Citrus Sinensis ID: 036996

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MGSFGLSANNITHGTSFSADLEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAKLI
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccEEccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHcc
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccccccccccHHHHHHHHHHHcccccccccccccEEEccccccHHHHHHHHHHHHHHHHcHcHcccHHHHHHHHHHHHHHHHHHcccHHHHHccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHcHHHHHHHHHc
mgsfglsannithgtsfsadlepksfsdeSKAVIDFIADYYKNiekypvqskvepgylsarlpdtaphspesLDDILKDVTdcilpglthwqspnffgyfqanastaGFLGEMLCsgfnvvgfnwlaspvatELESIVMDWMGKmlklpssflfsgtgggvlhgstCESLVCTLAAARDKALEKlgggfdniTKLAVYASDQTHFALQKSAKLI
mgsfglsannithgtsfsadlepksfSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAKLI
MGSFGLSANNITHGTSFSADLEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAKLI
*******************************AVIDFIADYYKNIEKYPVQSKVEPGY****************DDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFA********
********************LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPD***HSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKL*G**DNITKLAVYASDQTHFALQKSAKLI
MGSFGLSANNITHGTSFSADLEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAKLI
******************ADLEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFA*QK****I
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSFGLSANNITHGTSFSADLEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAKLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
P54770 533 Tyrosine/DOPA decarboxyla N/A no 0.981 0.393 0.604 9e-77
P54769 531 Tyrosine/DOPA decarboxyla N/A no 0.892 0.359 0.637 3e-75
Q06087 516 Tyrosine decarboxylase 3 N/A no 0.985 0.408 0.612 5e-71
P54768 518 Tyrosine/DOPA decarboxyla N/A no 0.976 0.403 0.610 2e-70
Q06086 514 Tyrosine decarboxylase 2 N/A no 0.892 0.371 0.647 2e-70
Q06088 508 Tyrosine decarboxylase 4 N/A no 0.892 0.375 0.647 3e-70
Q06085 432 Tyrosine decarboxylase 1 N/A no 0.869 0.430 0.648 4e-68
P17770 500 Aromatic-L-amino-acid dec N/A no 0.892 0.382 0.585 5e-66
P54771 523 Tyrosine/DOPA decarboxyla N/A no 0.883 0.361 0.587 8e-64
Q7XHL3 497 Tyrosine decarboxylase 1 yes no 0.836 0.360 0.569 2e-60
>sp|P54770|TYDC3_PAPSO Tyrosine/DOPA decarboxylase 3 OS=Papaver somniferum GN=TYDC3 PE=2 SV=2 Back     alignment and function desciption
 Score =  286 bits (731), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 172/215 (80%), Gaps = 5/215 (2%)

Query: 1   MGSFGLSANNITHGTSFSAD--LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYL 58
           MGS   + + + H ++F A   L+P+ F  +   +IDF+ADYY+++EKYPV+S+VEPGYL
Sbjct: 1   MGSLN-TEDVLEHSSAFGATNPLDPEEFRRQGHMIIDFLADYYRDVEKYPVRSQVEPGYL 59

Query: 59  SARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGF 118
             RLP+TAP++PES++ IL+DVT  I+PGLTHWQSPN++ YF ++ S AGFLGEML +GF
Sbjct: 60  RKRLPETAPYNPESIETILQDVTSEIIPGLTHWQSPNYYAYFPSSGSVAGFLGEMLSTGF 119

Query: 119 NVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAAR 178
           NVVGFNW++SP ATELE IVMDW GKML LP S+LFSGTGGGVL G+TCE+++CTL AAR
Sbjct: 120 NVVGFNWMSSPAATELEGIVMDWFGKMLNLPKSYLFSGTGGGVLQGTTCEAILCTLTAAR 179

Query: 179 DKALEKLGGGFDNITKLAVYASDQTHFALQKSAKL 213
           D+ L K+G   ++I +L VY SDQTH ALQK+A++
Sbjct: 180 DRKLNKIGR--EHIGRLVVYGSDQTHCALQKAAQI 212
Marginally higher substrate specificity for L-DOPA over L-tyrosine.
Papaver somniferum (taxid: 3469)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 5
>sp|P54769|TYDC2_PAPSO Tyrosine/DOPA decarboxylase 2 OS=Papaver somniferum GN=TYDC2 PE=2 SV=1 Back     alignment and function description
>sp|Q06087|TYDC3_PETCR Tyrosine decarboxylase 3 OS=Petroselinum crispum GN=TYRDC-3 PE=2 SV=1 Back     alignment and function description
>sp|P54768|TYDC1_PAPSO Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum GN=TYDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q06086|TYDC2_PETCR Tyrosine decarboxylase 2 OS=Petroselinum crispum GN=TYRDC-2 PE=2 SV=1 Back     alignment and function description
>sp|Q06088|TYDC4_PETCR Tyrosine decarboxylase 4 OS=Petroselinum crispum GN=TYRDC-4 PE=2 SV=1 Back     alignment and function description
>sp|Q06085|TYDC1_PETCR Tyrosine decarboxylase 1 (Fragment) OS=Petroselinum crispum GN=TYRDC-1 PE=2 SV=1 Back     alignment and function description
>sp|P17770|DDC_CATRO Aromatic-L-amino-acid decarboxylase OS=Catharanthus roseus GN=TDC PE=2 SV=1 Back     alignment and function description
>sp|P54771|TYDC5_PAPSO Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum GN=TYDC5 PE=2 SV=1 Back     alignment and function description
>sp|Q7XHL3|TYDC1_ORYSJ Tyrosine decarboxylase 1 OS=Oryza sativa subsp. japonica GN=Os07g0437500 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
224139068 494 predicted protein [Populus trichocarpa] 0.943 0.408 0.726 4e-84
224123662 493 predicted protein [Populus trichocarpa] 0.897 0.389 0.752 2e-83
225462400 496 PREDICTED: tyrosine/DOPA decarboxylase 2 0.897 0.387 0.762 2e-81
359476508 496 PREDICTED: tyrosine/DOPA decarboxylase 2 0.897 0.387 0.757 2e-81
147833019 496 hypothetical protein VITISV_007034 [Viti 0.897 0.387 0.752 5e-81
255605445239 aromatic amino acid decarboxylase, putat 0.841 0.753 0.741 4e-80
226897772225 tyrosine/dopa decarboxylase-like protein 0.892 0.848 0.673 1e-76
217038851 537 tyrosine/DOPA decarboxylase [Argemone me 0.981 0.391 0.618 5e-76
226897724238 putative tyrosine/dopa decarboxylase [Pa 0.981 0.882 0.609 2e-75
147854402 489 hypothetical protein VITISV_020160 [Viti 0.897 0.392 0.742 3e-75
>gi|224139068|ref|XP_002322972.1| predicted protein [Populus trichocarpa] gi|222867602|gb|EEF04733.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 174/205 (84%), Gaps = 3/205 (1%)

Query: 10  NITHGTSFSADLEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHS 69
           +++  T+FS  L+P  F+++SK VIDFIADYYKNIE  PVQS+V+PGYL  +LPDTAP+ 
Sbjct: 3   SLSTNTTFSP-LDPNGFTNDSKMVIDFIADYYKNIENNPVQSQVKPGYLLTQLPDTAPYC 61

Query: 70  PESLDDILKDVTDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASP 129
            ESL+D+LKDVTD I+PGLTHWQSPNFF YFQANASTAGF+GEMLC+G NVVGFNW+ASP
Sbjct: 62  QESLEDVLKDVTDSIIPGLTHWQSPNFFAYFQANASTAGFVGEMLCTGLNVVGFNWIASP 121

Query: 130 VATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGF 189
            ATELESIVMDWMGKMLKLPS+FLFSG GGGVLHGSTCE++VCTL AARD+ L  +G   
Sbjct: 122 AATELESIVMDWMGKMLKLPSTFLFSGNGGGVLHGSTCEAIVCTLVAARDETLRMIGA-- 179

Query: 190 DNITKLAVYASDQTHFALQKSAKLI 214
           +NITKL VYASDQTH  L K  KL+
Sbjct: 180 ENITKLVVYASDQTHSTLLKGVKLV 204

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224123662|ref|XP_002319135.1| predicted protein [Populus trichocarpa] gi|222857511|gb|EEE95058.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462400|ref|XP_002266962.1| PREDICTED: tyrosine/DOPA decarboxylase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476508|ref|XP_003631850.1| PREDICTED: tyrosine/DOPA decarboxylase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833019|emb|CAN61896.1| hypothetical protein VITISV_007034 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255605445|ref|XP_002538395.1| aromatic amino acid decarboxylase, putative [Ricinus communis] gi|223512373|gb|EEF23988.1| aromatic amino acid decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|226897772|gb|ACO90256.1| tyrosine/dopa decarboxylase-like protein [Eschscholzia californica] Back     alignment and taxonomy information
>gi|217038851|gb|ACJ76782.1| tyrosine/DOPA decarboxylase [Argemone mexicana] Back     alignment and taxonomy information
>gi|226897724|gb|ACO90233.1| putative tyrosine/dopa decarboxylase [Papaver bracteatum] Back     alignment and taxonomy information
>gi|147854402|emb|CAN81298.1| hypothetical protein VITISV_020160 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
TAIR|locus:2038937 490 AAS "AT2G20340" [Arabidopsis t 0.892 0.389 0.533 1.3e-54
TAIR|locus:2139855 547 TYRDC "L-tyrosine decarboxylas 0.878 0.343 0.5 3.1e-51
UNIPROTKB|E1BV90 485 DDC "Uncharacterized protein" 0.892 0.393 0.432 3.9e-44
RGD|2494 480 Ddc "dopa decarboxylase (aroma 0.887 0.395 0.439 3.9e-44
MGI|MGI:94876 480 Ddc "dopa decarboxylase" [Mus 0.887 0.395 0.439 1e-43
UNIPROTKB|P80041 486 DDC "Aromatic-L-amino-acid dec 0.887 0.390 0.429 2.5e-42
ZFIN|ZDB-GENE-040426-2656 480 ddc "dopa decarboxylase" [Dani 0.887 0.395 0.414 5.2e-42
UNIPROTKB|F1PFV0 480 DDC "Uncharacterized protein" 0.887 0.395 0.429 6.6e-42
UNIPROTKB|F6R993 380 DDC "Aromatic-L-amino-acid dec 0.887 0.5 0.419 4.6e-41
UNIPROTKB|E7ER62 338 DDC "Aromatic-L-amino-acid dec 0.887 0.562 0.414 5.9e-41
TAIR|locus:2038937 AAS "AT2G20340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 564 (203.6 bits), Expect = 1.3e-54, P = 1.3e-54
 Identities = 103/193 (53%), Positives = 139/193 (72%)

Query:    21 LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDV 80
             ++ +   +    ++DFIADYYK IE +PV S+V+PGYL   LPD+AP  PE+LD +L DV
Sbjct:    12 MDSEQLREYGHLMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDV 71

Query:    81 TDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMD 140
                ILPG+THWQSP+FF Y+ +N+S AGFLGEML +G  +VGF+W+ SP ATELE IV+D
Sbjct:    72 RAKILPGVTHWQSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLD 131

Query:   141 WMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYAS 200
             W+ K+L LP  F+  G GGGV+ GS  E+++  L AARDK L  +G   + + KL VY+S
Sbjct:   132 WVAKLLNLPEQFMSKGNGGGVIQGSASEAVLVVLIAARDKVLRSVGK--NALEKLVVYSS 189

Query:   201 DQTHFALQKSAKL 213
             DQTH ALQK+ ++
Sbjct:   190 DQTHSALQKACQI 202
GO:0004837 "tyrosine decarboxylase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006520 "cellular amino acid metabolic process" evidence=ISS
GO:0009611 "response to wounding" evidence=IEP
GO:1990055 "phenylacetaldehyde synthase activity" evidence=IDA
GO:0006559 "L-phenylalanine catabolic process" evidence=IDA
TAIR|locus:2139855 TYRDC "L-tyrosine decarboxylase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BV90 DDC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2494 Ddc "dopa decarboxylase (aromatic L-amino acid decarboxylase)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:94876 Ddc "dopa decarboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P80041 DDC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2656 ddc "dopa decarboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFV0 DDC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6R993 DDC "Aromatic-L-amino-acid decarboxylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER62 DDC "Aromatic-L-amino-acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
PLN02880 490 PLN02880, PLN02880, tyrosine decarboxylase 1e-84
PLN02590 539 PLN02590, PLN02590, probable tyrosine decarboxylas 2e-67
pfam00282 373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 1e-62
cd06450 345 cd06450, DOPA_deC_like, DOPA decarboxylase family 6e-28
COG0076 460 COG0076, GadB, Glutamate decarboxylase and related 2e-19
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information 
 Score =  258 bits (661), Expect = 1e-84
 Identities = 105/181 (58%), Positives = 140/181 (77%), Gaps = 2/181 (1%)

Query: 33  VIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQ 92
           ++DFIADYYK+IE +PV S+V+PGYL   LPD+AP+ PE+LD +L DV   ILPG+THWQ
Sbjct: 22  MVDFIADYYKSIENFPVLSQVQPGYLRELLPDSAPNQPETLDQVLDDVQAKILPGVTHWQ 81

Query: 93  SPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSF 152
           SPN+F Y+ +N+S AGFLGEML +G N+VGF+W+ SP ATELE IV+DW+ K+L LP  F
Sbjct: 82  SPNYFAYYPSNSSVAGFLGEMLSAGLNIVGFSWITSPAATELEMIVLDWLAKLLNLPEQF 141

Query: 153 LFSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAK 212
           L +G GGGV+ G+  E+++  L AARD+ L K+G   + + KL VYASDQTH ALQK+ +
Sbjct: 142 LSTGNGGGVIQGTASEAVLVVLLAARDRVLRKVGK--NALEKLVVYASDQTHSALQKACQ 199

Query: 213 L 213
           +
Sbjct: 200 I 200

Length = 490
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
PLN02590 539 probable tyrosine decarboxylase 100.0
PLN02880 490 tyrosine decarboxylase 100.0
KOG0628 511 consensus Aromatic-L-amino-acid/L-histidine decarb 100.0
PF00282 373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 100.0
KOG0629 510 consensus Glutamate decarboxylase and related prot 100.0
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 99.94
PLN02263 470 serine decarboxylase 99.91
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 99.87
PLN03032 374 serine decarboxylase; Provisional 99.72
PRK02769 380 histidine decarboxylase; Provisional 99.7
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 99.6
KOG1383 491 consensus Glutamate decarboxylase/sphingosine phos 99.27
PRK13520 371 L-tyrosine decarboxylase; Provisional 98.93
PRK00451 447 glycine dehydrogenase subunit 1; Validated 98.87
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 98.81
PRK05367 954 glycine dehydrogenase; Provisional 98.35
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.35
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 98.06
PRK04366 481 glycine dehydrogenase subunit 2; Validated 97.78
PLN02651 364 cysteine desulfurase 96.76
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 96.36
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 96.34
PRK02948 381 cysteine desulfurase; Provisional 96.24
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 95.95
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 95.82
PRK14012 404 cysteine desulfurase; Provisional 95.65
cd00609 350 AAT_like Aspartate aminotransferase family. This f 95.01
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 94.55
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 94.52
KOG1549 428 consensus Cysteine desulfurase NFS1 [Amino acid tr 94.43
PRK07179 407 hypothetical protein; Provisional 92.8
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 92.55
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 91.89
PRK12566 954 glycine dehydrogenase; Provisional 91.7
PF01212 290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 91.45
cd01494 170 AAT_I Aspartate aminotransferase (AAT) superfamily 91.2
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 90.3
cd00615 294 Orn_deC_like Ornithine decarboxylase family. This 90.16
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 90.1
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 90.07
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 89.93
PRK03715 395 argD acetylornithine transaminase protein; Provisi 89.6
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 88.14
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 87.96
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 87.23
KOG1368 384 consensus Threonine aldolase [Amino acid transport 86.72
PRK12403 460 putative aminotransferase; Provisional 86.39
PF02347 429 GDC-P: Glycine cleavage system P-protein; InterPro 85.75
COG0001 432 HemL Glutamate-1-semialdehyde aminotransferase [Co 85.58
PRK15029 755 arginine decarboxylase; Provisional 85.52
PRK09082 386 methionine aminotransferase; Validated 85.49
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 85.4
PRK02936 377 argD acetylornithine aminotransferase; Provisional 84.93
PRK08361 391 aspartate aminotransferase; Provisional 84.9
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 84.5
PLN02721 353 threonine aldolase 84.34
PRK15399 713 lysine decarboxylase LdcC; Provisional 84.33
PRK01278 389 argD acetylornithine transaminase protein; Provisi 84.33
PRK06917 447 hypothetical protein; Provisional 84.02
PRK07046 453 aminotransferase; Validated 83.97
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 83.84
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 83.67
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 83.33
PRK06108 382 aspartate aminotransferase; Provisional 83.19
PLN02414 993 glycine dehydrogenase (decarboxylating) 82.8
PRK05965 459 hypothetical protein; Provisional 82.02
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 81.95
PRK12566 954 glycine dehydrogenase; Provisional 81.87
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 81.81
cd00611 355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 81.69
PRK04260 375 acetylornithine aminotransferase; Provisional 81.44
PRK02627 396 acetylornithine aminotransferase; Provisional 81.34
PRK03244 398 argD acetylornithine aminotransferase; Provisional 81.14
PRK07481 449 hypothetical protein; Provisional 81.02
PRK15400 714 lysine decarboxylase CadA; Provisional 80.69
PRK04073 396 rocD ornithine--oxo-acid transaminase; Provisional 80.57
PLN02624 474 ornithine-delta-aminotransferase 80.4
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 80.39
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 80.25
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information 
Probab=100.00  E-value=2.8e-44  Score=331.25  Aligned_cols=195  Identities=50%  Similarity=0.978  Sum_probs=181.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHhcCC----CCCCCCCChhHHhhcCCCCCCCCCCCHHHHHHHHhHhhcCCCCcCCC
Q 036996           18 SADLEPKSFSDESKAVIDFIADYYKNIEK----YPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQS   93 (214)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~----~pv~~~~~~~~l~~~~~~~lP~~g~~~~~il~~l~~~~~~~~~~~~~   93 (214)
                      +.++++++||+.++++++.+.+|++++.+    +||.+.+.|+++++.++.++|++|++++++++++.+.+.++.++|+|
T Consensus        51 ~~~m~~~~~r~~~~~~~d~i~~~~~~~~~~~~~~pv~~~~~p~~l~~~l~~~~P~~g~~~~~il~~~~~~i~p~~~~~~h  130 (539)
T PLN02590         51 MKPMDSELLREQGHIMVDFIADYYKNLQDSPQDFPVLSQVQPGYLRDMLPDSAPERPESLKELLDDVSKKIMPGITHWQS  130 (539)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHhhccccccCCCCCCCCChHHHHHhcCCCCCCCCCCHHHHHHHHHHHHhccCCcCCC
Confidence            56699999999999999999999999887    69999999999999999999999999999999999999999999999


Q ss_pred             CCcceeccCCCChhhhHHHHHHhhcccCcccccCChhHHHHHHHHHHHHHHHcCCCCCCcCCCCCCceecCCchHHHHHH
Q 036996           94 PNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLFSGTGGGVLHGSTCESLVCT  173 (214)
Q Consensus        94 pr~~g~~~~~~~~~~~~~d~l~~~~n~n~~~~~~sp~~~~iE~~vi~wl~~l~G~p~~~~~~~~~~G~~tsGGt~aNl~A  173 (214)
                      ||||||+++++++++++||+|++++|+++..|+.||++++||++|++||++|+|+|+.+..++.++|+||+|||+|||+|
T Consensus       131 P~f~a~~~~~~~~~~~lgd~l~sa~n~~~~~~~~sPa~t~lE~~vi~wl~~l~glp~~~~~~~~~gG~~~sGgSeAnl~a  210 (539)
T PLN02590        131 PSYFAYYASSTSVAGFLGEMLNAGLSVVGFTWLTSPAATELEIIVLDWLAKLLQLPDHFLSTGNGGGVIQGTGCEAVLVV  210 (539)
T ss_pred             CCeeEeccCCCcHHHHHHHHHHHhcccccCCcccCchhHHHHHHHHHHHHHHhCCCcccccCCCCceEEcCchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999875433447899999999999999


Q ss_pred             HHHHHHHHHHHhCCCCCCCCceEEEEeCCCchHHHHHhhcC
Q 036996          174 LAAARDKALEKLGGGFDNITKLAVYASDQTHFALQKSAKLI  214 (214)
Q Consensus       174 l~aAR~~~~~~~~~g~~~~~~~~i~~s~~aH~Si~KAa~ll  214 (214)
                      |++||++..++.+.  .+.+++++|+|+++||||+|||+++
T Consensus       211 l~aAR~~~~~~~g~--~~~~~~vvy~S~~aH~Sv~KAa~il  249 (539)
T PLN02590        211 VLAARDRILKKVGK--TLLPQLVVYGSDQTHSSFRKACLIG  249 (539)
T ss_pred             HHHHHHHHHhhhcc--cCCCCEEEEecCCchHHHHHHHHHc
Confidence            99999988765443  4568999999999999999999975

>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
3rbf_A 480 Crystal Structure Of Human Aromatic L-Amino Acid De 4e-45
3rch_A 480 Crystal Structure Of Human Aromatic L-Amino Acid De 4e-45
1js3_A 486 Crystal Structure Of Dopa Decarboxylase In Complex 4e-43
4e1o_A 481 Human Histidine Decarboxylase Complex With Histidin 2e-40
3k40_A 475 Crystal Structure Of Drosophila 3,4-Dihydroxyphenyl 2e-39
3vp6_A 511 Structural Characterization Of Glutamic Acid Decarb 2e-07
2okj_A 504 The X-Ray Crystal Structure Of The 67kda Isoform Of 2e-07
>pdb|3RBF|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Apo Form Length = 480 Back     alignment and structure 
Iteration: 1

 Score =  177 bits (449), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 118/194 (60%), Gaps = 8/194 (4%)
Query: 25  SFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCI 84
            F    K ++D++A+Y + IE   V   VEPGYL   +P  AP  P++ +DI+ DV   I
Sbjct: 5   EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKII 64
Query: 85  LPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGK 144
           +PG+THW SP FF YF   +S    L +MLC     +GF+W ASP  TELE+++MDW+GK
Sbjct: 65  MPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGK 124
Query: 145 MLKLPSSFL--FSGTGGGVLHGSTCESLVCTLAAARDKALEKLGGGFDNIT------KLA 196
           ML+LP +FL   +G GGGV+ GS  E+ +  L AAR K + +L      +T      KL 
Sbjct: 125 MLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLV 184
Query: 197 VYASDQTHFALQKS 210
            Y+SDQ H +++++
Sbjct: 185 AYSSDQAHSSVERA 198
>pdb|3RCH|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Open Conformation With Llp And Plp Bound To Chain-A And Chain- B Respectively Length = 480 Back     alignment and structure
>pdb|1JS3|A Chain A, Crystal Structure Of Dopa Decarboxylase In Complex With The Inhibitor Carbidopa Length = 486 Back     alignment and structure
>pdb|4E1O|A Chain A, Human Histidine Decarboxylase Complex With Histidine Methyl Ester (Hme) Length = 481 Back     alignment and structure
>pdb|3K40|A Chain A, Crystal Structure Of Drosophila 3,4-Dihydroxyphenylalanine Decarboxylase Length = 475 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 1e-76
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 1e-76
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1e-76
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 2e-67
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 3e-66
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 5e-63
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 1e-13
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 1e-10
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 4e-10
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 1e-07
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 1e-04
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
 Score =  237 bits (607), Expect = 1e-76
 Identities = 84/202 (41%), Positives = 121/202 (59%), Gaps = 8/202 (3%)

Query: 21  LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDV 80
           +    F    K ++D++ADY + IE   V   V+PGYL   +P TAP  P++ +DIL+DV
Sbjct: 1   MNASDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDV 60

Query: 81  TDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMD 140
              I+PG+THW SP FF YF   +S    L +MLC     +GF+W ASP  TELE+++MD
Sbjct: 61  EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD 120

Query: 141 WMGKMLKLPSSFLF--SGTGGGVLHGSTCESLVCTLAAARDKALEKLGG------GFDNI 192
           W+GKML+LP +FL   +G GGGV+ GS  E+ +  L AAR K + +L            +
Sbjct: 121 WLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVL 180

Query: 193 TKLAVYASDQTHFALQKSAKLI 214
            KL  YASDQ H +++++  + 
Sbjct: 181 EKLVAYASDQAHSSVERAGLIG 202
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 100.0
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 100.0
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.97
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.97
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.96
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.96
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.95
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.72
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.62
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.61
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.57
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.53
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.25
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 98.98
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 98.87
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 98.02
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 97.13
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 96.91
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 96.87
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 96.86
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 96.78
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 96.33
1svv_A 359 Threonine aldolase; structural genomics, structura 95.9
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 95.81
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 95.58
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 95.55
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 95.45
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 95.0
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 94.88
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 94.8
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 94.76
1iug_A 352 Putative aspartate aminotransferase; wild type, py 94.73
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 94.56
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 94.21
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 94.18
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 94.17
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 94.03
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 94.02
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 94.02
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 93.86
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 93.82
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 93.81
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 93.81
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 93.8
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 93.72
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 93.62
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 93.47
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 93.44
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 93.31
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 93.25
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 93.16
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 92.97
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 92.96
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 92.94
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 92.91
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 92.85
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 92.78
3nra_A 407 Aspartate aminotransferase; structural genomics, j 92.78
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 92.6
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 92.53
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 92.38
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 92.06
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 91.93
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 91.83
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 91.67
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 91.66
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 91.62
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 91.54
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 91.5
3ele_A 398 Amino transferase; RER070207001803, structural gen 91.36
1vp4_A 425 Aminotransferase, putative; structural genomics, j 91.04
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 91.02
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 90.91
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 90.83
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 90.73
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 90.64
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 90.42
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 90.28
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 90.26
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 90.17
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 89.96
4e3q_A 473 Pyruvate transaminase; aminotransferase, transfera 89.95
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 89.75
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 89.67
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 89.66
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 89.63
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 89.53
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 89.53
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 89.52
3hmu_A 472 Aminotransferase, class III; structural genomics, 89.43
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 89.26
3pj0_A 359 LMO0305 protein; structural genomics, joint center 89.25
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 89.09
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 88.96
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 88.91
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 88.83
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 88.74
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 88.68
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 88.22
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 88.19
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 88.11
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 87.94
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 87.82
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 87.79
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 87.78
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 87.63
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 87.6
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 87.6
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 87.58
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 87.49
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 87.39
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 87.38
2fnu_A 375 Aminotransferase; protein-product complex, structu 87.25
1z7d_A 433 Ornithine aminotransferase; structural genomics co 87.18
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 87.13
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 87.04
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 86.91
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 86.9
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 86.84
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 86.82
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 86.8
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 86.74
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 86.71
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 86.55
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 86.42
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 86.41
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 86.29
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 86.22
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 86.11
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 85.83
2c0r_A 362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 85.79
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 85.7
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 85.65
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 85.62
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 85.56
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 85.11
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 84.6
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 84.51
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 84.1
3rq1_A 418 Aminotransferase class I and II; structural genomi 84.09
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 83.9
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 83.7
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 83.3
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 83.29
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 83.23
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 83.23
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 82.63
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 82.47
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 81.92
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 81.86
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 81.24
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 81.14
4atq_A 456 4-aminobutyrate transaminase; transferase; HET: PL 80.9
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 80.56
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 80.46
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 80.33
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 80.15
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 80.11
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
Probab=100.00  E-value=7.4e-36  Score=271.16  Aligned_cols=193  Identities=42%  Similarity=0.845  Sum_probs=174.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCChhHHhhcCCCCCCCCCCCHHHHHHHHhHhhcCCCCcCCCCCcceec
Q 036996           21 LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYF  100 (214)
Q Consensus        21 ~~~~~~~~~~~~~~~~i~~~~~~~~~~pv~~~~~~~~l~~~~~~~lP~~g~~~~~il~~l~~~~~~~~~~~~~pr~~g~~  100 (214)
                      +|+++||+.++++++.+.+|+++++++||.+.+.|+++++.++..+|++|.+++++++++.+.+.++.++|+||||+||+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~p~~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~   80 (475)
T 3k40_A            1 MEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYF   80 (475)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHTGGGSCSSCSSCTTCSGGGSCSSCCSSCCCHHHHHHHHHHHTGGGCCCTTCTTBCCSS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHhccccCCCCCCCCHHHHHHhcCCCCCCCCCCHHHHHHHHHHHHhccCCCCCCcCceeeC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCChhhhHHHHHHhhcccCcccccCChhHHHHHHHHHHHHHHHcCCCCCCcC--CCCCCceecCCchHHHHHHHHHHH
Q 036996          101 QANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLF--SGTGGGVLHGSTCESLVCTLAAAR  178 (214)
Q Consensus       101 ~~~~~~~~~~~d~l~~~~n~n~~~~~~sp~~~~iE~~vi~wl~~l~G~p~~~~~--~~~~~G~~tsGGt~aNl~Al~aAR  178 (214)
                      ++++++++++++++++.+|+|+..|..+|++++||+++++|+++++|+|+.+.+  .+.++|+||+|||+||++|+++||
T Consensus        81 ~~~~~~~~~~~~~l~~~~n~~~~~~~~~p~~~~lE~~v~~~l~~~~g~~~~~~~~~~~~~~gv~t~ggt~anl~al~~ar  160 (475)
T 3k40_A           81 PTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAK  160 (475)
T ss_dssp             CCCCCHHHHHHHHHHHHHCCCSSSCCCCHHHHHHHHHHHHHHHHHTTCCGGGCGGGTSSCEEEEESCHHHHHHHHHHHHH
T ss_pred             CCCCcHHHHHHHHHHHHhCccccCccCCcHHHHHHHHHHHHHHHHhCCCchhccccCCCCCeEEcCchHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999975432  123579999999999999999999


Q ss_pred             HHHHHHh---CCCCC--C-CCceEEEEeCCCchHHHHHhhc
Q 036996          179 DKALEKL---GGGFD--N-ITKLAVYASDQTHFALQKSAKL  213 (214)
Q Consensus       179 ~~~~~~~---~~g~~--~-~~~~~i~~s~~aH~Si~KAa~l  213 (214)
                      ++..++.   +.++.  + .++.+||+|+.+|+|+.|++++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~vi~s~~~H~s~~~~~~~  201 (475)
T 3k40_A          161 AKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLL  201 (475)
T ss_dssp             HHHHHHHHHHCTTSCHHHHHHHEEEEEETTSCHHHHHHHHH
T ss_pred             HHHHHHhhccCcccccccccCCeEEEECCCchHHHHHHHHH
Confidence            9876543   21111  1 2568999999999999999875
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1js3a_ 476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 2e-55
d1pmma_ 450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 2e-21
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  181 bits (460), Expect = 2e-55
 Identities = 84/198 (42%), Positives = 119/198 (60%), Gaps = 8/198 (4%)

Query: 21  LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDV 80
           +    F    K ++D++ADY + IE   V   V+PGYL   +P TAP  P++ +DIL+DV
Sbjct: 1   MNASDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDV 60

Query: 81  TDCILPGLTHWQSPNFFGYFQANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMD 140
              I+PG+THW SP FF YF   +S    L +MLC     +GF+W ASP  TELE+++MD
Sbjct: 61  EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD 120

Query: 141 WMGKMLKLPSSFLFSGTG--GGVLHGSTCESLVCTLAAARDKALEKLGGGFDNIT----- 193
           W+GKML+LP +FL    G  GGV+ GS  E+ +  L AAR K + +L      +T     
Sbjct: 121 WLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVL 180

Query: 194 -KLAVYASDQTHFALQKS 210
            KL  YASDQ H +++++
Sbjct: 181 EKLVAYASDQAHSSVERA 198
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 99.86
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.41
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.1
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 97.0
d1svva_ 340 Low-specificity threonine aldolase {Leishmania maj 96.84
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 95.49
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 95.03
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 94.9
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 94.09
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 93.29
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 92.27
d1wyub1 471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 91.13
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 87.8
d1wyua1 437 Glycine dehydrogenase (decarboxylating) subunit 1 86.22
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 85.94
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 85.47
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 82.71
d2c0ra1 361 Phosphoserine aminotransferase, PSAT {Bacillus cir 80.86
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 80.55
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 80.07
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=7.6e-44  Score=322.45  Aligned_cols=194  Identities=44%  Similarity=0.879  Sum_probs=179.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCChhHHhhcCCCCCCCCCCCHHHHHHHHhHhhcCCCCcCCCCCcceec
Q 036996           21 LEPKSFSDESKAVIDFIADYYKNIEKYPVQSKVEPGYLSARLPDTAPHSPESLDDILKDVTDCILPGLTHWQSPNFFGYF  100 (214)
Q Consensus        21 ~~~~~~~~~~~~~~~~i~~~~~~~~~~pv~~~~~~~~l~~~~~~~lP~~g~~~~~il~~l~~~~~~~~~~~~~pr~~g~~  100 (214)
                      +|+|+||+.+++++|.+.||+++.+++||+++++|.++++.++..+|++|.+.+++++++.+.+.+++++|+||||+||+
T Consensus         1 m~~~~fr~~~~~~~d~i~d~~~~~~~~~v~~~~~p~~l~~~~~~~~P~~g~~~~~~l~~~~~~i~~~~~~~~~P~f~~~~   80 (476)
T d1js3a_           1 MNASDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKIIMPGVTHWHSPYFFAYF   80 (476)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHTGGGSCSSCCCCTTCSGGGSCSSCCSSCCCHHHHHHHHHHTTGGGCCCTTSTTBCSSS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCChHHHHHhcCcccCcCCCCHHHHHHHHHHHHhCCCCCCCCCCeeEeC
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCChhhhHHHHHHhhcccCcccccCChhHHHHHHHHHHHHHHHcCCCCCCcC--CCCCCceecCCchHHHHHHHHHHH
Q 036996          101 QANASTAGFLGEMLCSGFNVVGFNWLASPVATELESIVMDWMGKMLKLPSSFLF--SGTGGGVLHGSTCESLVCTLAAAR  178 (214)
Q Consensus       101 ~~~~~~~~~~~d~l~~~~n~n~~~~~~sp~~~~iE~~vi~wl~~l~G~p~~~~~--~~~~~G~~tsGGt~aNl~Al~aAR  178 (214)
                      ++++++++++||++++++|+|+..|+.||++++||++|++||++++|+|+++..  .+.++|++|+|||+||++||++||
T Consensus        81 ~~~~~~~~~l~~~~~~~~n~n~~~~~~sp~~t~iE~~v~~wl~~l~g~p~~~~~~~~~~~~G~~~~Ggs~anl~al~~AR  160 (476)
T d1js3a_          81 PTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAAR  160 (476)
T ss_dssp             CCCCCHHHHHHHHHHHHHCCCCSSGGGCHHHHHHHHHHHHHHHHHTTCCGGGCCTTTCSCEEEEESCHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHhhcccccchhhhhhHHHHHHHHHHHHHHHhCCCcccccCCCCCCCceECCcHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999987643  346899999999999999999999


Q ss_pred             HHHHHHhC---CCCC---CCCceEEEEeCCCchHHHHHhhcC
Q 036996          179 DKALEKLG---GGFD---NITKLAVYASDQTHFALQKSAKLI  214 (214)
Q Consensus       179 ~~~~~~~~---~g~~---~~~~~~i~~s~~aH~Si~KAa~ll  214 (214)
                      ++.+++.+   .|+.   ..+++++|+|+++|||+.|||+++
T Consensus       161 ~~~~~~~~~~~~g~~~~~~~~~~vv~~s~~~H~Si~ka~~~l  202 (476)
T d1js3a_         161 TKVVRRLQAASPGLTQGAVLEKLVAYASDQAHSSVERAGLIG  202 (476)
T ss_dssp             HHHHHHHHHHSTTCCHHHHHHHEEEEEETTCCHHHHHHHHHH
T ss_pred             HHHHHhhcccccCcccccccCceEEEecccccHHHHHHHHhc
Confidence            99876532   2332   135899999999999999999864
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure