrseseAIMSNETQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN
****AVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYW***********************FY********************************************************************YLSVLRSLMPDSYVQRGDQASIIGGAINFVKELE*********************LFAEFFAF***********************************************QLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRI*******
MALEAVVYQQDFLSYN************************************************************************************************************************K*MNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELE*****************************************************ADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQED****
MALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWNNN********PTPSIMVPNFNEFYSEDANANVNANVSSILDADHPLHQMDITLPNNR*************EIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENSESGSTLFAEFFAFPQ**************SNETQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN
*ALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWNNNSTSS*********************************************************************RMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKE**************************************QNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDA***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWNNNSTSSSPPAPTPSIMVPNFNEFYSEDANANVNANVSSILDADHPLHQMDITLPNNRPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFxxxxxxxxxxxxxxxxxxxxxESGSTLFAEFFAFPQYSTSSSRSESEAIMSNETQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
Q9C7T4320 Transcription factor bHLH yes no 0.930 0.921 0.479 1e-66
Q9SK91304 Transcription factor bHLH no no 0.902 0.940 0.454 2e-59
Q56YJ8414 Transcription factor FAMA no no 0.684 0.524 0.427 7e-46
Q9FKQ6296 Transcription factor bHLH no no 0.602 0.645 0.472 4e-44
Q9M128315 Transcription factor bHLH no no 0.615 0.619 0.467 6e-44
O81037371 Transcription factor bHLH no no 0.580 0.495 0.481 3e-42
Q56XR0327 Transcription factor bHLH no no 0.611 0.593 0.458 1e-41
Q700E4358 Transcription factor bHLH no no 0.583 0.516 0.455 2e-39
Q9M8K6202 Transcription factor MUTE no no 0.520 0.816 0.380 2e-27
Q700C7364 Transcription factor SPEE no no 0.214 0.186 0.652 3e-20
>sp|Q9C7T4|BH096_ARATH Transcription factor bHLH96 OS=Arabidopsis thaliana GN=BHLH96 PE=2 SV=1 Back     alignment and function desciption
 Score =  253 bits (647), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 164/342 (47%), Positives = 206/342 (60%), Gaps = 47/342 (13%)

Query: 1   MALEAVVYQQDFLSYNGSKDINNLLGCPFDDHHFLENQTESFLDGDYWNNNSTSSSPPAP 60
           MALEAVVY QD  SY   KD       PF D +F E +     D D  +  +        
Sbjct: 1   MALEAVVYPQDPFSYISCKDF------PFYDLYFQEEE-----DQDPQDTKNNIKLGQGQ 49

Query: 61  TPSIMVPNFNEF---YSEDANANV-------NANVSSILDADHPLHQMDITLPNNRPKRR 110
                  N+N     YS+D N N        +    S +D +      D+     R KRR
Sbjct: 50  GHGFASNNYNGRTGDYSDDYNYNEEDLQWPRDLPYGSAVDTESQPPPSDVAAGGGRRKRR 109

Query: 111 RAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINF 170
           R +S KN+EEIENQRMTHIAVERNRRKQMNEYL+VLRSLMP  Y QRGDQASI+GGAIN+
Sbjct: 110 RTRSSKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPYYAQRGDQASIVGGAINY 169

Query: 171 VKELEQRLQSL------------GARKEIKENSESGSTLFAEFFAFPQYS---TSSSRSE 215
           +KELE  LQS+                + K  S S S  F++FFAFPQYS   TS++ +E
Sbjct: 170 LKELEHHLQSMEPPVKTATEDTGAGHDQTKTTSASSSGPFSDFFAFPQYSNRPTSAAAAE 229

Query: 216 SEAIMSNETQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMRLTILHFNVTTA 275
                       +A+IEV MVESHA+LKI +K+RP+QLLKLVS +QS+RLT+LH NVTT 
Sbjct: 230 -----------GMAEIEVTMVESHASLKILAKKRPRQLLKLVSSIQSLRLTLLHLNVTTR 278

Query: 276 DEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN 317
           D+ VLYS+SVKVE+   L + +DIA AV Q+L RI+E++S +
Sbjct: 279 DDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRIEEESSFS 320

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SK91|BH094_ARATH Transcription factor bHLH94 OS=Arabidopsis thaliana GN=BHLH94 PE=2 SV=2 Back     alignment and function description
>sp|Q56YJ8|FAMA_ARATH Transcription factor FAMA OS=Arabidopsis thaliana GN=FMA PE=1 SV=1 Back     alignment and function description
>sp|Q9FKQ6|BH099_ARATH Transcription factor bHLH99 OS=Arabidopsis thaliana GN=BHLH99 PE=2 SV=1 Back     alignment and function description
>sp|Q9M128|BH057_ARATH Transcription factor bHLH57 OS=Arabidopsis thaliana GN=BHLH57 PE=2 SV=1 Back     alignment and function description
>sp|O81037|BH070_ARATH Transcription factor bHLH70 OS=Arabidopsis thaliana GN=BHLH70 PE=2 SV=1 Back     alignment and function description
>sp|Q56XR0|BH071_ARATH Transcription factor bHLH71 OS=Arabidopsis thaliana GN=BHLH71 PE=1 SV=1 Back     alignment and function description
>sp|Q700E4|BH067_ARATH Transcription factor bHLH67 OS=Arabidopsis thaliana GN=BHLH67 PE=2 SV=1 Back     alignment and function description
>sp|Q9M8K6|MUTE_ARATH Transcription factor MUTE OS=Arabidopsis thaliana GN=MUTE PE=2 SV=1 Back     alignment and function description
>sp|Q700C7|SPCH_ARATH Transcription factor SPEECHLESS OS=Arabidopsis thaliana GN=SPCH PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
429326540343 helix-loop-helix protein [Populus toment 0.965 0.892 0.589 2e-94
255542558366 DNA binding protein, putative [Ricinus c 0.968 0.838 0.576 3e-93
359487778323 PREDICTED: transcription factor bHLH96-l 0.940 0.922 0.608 3e-93
356573022322 PREDICTED: transcription factor bHLH96-l 0.924 0.909 0.593 1e-90
356505880318 PREDICTED: transcription factor bHLH96-l 0.902 0.899 0.589 7e-89
356576765328 PREDICTED: transcription factor bHLH96-l 0.933 0.902 0.555 7e-88
363808030319 uncharacterized protein LOC100811408 [Gl 0.917 0.912 0.559 4e-86
302398611320 BHLH domain class transcription factor [ 0.936 0.928 0.553 4e-85
357441581324 Transcription factor bHLH94 [Medicago tr 0.943 0.922 0.573 4e-81
223702444306 putative basic helix-loop-helix protein 0.899 0.931 0.571 2e-80
>gi|429326540|gb|AFZ78610.1| helix-loop-helix protein [Populus tomentosa] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 208/353 (58%), Positives = 253/353 (71%), Gaps = 47/353 (13%)

Query: 1   MALEAVVYQQDFLSYNGSKDINNLLGCPFD----------------DHHFLENQTESFLD 44
           MALEA V+QQD+  ++ SK++ N  G  +                   +FLENQTE+FL 
Sbjct: 1   MALEAAVFQQDWFGHS-SKELYNFPGGNWSYDFGLDQNEEDQDKSCSSYFLENQTETFLH 59

Query: 45  GDYWNNNSTSSSPPAPTPSIMVPNFNEFYSEDAN------ANVNAN---VSSILDADHPL 95
           GD WN        P P P  MVP F++     +N      A++NA    +S+   +DH  
Sbjct: 60  GD-WN--------PLPPPDSMVPPFSDLQLTCSNIPSLSEASINAANGLMSTTPTSDHHH 110

Query: 96  HQMDIT-LPNNRPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSY 154
           H  + + +P  R KRRR++S+KN+EEIENQRMTHIAVERNRRKQMNEYLSVLR+LMP+SY
Sbjct: 111 HLGESSAMPATRVKRRRSRSKKNKEEIENQRMTHIAVERNRRKQMNEYLSVLRALMPESY 170

Query: 155 VQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENSES------GSTLFAEFFAFPQYS 208
           VQRGDQASIIGGAINFVKELEQ++Q LGA K++KENS+        S  F+EFF FPQYS
Sbjct: 171 VQRGDQASIIGGAINFVKELEQKMQVLGACKKMKENSDGDNQQHVSSLPFSEFFTFPQYS 230

Query: 209 TSSSRSESEAIMSNE----TQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMR 264
           TSS   E+ ++  NE    TQ++IADIEV MVESHANLKIRSKRRPKQLLK+VSGL SMR
Sbjct: 231 TSSIHFEN-SVGKNEKLHKTQSTIADIEVTMVESHANLKIRSKRRPKQLLKVVSGLHSMR 289

Query: 265 LTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN 317
           LT+LH NVTT D+IVLYSLSVKVEDDC L+S D+IATAVYQ+LGRIQE++ LN
Sbjct: 290 LTVLHLNVTTVDQIVLYSLSVKVEDDCKLSSVDEIATAVYQMLGRIQEESMLN 342

Source: Populus tomentosa

Species: Populus tomentosa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255542558|ref|XP_002512342.1| DNA binding protein, putative [Ricinus communis] gi|223548303|gb|EEF49794.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359487778|ref|XP_002281083.2| PREDICTED: transcription factor bHLH96-like [Vitis vinifera] gi|296088296|emb|CBI36741.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356573022|ref|XP_003554664.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
>gi|356505880|ref|XP_003521717.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
>gi|356576765|ref|XP_003556500.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
>gi|363808030|ref|NP_001242465.1| uncharacterized protein LOC100811408 [Glycine max] gi|255634957|gb|ACU17837.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|302398611|gb|ADL36600.1| BHLH domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|357441581|ref|XP_003591068.1| Transcription factor bHLH94 [Medicago truncatula] gi|355480116|gb|AES61319.1| Transcription factor bHLH94 [Medicago truncatula] Back     alignment and taxonomy information
>gi|223702444|gb|ACN21653.1| putative basic helix-loop-helix protein BHLH26 [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
UNIPROTKB|Q6YTU1363 P0419H09.4 "cDNA clone:002-131 0.391 0.341 0.604 2.4e-64
UNIPROTKB|Q6K4B1351 OJ1595_D08.4 "Os09g0468700 pro 0.328 0.296 0.694 3.3e-63
TAIR|locus:2207061320 AT1G72210 "AT1G72210" [Arabido 0.955 0.946 0.470 1.4e-62
TAIR|locus:2009537304 AT1G22490 "AT1G22490" [Arabido 0.646 0.674 0.573 3.3e-61
UNIPROTKB|Q6ZGS3373 OJ1148_D05.9 "Putative basic-h 0.261 0.222 0.759 8.8e-57
UNIPROTKB|Q7XLY9362 OSJNBa0086O06.20 "OSJNBa0086O0 0.261 0.229 0.759 1.3e-54
TAIR|locus:2168235296 AT5G65320 "AT5G65320" [Arabido 0.646 0.692 0.450 1.3e-45
TAIR|locus:2116977315 AT4G01460 "AT4G01460" [Arabido 0.662 0.666 0.432 8.1e-44
TAIR|locus:2044387371 AT2G46810 "AT2G46810" [Arabido 0.624 0.533 0.473 3.5e-43
TAIR|locus:2093746414 FMA "AT3G24140" [Arabidopsis t 0.687 0.526 0.421 6.6e-42
UNIPROTKB|Q6YTU1 P0419H09.4 "cDNA clone:002-131-D10, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 2.4e-64, Sum P(3) = 2.4e-64
 Identities = 78/129 (60%), Positives = 95/129 (73%)

Query:   106 RPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIG 165
             R KRRRA++ KN+EE+E+QRMTHIAVERNRRKQMNEYL+VLRSLMP SYVQRGDQASIIG
Sbjct:   120 RRKRRRARTVKNREEVESQRMTHIAVERNRRKQMNEYLAVLRSLMPASYVQRGDQASIIG 179

Query:   166 GAINFVKELEQRLQSLGARKEIKE-NSESGSTL-FAEFFAFPQYXXXX---XXXXXXAIM 220
             GAIN+VKE+EQ LQSL A +  +   +++ + L FA FF FPQY             A  
Sbjct:   180 GAINYVKEMEQLLQSLEAHRHARRARTDAAAALPFAGFFTFPQYSMSAVPTTTTTTVAAA 239

Query:   221 SNETQNSIA 229
             + E  N++A
Sbjct:   240 ATENGNAVA 248
GO:0005634 "nucleus" evidence=IC
UNIPROTKB|Q6K4B1 OJ1595_D08.4 "Os09g0468700 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2207061 AT1G72210 "AT1G72210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009537 AT1G22490 "AT1G22490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZGS3 OJ1148_D05.9 "Putative basic-helix-loop-helix transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XLY9 OSJNBa0086O06.20 "OSJNBa0086O06.20 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2168235 AT5G65320 "AT5G65320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116977 AT4G01460 "AT4G01460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044387 AT2G46810 "AT2G46810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093746 FMA "AT3G24140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C7T4BH096_ARATHNo assigned EC number0.47950.93050.9218yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022870001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (323 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 5e-12
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 2e-11
smart0035353 smart00353, HLH, helix loop helix domain 4e-08
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information 
 Score = 59.4 bits (145), Expect = 5e-12
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 124 QRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELE 175
           +R  H   ER RR ++N+    LR L+P    ++  +A I+  AI ++K L+
Sbjct: 1   RRKAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52

Length = 52
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.44
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.39
smart0035353 HLH helix loop helix domain. 99.33
KOG1318411 consensus Helix loop helix transcription factor EB 99.07
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.75
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.6
KOG3960284 consensus Myogenic helix-loop-helix transcription 98.51
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.39
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.36
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.28
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.24
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.23
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.22
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.17
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 98.12
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.05
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.9
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.82
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.77
KOG4029228 consensus Transcription factor HAND2/Transcription 97.61
PLN0321793 transcription factor ATBS1; Provisional 97.53
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.53
KOG0561 373 consensus bHLH transcription factor [Transcription 97.51
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.27
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.19
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.18
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.18
PRK05007884 PII uridylyl-transferase; Provisional 97.13
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.11
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.03
KOG4447173 consensus Transcription factor TWIST [Transcriptio 96.95
PRK05092931 PII uridylyl-transferase; Provisional 96.93
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.9
PRK0019490 hypothetical protein; Validated 96.9
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.89
PRK04374869 PII uridylyl-transferase; Provisional 96.88
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.83
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.8
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.74
PRK03381774 PII uridylyl-transferase; Provisional 96.6
PRK03059856 PII uridylyl-transferase; Provisional 96.54
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.54
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.49
PRK03381774 PII uridylyl-transferase; Provisional 96.45
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.41
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.15
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.11
PRK05007 884 PII uridylyl-transferase; Provisional 96.09
PRK00275 895 glnD PII uridylyl-transferase; Provisional 96.0
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.95
PRK05092 931 PII uridylyl-transferase; Provisional 95.93
PRK03059856 PII uridylyl-transferase; Provisional 95.89
KOG3910632 consensus Helix loop helix transcription factor [T 95.68
PRK04374869 PII uridylyl-transferase; Provisional 95.56
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 95.44
PRK04435147 hypothetical protein; Provisional 95.43
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.35
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 95.08
cd0211660 ACT ACT domains are commonly involved in specifica 95.04
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 94.99
PRK08577136 hypothetical protein; Provisional 94.68
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 94.48
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.4
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 94.35
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 94.33
PRK07334403 threonine dehydratase; Provisional 94.25
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 94.08
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 94.05
KOG3898254 consensus Transcription factor NeuroD and related 94.01
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 93.67
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 93.59
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 93.34
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 93.25
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 93.13
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 92.95
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 92.9
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 92.7
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.61
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 92.58
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 92.05
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 92.03
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 91.96
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 91.94
PRK11589190 gcvR glycine cleavage system transcriptional repre 91.87
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 90.67
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 90.66
CHL00100174 ilvH acetohydroxyacid synthase small subunit 90.41
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 90.4
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 89.92
PRK11589 190 gcvR glycine cleavage system transcriptional repre 89.64
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 89.38
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 89.28
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 89.11
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 89.04
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 89.0
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 88.83
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 88.45
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 87.12
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 86.88
COG383090 ACT domain-containing protein [Signal transduction 86.88
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 86.82
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 86.28
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 86.03
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 84.1
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 84.01
PRK08198404 threonine dehydratase; Provisional 83.92
KOG4395285 consensus Transcription factor Atonal, contains HT 83.82
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 83.41
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 82.06
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 81.52
PRK06382406 threonine dehydratase; Provisional 81.23
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona 80.89
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information 
Probab=99.44  E-value=1.8e-13  Score=98.79  Aligned_cols=52  Identities=35%  Similarity=0.610  Sum_probs=48.3

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHccCCCC---cCCCCCccchHHHHHHHHHHHH
Q 036531          124 QRMTHIAVERNRRKQMNEYLSVLRSLMPDS---YVQRGDQASIIGGAINFVKELE  175 (317)
Q Consensus       124 ~~~~h~~~ER~RR~~mn~~~~~LrslvP~~---~~~k~dKasiL~~ai~YIk~Lq  175 (317)
                      +|..|+..||+||++||+.|..|+.+||..   ...|.+|++||..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            478899999999999999999999999994   4578999999999999999997

; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 3e-10
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 7e-10
1hlo_A80 Protein (transcription factor MAX); transcriptiona 4e-09
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 1e-08
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 1e-07
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 4e-06
1a0a_A63 BHLH, protein (phosphate system positive regulator 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
 Score = 55.1 bits (133), Expect = 3e-10
 Identities = 13/64 (20%), Positives = 31/64 (48%)

Query: 123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLG 182
           ++R  H A+ER RR  + +    LR  +P    ++  +A I+  A  +++ + ++  +  
Sbjct: 1   DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60

Query: 183 ARKE 186
              +
Sbjct: 61  QDID 64
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.66
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.62
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.61
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.58
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.57
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.51
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.5
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.48
4ati_A118 MITF, microphthalmia-associated transcription fact 99.47
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.46
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.42
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.34
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.23
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.9
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.75
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.69
4ath_A83 MITF, microphthalmia-associated transcription fact 98.44
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.21
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.53
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.84
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 96.46
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.24
2nyi_A 195 Unknown protein; protein structure initiative, PSI 96.24
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.88
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 93.55
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 93.42
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 93.16
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 92.8
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 92.46
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 92.01
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 91.6
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 90.57
2pc6_A165 Probable acetolactate synthase isozyme III (small; 90.47
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 89.34
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 89.28
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.66  E-value=1.5e-16  Score=123.57  Aligned_cols=68  Identities=19%  Similarity=0.351  Sum_probs=62.9

Q ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHHccCCCCcCCCCCccchHHHHHHHHHHHHHHHHHHHHhHHhhhhc
Q 036531          123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENS  191 (317)
Q Consensus       123 ~~~~~h~~~ER~RR~~mn~~~~~LrslvP~~~~~k~dKasiL~~ai~YIk~Lq~~v~~L~~~~~~~~~~  191 (317)
                      .++.+|+.+||+||.+||+.|..|++|||.. ..|++|++||.+||+||++||.+++.|+.+...++..
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~-~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~   72 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA   72 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhccCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4589999999999999999999999999983 4899999999999999999999999999999887654
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 6e-14
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 3e-13
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 4e-13
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 4e-12
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 8e-12
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 3e-11
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 5e-10
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-08
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Max protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.1 bits (156), Expect = 6e-14
 Identities = 13/64 (20%), Positives = 31/64 (48%)

Query: 123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLG 182
           ++R  H A+ER RR  + +    LR  +P    ++  +A I+  A  +++ + ++  +  
Sbjct: 1   DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60

Query: 183 ARKE 186
              +
Sbjct: 61  QDID 64
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.57
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.53
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.53
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.43
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.61
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.47
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.16
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.07
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 94.12
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 92.91
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 91.13
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 90.71
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 88.86
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 88.09
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 87.2
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 84.89
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 81.78
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.61  E-value=4.8e-16  Score=118.16  Aligned_cols=67  Identities=19%  Similarity=0.351  Sum_probs=61.9

Q ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHHccCCCCcCCCCCccchHHHHHHHHHHHHHHHHHHHHhHHhhhh
Q 036531          123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKEN  190 (317)
Q Consensus       123 ~~~~~h~~~ER~RR~~mn~~~~~LrslvP~~~~~k~dKasiL~~ai~YIk~Lq~~v~~L~~~~~~~~~  190 (317)
                      .+|..|+.+||+||++||+.|..|++|||.. ..|++|++||..||+||++|+++++.|+.+...++.
T Consensus         5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~-~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~   71 (80)
T d1am9a_           5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT   71 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4588999999999999999999999999984 579999999999999999999999999998887754
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure