Citrus Sinensis ID: 036765
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 350 | ||||||
| 224136848 | 386 | predicted protein [Populus trichocarpa] | 0.942 | 0.854 | 0.620 | 1e-127 | |
| 359491993 | 388 | PREDICTED: uncharacterized protein LOC10 | 0.948 | 0.855 | 0.592 | 1e-121 | |
| 147782531 | 1001 | hypothetical protein VITISV_012133 [Viti | 0.88 | 0.307 | 0.584 | 1e-108 | |
| 356509761 | 416 | PREDICTED: uncharacterized protein LOC10 | 0.94 | 0.790 | 0.495 | 5e-90 | |
| 87241421 | 400 | Zinc finger, RING-type [Medicago truncat | 0.891 | 0.78 | 0.467 | 6e-88 | |
| 357437679 | 374 | hypothetical protein MTR_1g018650 [Medic | 0.825 | 0.772 | 0.472 | 7e-80 | |
| 356518116 | 368 | PREDICTED: uncharacterized protein LOC10 | 0.868 | 0.826 | 0.482 | 1e-78 | |
| 255538134 | 224 | ubiquitin-protein ligase, putative [Rici | 0.637 | 0.995 | 0.608 | 1e-74 | |
| 296087364 | 192 | unnamed protein product [Vitis vinifera] | 0.44 | 0.802 | 0.490 | 2e-38 | |
| 255569361 | 502 | ubiquitin-protein ligase, putative [Rici | 0.94 | 0.655 | 0.289 | 2e-38 |
| >gi|224136848|ref|XP_002326960.1| predicted protein [Populus trichocarpa] gi|222835275|gb|EEE73710.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 461 bits (1187), Expect = e-127, Method: Compositional matrix adjust.
Identities = 219/353 (62%), Positives = 278/353 (78%), Gaps = 23/353 (6%)
Query: 1 MKASSLFVRQVEVRADSEKGFLLYGFSEKPQLTHETNWTVSNFLMVGSYSRKGISLWLNK 60
MKASS+FV VEVR + +KG LLYGF EKP+L+ ETNW+V+++++V SYSRKG SLWLNK
Sbjct: 52 MKASSVFVDHVEVRDEDKKGVLLYGFYEKPELSFETNWSVADYMIVASYSRKGFSLWLNK 111
Query: 61 GSGIRMRWETRASKLNQTQLVIIKGEREFQTLLPKFTSSSDPPALTDPIDGMIFVSLAFS 120
GS IRMRWE R S LNQ Q+V+IKGER+++TLLPK TSS D L++P++G
Sbjct: 112 GSKIRMRWEARTSILNQLQVVMIKGERKYETLLPKQTSSPDALNLSEPLNG--------- 162
Query: 121 FQMNKKSKIGQYDVEEDDMYYFGVTNKNPRSITMTMNVNVTSKIYDLTKAKNMCSSSNGS 180
K +Y +EED+ YY G+ N NP++I T++VNVTSK+Y+L+KA+NMCS++ GS
Sbjct: 163 -------KEAEYTIEEDNRYYLGLINTNPKNIITTLSVNVTSKMYELSKARNMCSTTQGS 215
Query: 181 CRLKLLFPNSQYVILTTPSNGDLDGWHVEVSFAARLIIYIAILGFITLIIFLVSKYLGAC 240
CRLKLLFP +QYV++TTP NGD++GW++EV+F AR IIY+AILG I +IIFL+ KYLGAC
Sbjct: 216 CRLKLLFPKTQYVVVTTPDNGDINGWNIEVAFVARAIIYVAILGAIVIIIFLILKYLGAC 275
Query: 241 DGN-SDNTDSTA---AREVTETDPLVHEKPVQFTYGTTNNDEDDDAGFSSTSSDDLYDAK 296
D + S N TA A E +ET+P++ K V+ TYGT +E+DD G S +SS+DLYDAK
Sbjct: 276 DTDQSTNLVETATWQASEPSETEPIMPAKSVRLTYGT---NEEDDEGSSCSSSEDLYDAK 332
Query: 297 LCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRTLIHKVRRLFT 349
LCVICYDDQRNCFFVPCGHCATCYDC QRIM++D+K+CPICR LIHKVRRLFT
Sbjct: 333 LCVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKMCPICRRLIHKVRRLFT 385
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359491993|ref|XP_002283216.2| PREDICTED: uncharacterized protein LOC100248821 [Vitis vinifera] gi|302142238|emb|CBI19441.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147782531|emb|CAN68429.1| hypothetical protein VITISV_012133 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356509761|ref|XP_003523614.1| PREDICTED: uncharacterized protein LOC100777075 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|87241421|gb|ABD33279.1| Zinc finger, RING-type [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357437679|ref|XP_003589115.1| hypothetical protein MTR_1g018650 [Medicago truncatula] gi|355478163|gb|AES59366.1| hypothetical protein MTR_1g018650 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356518116|ref|XP_003527728.1| PREDICTED: uncharacterized protein LOC100794488 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255538134|ref|XP_002510132.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550833|gb|EEF52319.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296087364|emb|CBI33738.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255569361|ref|XP_002525648.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535084|gb|EEF36766.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 350 | ||||||
| TAIR|locus:2042922 | 404 | APD3 "ABERRANT POLLEN DEVELOPM | 0.897 | 0.777 | 0.314 | 1.2e-35 | |
| TAIR|locus:4515102961 | 399 | APD4 "ABERRANT POLLEN DEVELOPM | 0.885 | 0.776 | 0.306 | 3.6e-34 | |
| TAIR|locus:2179187 | 444 | APD2 "ABERRANT POLLEN DEVELOPM | 0.925 | 0.729 | 0.284 | 9.8e-32 | |
| TAIR|locus:4515103444 | 178 | AT4G24204 [Arabidopsis thalian | 0.408 | 0.803 | 0.464 | 8.8e-31 | |
| ZFIN|ZDB-GENE-090311-3 | 558 | neurla "neuralized homolog a ( | 0.431 | 0.270 | 0.305 | 1.9e-07 | |
| DICTYBASE|DDB_G0270000 | 424 | DDB_G0270000 [Dictyostelium di | 0.197 | 0.162 | 0.311 | 1.4e-06 | |
| RGD|1359633 | 254 | Neurl3 "neuralized homolog 3 ( | 0.242 | 0.334 | 0.354 | 1.1e-05 | |
| ZFIN|ZDB-GENE-050522-102 | 560 | zgc:110426 "zgc:110426" [Danio | 0.305 | 0.191 | 0.290 | 1.1e-05 | |
| FB|FBgn0260635 | 438 | th "thread" [Drosophila melano | 0.168 | 0.134 | 0.359 | 2.2e-05 | |
| UNIPROTKB|I3LE70 | 387 | MEX3C "Uncharacterized protein | 0.248 | 0.224 | 0.287 | 2.3e-05 |
| TAIR|locus:2042922 APD3 "ABERRANT POLLEN DEVELOPMENT 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
Identities = 114/363 (31%), Positives = 185/363 (50%)
Query: 1 MKASSLFVRQVEVRA-D-SEKGFLLYGFS-EKPQLTHETNWTVSNFLMVGSYSRKGISLW 57
+K SS+FV+ ++V+ D S+ G LYGF+ + + NWT S L V S KG +
Sbjct: 76 VKPSSIFVKSIKVKELDFSKPGLQLYGFNGQSTPSGYFVNWTESRVLSVSQNSYKGWPYY 135
Query: 58 LNKGSGIRMRWETRASKLNQTQLVIIKGEREFQTLLPKFTSSSDPPALTDPIDGMIFVSL 117
LN+G+ + + + K + +LVI +G + +P F SS L D + F
Sbjct: 136 LNRGTHMNISYNI-LPKGSAVRLVITEGSQVIG--MPFFYRSS----LKD----IAFRDT 184
Query: 118 AFSFQMNKKSKIGQYDVEEDDMYYFGVTNKNPRSITMTMNVNVTSKIYDLTKAKNMCSSS 177
A+S+ + + S + Q D+ + YY V N + I + ++++V + +YD + CS S
Sbjct: 185 AWSWNLIQGSGMIQLDISKSKGYYLTVANLKRKDIEVELDIDVKAVLYDTKQTSYNCSFS 244
Query: 178 NGSCRLKL--LFPNSQYVILTTPSNGDL----DGWHVEVSFAARLIIYIA----ILGFIT 227
NG C K+ +P Y ++T+P+ G D W++E+S+ RLI Y + +L F+
Sbjct: 245 NGECSFKMNERYPVENYAVVTSPALGQGVSIDDEWYIELSYQPRLIAYGSFTGVLLSFML 304
Query: 228 LIIFLVSKYLGACDGNSDNTDSTAAREVTETDPLVHEKPVQFTYGTTNNDEDDDAGFSST 287
+ I +K L C G + + R L+ +K G +ND +D S+
Sbjct: 305 VAIHFCNK-LKCCGGEGFLSGDDSVRTC-----LLADK------G--DNDCCNDVEASNK 350
Query: 288 SSDDLYDAKLCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRT-LIHKVRR 346
S LC IC+D R+C F+PCGHC +CY CG +I + + CPICR +IH V+R
Sbjct: 351 S--------LCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGR-CPICRKKMIH-VKR 400
Query: 347 LFT 349
++T
Sbjct: 401 IYT 403
|
|
| TAIR|locus:4515102961 APD4 "ABERRANT POLLEN DEVELOPMENT 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179187 APD2 "ABERRANT POLLEN DEVELOPMENT 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515103444 AT4G24204 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090311-3 neurla "neuralized homolog a (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0270000 DDB_G0270000 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| RGD|1359633 Neurl3 "neuralized homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-102 zgc:110426 "zgc:110426" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260635 th "thread" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LE70 MEX3C "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00400367 | hypothetical protein (386 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 350 | |||
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 1e-16 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 8e-10 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 3e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-06 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 9e-05 |
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Score = 72.8 bits (179), Expect = 1e-16
Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)
Query: 294 DAKLCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRTLIHKV 344
+ LCVIC + RN F+PCGH C +C +R+ K CPICR I V
Sbjct: 1 EDDLCVICLERPRNVVFLPCGHLCLCEECAKRLRS--KKKCPICRQPIESV 49
|
Length = 49 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.53 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 99.5 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.38 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.25 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 99.15 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.06 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.89 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.81 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.76 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.75 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.74 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.73 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.72 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.67 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.64 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.53 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.49 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.47 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.47 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.4 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.37 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.36 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.36 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.23 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.2 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.14 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.09 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.07 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.02 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.01 | |
| KOG1327 | 529 | consensus Copine [Signal transduction mechanisms] | 97.99 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 97.93 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.87 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.85 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.79 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.78 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.74 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.72 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.71 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.69 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.53 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.47 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.31 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.29 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 97.09 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.07 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 96.9 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.83 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.83 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.65 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.63 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.52 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 96.51 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.29 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.14 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.99 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.98 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 95.87 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 95.87 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.24 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 95.2 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.19 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 95.18 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 94.95 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 94.55 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.44 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 93.67 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 93.47 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 92.99 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.7 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 92.7 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 92.56 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 92.31 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 91.49 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 90.82 | |
| cd01459 | 254 | vWA_copine_like VWA Copine: Copines are phospholip | 90.61 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 90.43 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 90.36 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.07 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 89.84 | |
| PHA02862 | 156 | 5L protein; Provisional | 89.66 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.01 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 87.84 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 87.75 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 87.74 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 87.45 | |
| KOG3842 | 429 | consensus Adaptor protein Pellino [Signal transduc | 86.58 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 86.46 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.11 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 85.85 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.37 | |
| PHA03096 | 284 | p28-like protein; Provisional | 84.9 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.21 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 82.93 | |
| PF04710 | 416 | Pellino: Pellino; InterPro: IPR006800 Pellino is i | 80.12 |
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.53 E-value=8.1e-16 Score=144.48 Aligned_cols=51 Identities=49% Similarity=1.209 Sum_probs=48.4
Q ss_pred CcceeeccccccccEEEcCCCCccccHHhHHHHhhcCCCCCccccccccceeeccc
Q 036765 294 DAKLCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRTLIHKVRRLFT 349 (350)
Q Consensus 294 ~~~~C~IC~d~~~~~v~lpCGH~~~C~~C~~~~~~~~~~~CPiCR~~I~~~~ri~~ 349 (350)
.+.+|.||+|+++|++|++|||++.|.+|++++ ..|||||+.|.++++||+
T Consensus 299 ~~~LC~ICmDaP~DCvfLeCGHmVtCt~CGkrm-----~eCPICRqyi~rvvrif~ 349 (350)
T KOG4275|consen 299 TRRLCAICMDAPRDCVFLECGHMVTCTKCGKRM-----NECPICRQYIVRVVRIFR 349 (350)
T ss_pred HHHHHHHHhcCCcceEEeecCcEEeehhhcccc-----ccCchHHHHHHHHHhhhc
Confidence 378999999999999999999999999999998 589999999999999996
|
|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1327 consensus Copine [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 350 | ||||
| 2yhn_A | 79 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 8e-07 | ||
| 3eb5_A | 74 | Structure Of The Ciap2 Ring Domain Length = 74 | 2e-06 | ||
| 2ecg_A | 75 | Solution Structure Of The Ring Domain Of The Baculo | 3e-06 | ||
| 4ic2_A | 74 | Crystal Structure Of The Xiap Ring Domain Length = | 3e-06 | ||
| 3t6p_A | 345 | Iap Antagonist-Induced Conformational Change In Cia | 4e-06 | ||
| 4ic3_A | 74 | Crystal Structure Of The F495l Mutant Xiap Ring Dom | 7e-06 |
| >pdb|2YHN|A Chain A, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 79 | Back alignment and structure |
|
| >pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 | Back alignment and structure |
| >pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 | Back alignment and structure |
| >pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 | Back alignment and structure |
| >pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 | Back alignment and structure |
| >pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 350 | |||
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 4e-21 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 1e-20 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 1e-19 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 2e-18 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 5e-18 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 1e-13 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 8e-09 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 1e-07 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-07 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 3e-07 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 5e-07 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 2e-06 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 2e-06 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 8e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-05 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 1e-05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-05 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 2e-05 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 4e-05 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 4e-05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 4e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 5e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 7e-05 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 7e-05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 8e-05 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 8e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 9e-05 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 1e-04 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 1e-04 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 1e-04 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 2e-04 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-04 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 2e-04 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 7e-04 |
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
Score = 84.9 bits (210), Expect = 4e-21
Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 3/65 (4%)
Query: 288 SSDDLYDAKLCVICYDDQRNCFFVP--CGHCATCYDCGQRIMKDDSKVCPICRTLIHKVR 345
SS L + CVIC +N V GH C+ C +++ K + CP+CR I +
Sbjct: 1 SSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP-CPVCRQPIQMIV 59
Query: 346 RLFTP 350
+ P
Sbjct: 60 LTYFP 64
|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Length = 93 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.45 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.42 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.41 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.29 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.23 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.22 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.19 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.16 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.14 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.14 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.14 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.14 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.1 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.08 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.08 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.05 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.05 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.05 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.04 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.04 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.04 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.04 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.03 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.03 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.01 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.99 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.97 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.96 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.95 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.95 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.95 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.93 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.93 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.93 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.92 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.92 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.92 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.91 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.91 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.9 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.88 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.88 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.85 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.84 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.84 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.82 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.8 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.79 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.76 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.76 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.7 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.68 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.67 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.67 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.62 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.58 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.56 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.55 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.44 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.24 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.19 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.14 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.11 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.98 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.95 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.42 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.16 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.67 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 93.41 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 93.14 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 91.65 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 90.59 |
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.45 E-value=3.8e-14 Score=106.86 Aligned_cols=53 Identities=30% Similarity=0.775 Sum_probs=48.2
Q ss_pred cCcceeeccccccccEEEcCCCCccccHHhHHHHhhcCCCCCccccccccceeecccC
Q 036765 293 YDAKLCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRTLIHKVRRLFTP 350 (350)
Q Consensus 293 ~~~~~C~IC~d~~~~~v~lpCGH~~~C~~C~~~~~~~~~~~CPiCR~~I~~~~ri~~p 350 (350)
.+...|+||++..++++++||||..+|..|+..+ ..||+||++|..++++|.|
T Consensus 13 ~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~-----~~CP~CR~~i~~~~~i~~~ 65 (68)
T 2ea5_A 13 ENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYF-----QQCPMCRQFVQESFALSGP 65 (68)
T ss_dssp CCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHC-----SSCTTTCCCCCCEECCCSS
T ss_pred CCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcC-----CCCCCCCcchhceEEeecC
Confidence 3567899999999999999999966999999964 7899999999999999976
|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 350 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-11 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 3e-07 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-07 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 6e-07 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 4e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 4e-05 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 5e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 5e-04 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 0.001 | |
| d1weoa_ | 93 | g.44.1.1 (A:) Cellulose synthase A catalytic subun | 0.003 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.003 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 57.3 bits (138), Expect = 2e-11
Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%)
Query: 293 YDAKLCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRTLIHKVRRLF 348
+LC IC ++ ++ PCGH C C + + + CP CR I +
Sbjct: 21 STFQLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 93 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.11 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.1 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.01 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.96 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.96 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.95 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.94 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.92 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.88 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.86 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.71 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.61 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.6 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.56 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.31 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.72 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 90.77 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 80.72 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.23 E-value=2.2e-12 Score=98.12 Aligned_cols=52 Identities=29% Similarity=0.776 Sum_probs=45.8
Q ss_pred ceeeccccccccEEEcCCCCccccHHhHHHHhhcCCCCCccccccccceeecc
Q 036765 296 KLCVICYDDQRNCFFVPCGHCATCYDCGQRIMKDDSKVCPICRTLIHKVRRLF 348 (350)
Q Consensus 296 ~~C~IC~d~~~~~v~lpCGH~~~C~~C~~~~~~~~~~~CPiCR~~I~~~~ri~ 348 (350)
..|+||++...+++++|||| .||.+|+.+|...+...||+||..|.....+.
T Consensus 24 ~~C~IC~~~~~~~~~~~CgH-~fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~ 75 (79)
T d1fbva4 24 QLCKICAENDKDVKIEPCGH-LMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75 (79)
T ss_dssp TBCTTTSSSBCCEECSSSCC-EECHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred CCCccCCCcCCCeEEeCCCC-eeeHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence 46999999999999999999 89999999998764578999999998866553
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|