Citrus Sinensis ID: 036531
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 317 | ||||||
| 429326540 | 343 | helix-loop-helix protein [Populus toment | 0.965 | 0.892 | 0.589 | 2e-94 | |
| 255542558 | 366 | DNA binding protein, putative [Ricinus c | 0.968 | 0.838 | 0.576 | 3e-93 | |
| 359487778 | 323 | PREDICTED: transcription factor bHLH96-l | 0.940 | 0.922 | 0.608 | 3e-93 | |
| 356573022 | 322 | PREDICTED: transcription factor bHLH96-l | 0.924 | 0.909 | 0.593 | 1e-90 | |
| 356505880 | 318 | PREDICTED: transcription factor bHLH96-l | 0.902 | 0.899 | 0.589 | 7e-89 | |
| 356576765 | 328 | PREDICTED: transcription factor bHLH96-l | 0.933 | 0.902 | 0.555 | 7e-88 | |
| 363808030 | 319 | uncharacterized protein LOC100811408 [Gl | 0.917 | 0.912 | 0.559 | 4e-86 | |
| 302398611 | 320 | BHLH domain class transcription factor [ | 0.936 | 0.928 | 0.553 | 4e-85 | |
| 357441581 | 324 | Transcription factor bHLH94 [Medicago tr | 0.943 | 0.922 | 0.573 | 4e-81 | |
| 223702444 | 306 | putative basic helix-loop-helix protein | 0.899 | 0.931 | 0.571 | 2e-80 |
| >gi|429326540|gb|AFZ78610.1| helix-loop-helix protein [Populus tomentosa] | Back alignment and taxonomy information |
|---|
Score = 352 bits (902), Expect = 2e-94, Method: Compositional matrix adjust.
Identities = 208/353 (58%), Positives = 253/353 (71%), Gaps = 47/353 (13%)
Query: 1 MALEAVVYQQDFLSYNGSKDINNLLGCPFD----------------DHHFLENQTESFLD 44
MALEA V+QQD+ ++ SK++ N G + +FLENQTE+FL
Sbjct: 1 MALEAAVFQQDWFGHS-SKELYNFPGGNWSYDFGLDQNEEDQDKSCSSYFLENQTETFLH 59
Query: 45 GDYWNNNSTSSSPPAPTPSIMVPNFNEFYSEDAN------ANVNAN---VSSILDADHPL 95
GD WN P P P MVP F++ +N A++NA +S+ +DH
Sbjct: 60 GD-WN--------PLPPPDSMVPPFSDLQLTCSNIPSLSEASINAANGLMSTTPTSDHHH 110
Query: 96 HQMDIT-LPNNRPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSY 154
H + + +P R KRRR++S+KN+EEIENQRMTHIAVERNRRKQMNEYLSVLR+LMP+SY
Sbjct: 111 HLGESSAMPATRVKRRRSRSKKNKEEIENQRMTHIAVERNRRKQMNEYLSVLRALMPESY 170
Query: 155 VQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENSES------GSTLFAEFFAFPQYS 208
VQRGDQASIIGGAINFVKELEQ++Q LGA K++KENS+ S F+EFF FPQYS
Sbjct: 171 VQRGDQASIIGGAINFVKELEQKMQVLGACKKMKENSDGDNQQHVSSLPFSEFFTFPQYS 230
Query: 209 TSSSRSESEAIMSNE----TQNSIADIEVNMVESHANLKIRSKRRPKQLLKLVSGLQSMR 264
TSS E+ ++ NE TQ++IADIEV MVESHANLKIRSKRRPKQLLK+VSGL SMR
Sbjct: 231 TSSIHFEN-SVGKNEKLHKTQSTIADIEVTMVESHANLKIRSKRRPKQLLKVVSGLHSMR 289
Query: 265 LTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLLGRIQEDASLN 317
LT+LH NVTT D+IVLYSLSVKVEDDC L+S D+IATAVYQ+LGRIQE++ LN
Sbjct: 290 LTVLHLNVTTVDQIVLYSLSVKVEDDCKLSSVDEIATAVYQMLGRIQEESMLN 342
|
Source: Populus tomentosa Species: Populus tomentosa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255542558|ref|XP_002512342.1| DNA binding protein, putative [Ricinus communis] gi|223548303|gb|EEF49794.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359487778|ref|XP_002281083.2| PREDICTED: transcription factor bHLH96-like [Vitis vinifera] gi|296088296|emb|CBI36741.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356573022|ref|XP_003554664.1| PREDICTED: transcription factor bHLH96-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505880|ref|XP_003521717.1| PREDICTED: transcription factor bHLH96-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356576765|ref|XP_003556500.1| PREDICTED: transcription factor bHLH96-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363808030|ref|NP_001242465.1| uncharacterized protein LOC100811408 [Glycine max] gi|255634957|gb|ACU17837.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302398611|gb|ADL36600.1| BHLH domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|357441581|ref|XP_003591068.1| Transcription factor bHLH94 [Medicago truncatula] gi|355480116|gb|AES61319.1| Transcription factor bHLH94 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|223702444|gb|ACN21653.1| putative basic helix-loop-helix protein BHLH26 [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 317 | ||||||
| UNIPROTKB|Q6YTU1 | 363 | P0419H09.4 "cDNA clone:002-131 | 0.391 | 0.341 | 0.604 | 2.4e-64 | |
| UNIPROTKB|Q6K4B1 | 351 | OJ1595_D08.4 "Os09g0468700 pro | 0.328 | 0.296 | 0.694 | 3.3e-63 | |
| TAIR|locus:2207061 | 320 | AT1G72210 "AT1G72210" [Arabido | 0.955 | 0.946 | 0.470 | 1.4e-62 | |
| TAIR|locus:2009537 | 304 | AT1G22490 "AT1G22490" [Arabido | 0.646 | 0.674 | 0.573 | 3.3e-61 | |
| UNIPROTKB|Q6ZGS3 | 373 | OJ1148_D05.9 "Putative basic-h | 0.261 | 0.222 | 0.759 | 8.8e-57 | |
| UNIPROTKB|Q7XLY9 | 362 | OSJNBa0086O06.20 "OSJNBa0086O0 | 0.261 | 0.229 | 0.759 | 1.3e-54 | |
| TAIR|locus:2168235 | 296 | AT5G65320 "AT5G65320" [Arabido | 0.646 | 0.692 | 0.450 | 1.3e-45 | |
| TAIR|locus:2116977 | 315 | AT4G01460 "AT4G01460" [Arabido | 0.662 | 0.666 | 0.432 | 8.1e-44 | |
| TAIR|locus:2044387 | 371 | AT2G46810 "AT2G46810" [Arabido | 0.624 | 0.533 | 0.473 | 3.5e-43 | |
| TAIR|locus:2093746 | 414 | FMA "AT3G24140" [Arabidopsis t | 0.687 | 0.526 | 0.421 | 6.6e-42 |
| UNIPROTKB|Q6YTU1 P0419H09.4 "cDNA clone:002-131-D10, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 367 (134.2 bits), Expect = 2.4e-64, Sum P(3) = 2.4e-64
Identities = 78/129 (60%), Positives = 95/129 (73%)
Query: 106 RPKRRRAKSRKNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIG 165
R KRRRA++ KN+EE+E+QRMTHIAVERNRRKQMNEYL+VLRSLMP SYVQRGDQASIIG
Sbjct: 120 RRKRRRARTVKNREEVESQRMTHIAVERNRRKQMNEYLAVLRSLMPASYVQRGDQASIIG 179
Query: 166 GAINFVKELEQRLQSLGARKEIKE-NSESGSTL-FAEFFAFPQYXXXX---XXXXXXAIM 220
GAIN+VKE+EQ LQSL A + + +++ + L FA FF FPQY A
Sbjct: 180 GAINYVKEMEQLLQSLEAHRHARRARTDAAAALPFAGFFTFPQYSMSAVPTTTTTTVAAA 239
Query: 221 SNETQNSIA 229
+ E N++A
Sbjct: 240 ATENGNAVA 248
|
|
| UNIPROTKB|Q6K4B1 OJ1595_D08.4 "Os09g0468700 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207061 AT1G72210 "AT1G72210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009537 AT1G22490 "AT1G22490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZGS3 OJ1148_D05.9 "Putative basic-helix-loop-helix transcription factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XLY9 OSJNBa0086O06.20 "OSJNBa0086O06.20 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168235 AT5G65320 "AT5G65320" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116977 AT4G01460 "AT4G01460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044387 AT2G46810 "AT2G46810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093746 FMA "AT3G24140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00022870001 | SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (323 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 317 | |||
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 5e-12 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 2e-11 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 4e-08 |
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Score = 59.4 bits (145), Expect = 5e-12
Identities = 17/52 (32%), Positives = 29/52 (55%)
Query: 124 QRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELE 175
+R H ER RR ++N+ LR L+P ++ +A I+ AI ++K L+
Sbjct: 1 RRKAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52
|
Length = 52 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 317 | |||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.44 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.39 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.33 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 99.07 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.75 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 98.6 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 98.51 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 98.39 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 98.36 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 98.28 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 98.24 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 98.23 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 98.22 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 98.17 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 98.12 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 98.05 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.9 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.82 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.77 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 97.61 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 97.53 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 97.53 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 97.51 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.27 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 97.19 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 97.18 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 97.18 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 97.13 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.11 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.03 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 96.95 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 96.93 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 96.9 | |
| PRK00194 | 90 | hypothetical protein; Validated | 96.9 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 96.89 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 96.88 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 96.83 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 96.8 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 96.74 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.6 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 96.54 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.54 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 96.49 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.45 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.41 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 96.15 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.11 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 96.09 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 96.0 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 95.95 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.93 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 95.89 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 95.68 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 95.56 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 95.44 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 95.43 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 95.35 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 95.08 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 95.04 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 94.99 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 94.68 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 94.48 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 94.4 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 94.35 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 94.33 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 94.25 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 94.08 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 94.05 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 94.01 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 93.67 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 93.59 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 93.34 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 93.25 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 93.13 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 92.95 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 92.9 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 92.7 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 92.61 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 92.58 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 92.05 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 92.03 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 91.96 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 91.94 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 91.87 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 90.67 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 90.66 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 90.41 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 90.4 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 89.92 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 89.64 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 89.38 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 89.28 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 89.11 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 89.04 | |
| PF05088 | 1528 | Bac_GDH: Bacterial NAD-glutamate dehydrogenase | 89.0 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 88.83 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 88.45 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 87.12 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 86.88 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 86.88 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 86.82 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 86.28 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 86.03 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 84.1 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 84.01 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 83.92 | |
| KOG4395 | 285 | consensus Transcription factor Atonal, contains HT | 83.82 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 83.41 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 82.06 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 81.52 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 81.23 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 80.89 |
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
Probab=99.44 E-value=1.8e-13 Score=98.79 Aligned_cols=52 Identities=35% Similarity=0.610 Sum_probs=48.3
Q ss_pred hhhhhhHHHHHHHHHHHHHHHHHHccCCCC---cCCCCCccchHHHHHHHHHHHH
Q 036531 124 QRMTHIAVERNRRKQMNEYLSVLRSLMPDS---YVQRGDQASIIGGAINFVKELE 175 (317)
Q Consensus 124 ~~~~h~~~ER~RR~~mn~~~~~LrslvP~~---~~~k~dKasiL~~ai~YIk~Lq 175 (317)
+|..|+..||+||++||+.|..|+.+||.. ...|.+|++||..||+||++||
T Consensus 1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq 55 (55)
T PF00010_consen 1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ 55 (55)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence 478899999999999999999999999994 4578999999999999999997
|
; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B .... |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 317 | |||
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 3e-10 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 7e-10 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 4e-09 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 1e-08 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 1e-07 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 4e-06 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 |
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
Score = 55.1 bits (133), Expect = 3e-10
Identities = 13/64 (20%), Positives = 31/64 (48%)
Query: 123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLG 182
++R H A+ER RR + + LR +P ++ +A I+ A +++ + ++ +
Sbjct: 1 DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60
Query: 183 ARKE 186
+
Sbjct: 61 QDID 64
|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 317 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.66 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.62 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.61 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.58 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.57 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.51 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.5 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.48 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.47 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.46 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.42 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.34 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.23 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 98.9 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 98.75 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.69 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.44 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.21 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 97.53 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 96.84 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 96.46 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 96.24 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 96.24 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 95.88 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 93.55 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 93.42 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 93.16 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 92.8 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 92.46 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 92.01 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 91.6 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 90.57 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 90.47 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 89.34 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 89.28 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.66 E-value=1.5e-16 Score=123.57 Aligned_cols=68 Identities=19% Similarity=0.351 Sum_probs=62.9
Q ss_pred hhhhhhhHHHHHHHHHHHHHHHHHHccCCCCcCCCCCccchHHHHHHHHHHHHHHHHHHHHhHHhhhhc
Q 036531 123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKENS 191 (317)
Q Consensus 123 ~~~~~h~~~ER~RR~~mn~~~~~LrslvP~~~~~k~dKasiL~~ai~YIk~Lq~~v~~L~~~~~~~~~~ 191 (317)
.++.+|+.+||+||.+||+.|..|++|||.. ..|++|++||.+||+||++||.+++.|+.+...++..
T Consensus 5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~-~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~ 72 (82)
T 1am9_A 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA 72 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHhhhhHHHHHHHHHHHHHHHHHHhccCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4589999999999999999999999999983 4899999999999999999999999999999887654
|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 317 | ||||
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 6e-14 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 3e-13 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 4e-13 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 4e-12 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 8e-12 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 3e-11 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 5e-10 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 2e-08 |
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Max protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.1 bits (156), Expect = 6e-14
Identities = 13/64 (20%), Positives = 31/64 (48%)
Query: 123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLG 182
++R H A+ER RR + + LR +P ++ +A I+ A +++ + ++ +
Sbjct: 1 DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60
Query: 183 ARKE 186
+
Sbjct: 61 QDID 64
|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 317 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.57 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.53 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.53 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.43 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 97.61 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 97.47 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.16 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 95.07 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 94.12 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 92.91 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 91.13 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 90.71 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 88.86 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 88.09 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 87.2 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 84.89 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 81.78 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.61 E-value=4.8e-16 Score=118.16 Aligned_cols=67 Identities=19% Similarity=0.351 Sum_probs=61.9
Q ss_pred hhhhhhhHHHHHHHHHHHHHHHHHHccCCCCcCCCCCccchHHHHHHHHHHHHHHHHHHHHhHHhhhh
Q 036531 123 NQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQRLQSLGARKEIKEN 190 (317)
Q Consensus 123 ~~~~~h~~~ER~RR~~mn~~~~~LrslvP~~~~~k~dKasiL~~ai~YIk~Lq~~v~~L~~~~~~~~~ 190 (317)
.+|..|+.+||+||++||+.|..|++|||.. ..|++|++||..||+||++|+++++.|+.+...++.
T Consensus 5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~-~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~ 71 (80)
T d1am9a_ 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT 71 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4588999999999999999999999999984 579999999999999999999999999998887754
|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|