Citrus Sinensis ID: 037159


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MTSQGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSLAF
cccccccccccccccHHHHHHHHccccHHHHHHHHcHHcHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHcccccEEEEccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccccccccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHccccccEEEcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccHHHccHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHcccHHHEEEccHHHHHcccccccccccHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHcHcccEEEEEcccccHHHHHHHHccccccEEEEccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccHHHHHHHccHHHccc
mtsqgsnsrnwqNMHYDILVKIFMALRVTDLIFAVSKVCSswraasrdpvlWETLDLNVLLCNafdilpsnsnglsdghsSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVyaatrfpmvkhlalppcneitvdGFRSAIQWWKGLESltvpfisnASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEalnishcllgqipqfpgpllaIEQLDNFILGKASRLREFFTCqvqscsicqfeydddnifgwyeydkglwrddeirslaf
mtsqgsnsrnwqNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEydkglwrdDEIRSLAF
MTSQGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSLAF
**********WQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDD*******
************NMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSLA*
*********NWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSLAF
********RNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSLAF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSQGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSLAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q9M2Z5309 F-box/LRR-repeat protein yes no 0.960 0.954 0.377 9e-52
Q9T0C6333 Putative F-box protein At no no 0.967 0.891 0.270 2e-21
Q9S9V9449 Putative F-box/LRR-repeat no no 0.671 0.458 0.246 2e-10
Q9S9V8246 Putative F-box/LRR-repeat no no 0.677 0.845 0.219 7e-10
Q9M0U9302 F-box protein SKIP19 OS=A no no 0.644 0.655 0.238 2e-09
Q9M0U7309 Putative F-box protein At no no 0.664 0.660 0.234 4e-07
Q9M0U8304 Putative F-box/LRR-repeat no no 0.664 0.671 0.237 5e-05
Q96IG2436 F-box/LRR-repeat protein no no 0.472 0.332 0.264 0.0001
Q58DG6436 F-box/LRR-repeat protein yes no 0.472 0.332 0.264 0.0001
Q9CZV8436 F-box/LRR-repeat protein yes no 0.472 0.332 0.264 0.0001
>sp|Q9M2Z5|FBL53_ARATH F-box/LRR-repeat protein At3g48880 OS=Arabidopsis thaliana GN=At3g48880 PE=2 SV=1 Back     alignment and function desciption
 Score =  204 bits (518), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/299 (37%), Positives = 174/299 (58%), Gaps = 4/299 (1%)

Query: 9   RNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDIL 68
           R W+ +  DILV+IF    V +L   ++ VC  WRAA  DP+LW+T+DL+ +  ++F  +
Sbjct: 11  RRWEELDTDILVRIFQKFSVFELTSGLAHVCRGWRAACCDPILWKTVDLSNMR-SSFIKI 69

Query: 69  PSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKH 128
           P       +  S       IL  +  LS  + + LIF+++++L D+ L Y A R P ++ 
Sbjct: 70  PLEPYVYVERRSD-EALTRILKLSMNLSGGSTRTLIFHFNLFLSDDQLTYTAERCPGLRR 128

Query: 129 LALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFDL 188
           + LP  N I   G   AI+ WK LESLT+P I+N   ++  I  NCKNF  LK+M  F++
Sbjct: 129 VVLPAWNRIKKTGICKAIRIWKDLESLTMPSIANPPYLLTEIAKNCKNFKELKIMGPFEV 188

Query: 189 DFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQF-PGPLL 247
            FA +L   +P +K LS+R S + + AL  IL  + SLE LNISH  L +   + P   +
Sbjct: 189 FFANTLITCLPNIKTLSIRCSAIKREALMKILDGLPSLEVLNISHSHLVEYSGWQPQQKV 248

Query: 248 AIEQLDNFILGKASRLREFFTC-QVQSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSL 305
            + +LD  I+ K +RL++F TC   ++C +CQ   +D+ I  WY+Y++G W+ DE+ SL
Sbjct: 249 IVRELDKTIMEKTARLKKFLTCMDHKTCVMCQRTENDEGIVRWYKYEEGDWKVDEVSSL 307





Arabidopsis thaliana (taxid: 3702)
>sp|Q9T0C6|FB230_ARATH Putative F-box protein At4g11580 OS=Arabidopsis thaliana GN=At4g11580 PE=4 SV=1 Back     alignment and function description
>sp|Q9S9V9|FBL23_ARATH Putative F-box/LRR-repeat protein 23 OS=Arabidopsis thaliana GN=FBL23 PE=4 SV=1 Back     alignment and function description
>sp|Q9S9V8|FBL9_ARATH Putative F-box/LRR-repeat protein 9 OS=Arabidopsis thaliana GN=FBL9 PE=4 SV=1 Back     alignment and function description
>sp|Q9M0U9|SKI19_ARATH F-box protein SKIP19 OS=Arabidopsis thaliana GN=SKIP19 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0U7|FB221_ARATH Putative F-box protein At4g05475 OS=Arabidopsis thaliana GN=At4g05475 PE=4 SV=2 Back     alignment and function description
>sp|Q9M0U8|FBL21_ARATH Putative F-box/LRR-repeat protein 21 OS=Arabidopsis thaliana GN=FBL21 PE=4 SV=1 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
255539483316 conserved hypothetical protein [Ricinus 0.993 0.965 0.452 7e-67
356575953305 PREDICTED: F-box/LRR-repeat protein At3g 0.993 1.0 0.436 4e-62
356535883304 PREDICTED: F-box/LRR-repeat protein At3g 0.967 0.976 0.444 4e-62
224122416291 predicted protein [Populus trichocarpa] 0.947 1.0 0.452 8e-62
224134733291 predicted protein [Populus trichocarpa] 0.947 1.0 0.438 2e-60
388512841305 unknown [Medicago truncatula] 0.993 1.0 0.423 3e-59
217074224305 unknown [Medicago truncatula] 0.993 1.0 0.416 3e-58
357140792401 PREDICTED: F-box/LRR-repeat protein At3g 0.957 0.733 0.442 1e-57
255537381315 conserved hypothetical protein [Ricinus 0.954 0.930 0.471 4e-57
226505430348 uncharacterized protein LOC100273810 [Ze 0.957 0.844 0.432 4e-57
>gi|255539483|ref|XP_002510806.1| conserved hypothetical protein [Ricinus communis] gi|223549921|gb|EEF51408.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 192/307 (62%), Gaps = 2/307 (0%)

Query: 1   MTSQGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVL 60
           M    S  R W+++  DILVKIF +  +  L   ++ VCSSWR A  DP+LW+TLDL++L
Sbjct: 12  MEEGDSLVRRWEDLDTDILVKIFQSFDIFQLTSGIAHVCSSWRLACCDPLLWKTLDLSML 71

Query: 61  LCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAA 120
             N F  +P       DG S       +L  +  LS   +  LIF++++Y+ DE L Y A
Sbjct: 72  KSN-FIKIPLEPYVYVDGRSD-KTLTRVLKISLNLSQGNITSLIFHFNLYVSDEQLTYTA 129

Query: 121 TRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSML 180
            R P ++ L LP  N I   G   AI+ W+ LESLT+P I+N   +I+ I  NC+NFS L
Sbjct: 130 ERCPRLRRLVLPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLIEEIANNCRNFSEL 189

Query: 181 KVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIP 240
           K+M  F++ FA +L   +P+L+VLSLR S++ K+AL LIL  + SLE LNISHCLL ++P
Sbjct: 190 KIMGPFEIFFASTLAAYLPKLRVLSLRCSMLIKDALILILDSLQSLEVLNISHCLLIEVP 249

Query: 241 QFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDD 300
             P P   I +LD+ IL KASRLREF TC  +SC +CQ    D+ +  WY+Y++GLW+ D
Sbjct: 250 APPAPKRIIRELDHTILEKASRLREFLTCMDESCIMCQRTKSDEGLMRWYKYEEGLWKTD 309

Query: 301 EIRSLAF 307
           E+RSLA 
Sbjct: 310 EVRSLAL 316




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356575953|ref|XP_003556100.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Glycine max] Back     alignment and taxonomy information
>gi|356535883|ref|XP_003536472.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Glycine max] Back     alignment and taxonomy information
>gi|224122416|ref|XP_002318828.1| predicted protein [Populus trichocarpa] gi|222859501|gb|EEE97048.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134733|ref|XP_002321893.1| predicted protein [Populus trichocarpa] gi|222868889|gb|EEF06020.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388512841|gb|AFK44482.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074224|gb|ACJ85472.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357140792|ref|XP_003571947.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|255537381|ref|XP_002509757.1| conserved hypothetical protein [Ricinus communis] gi|223549656|gb|EEF51144.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|226505430|ref|NP_001141683.1| uncharacterized protein LOC100273810 [Zea mays] gi|194705538|gb|ACF86853.1| unknown [Zea mays] gi|414870842|tpg|DAA49399.1| TPA: hypothetical protein ZEAMMB73_662744 [Zea mays] gi|414870843|tpg|DAA49400.1| TPA: hypothetical protein ZEAMMB73_662744 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
TAIR|locus:2099443309 AT3G48880 "AT3G48880" [Arabido 0.957 0.951 0.38 5.8e-50
TAIR|locus:2139697333 AT4G11580 [Arabidopsis thalian 0.697 0.642 0.292 5.9e-29
TAIR|locus:2115979307 AT4G05490 "AT4G05490" [Arabido 0.166 0.166 0.352 4.6e-07
TAIR|locus:1005716270246 AT4G05497 "AT4G05497" [Arabido 0.693 0.865 0.219 6.4e-07
TAIR|locus:2174398300 SKIP1 "SKP1 interacting partne 0.547 0.56 0.262 0.00024
UNIPROTKB|Q58DG6436 FBXL20 "F-box/LRR-repeat prote 0.631 0.444 0.263 0.00028
UNIPROTKB|Q96IG2436 FBXL20 "F-box/LRR-repeat prote 0.631 0.444 0.263 0.00028
MGI|MGI:1919444436 Fbxl20 "F-box and leucine-rich 0.631 0.444 0.263 0.00028
TAIR|locus:2140715220 AT4G03630 "AT4G03630" [Arabido 0.394 0.55 0.284 0.00093
TAIR|locus:2099443 AT3G48880 "AT3G48880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 520 (188.1 bits), Expect = 5.8e-50, P = 5.8e-50
 Identities = 114/300 (38%), Positives = 176/300 (58%)

Query:     9 RNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDIL 68
             R W+ +  DILV+IF    V +L   ++ VC  WRAA  DP+LW+T+DL+ +  ++F  +
Sbjct:    11 RRWEELDTDILVRIFQKFSVFELTSGLAHVCRGWRAACCDPILWKTVDLSNMR-SSFIKI 69

Query:    69 PSNSNGLSDGHSSWLNAM-HILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVK 127
             P       +  S    A+  IL  +  LS  + + LIF+++++L D+ L Y A R P ++
Sbjct:    70 PLEPYVYVERRSD--EALTRILKLSMNLSGGSTRTLIFHFNLFLSDDQLTYTAERCPGLR 127

Query:   128 HLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFD 187
              + LP  N I   G   AI+ WK LESLT+P I+N   ++  I  NCKNF  LK+M  F+
Sbjct:   128 RVVLPAWNRIKKTGICKAIRIWKDLESLTMPSIANPPYLLTEIAKNCKNFKELKIMGPFE 187

Query:   188 LDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQF-PGPL 246
             + FA +L   +P +K LS+R S + + AL  IL  + SLE LNISH  L +   + P   
Sbjct:   188 VFFANTLITCLPNIKTLSIRCSAIKREALMKILDGLPSLEVLNISHSHLVEYSGWQPQQK 247

Query:   247 LAIEQLDNFILGKASRLREFFTCQV-QSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSL 305
             + + +LD  I+ K +RL++F TC   ++C +CQ   +D+ I  WY+Y++G W+ DE+ SL
Sbjct:   248 VIVRELDKTIMEKTARLKKFLTCMDHKTCVMCQRTENDEGIVRWYKYEEGDWKVDEVSSL 307




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2139697 AT4G11580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115979 AT4G05490 "AT4G05490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2140715 AT4G03630 "AT4G03630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2Z5FBL53_ARATHNo assigned EC number0.37790.96090.9546yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XII001171
hypothetical protein (291 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
pfam1293747 pfam12937, F-box-like, F-box-like 4e-06
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
 Score = 42.5 bits (101), Expect = 4e-06
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 17 DILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLN 58
          +IL++IF  L   DL+  ++ VC  WR  + D  LW  L L 
Sbjct: 7  EILLQIFSYLDPRDLL-RLALVCRRWRELASDDSLWRRLCLR 47


This is an F-box-like family. Length = 47

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.95
KOG4341 483 consensus F-box protein containing LRR [General fu 99.91
KOG4341483 consensus F-box protein containing LRR [General fu 99.66
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.45
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.29
KOG1947 482 consensus Leucine rich repeat proteins, some prote 99.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.09
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.98
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.86
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.83
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.76
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.36
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.16
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.88
KOG2997366 consensus F-box protein FBX9 [General function pre 97.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.71
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.71
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.63
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.58
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.45
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.41
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.37
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.26
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 97.23
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 97.16
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.13
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.85
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.77
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.72
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.62
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.59
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.33
PLN03150623 hypothetical protein; Provisional 96.26
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.88
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.6
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.41
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 95.35
PLN03150623 hypothetical protein; Provisional 94.8
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 94.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.69
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 94.63
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.21
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 93.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 92.92
KOG4237498 consensus Extracellular matrix protein slit, conta 92.09
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 92.02
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 92.01
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 91.79
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 91.29
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 91.14
PF13013109 F-box-like_2: F-box-like domain 91.02
KOG4308 478 consensus LRR-containing protein [Function unknown 91.01
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 90.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 90.67
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 90.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 89.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 88.33
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.26
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 88.23
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 87.89
KOG4308 478 consensus LRR-containing protein [Function unknown 87.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 87.49
PRK15386 426 type III secretion protein GogB; Provisional 86.12
KOG0617264 consensus Ras suppressor protein (contains leucine 85.76
KOG0617264 consensus Ras suppressor protein (contains leucine 84.38
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 84.31
KOG0472565 consensus Leucine-rich repeat protein [Function un 84.27
PF0937297 PRANC: PRANC domain; InterPro: IPR018272 This pres 84.17
KOG2502355 consensus Tub family proteins [General function pr 81.41
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 80.65
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=6.6e-28  Score=202.12  Aligned_cols=231  Identities=19%  Similarity=0.244  Sum_probs=172.2

Q ss_pred             CCCCCCCCCCCCHHHHHHHHhcCChHHHhhHHhhhhHHHHHhcCCCCcceeeecCccc--cc--------------cccc
Q 037159            4 QGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLL--CN--------------AFDI   67 (307)
Q Consensus         4 ~~~~~~~w~~LP~eiL~~If~~L~~~d~~~~~s~VCk~Wr~~~~~p~lw~~i~l~~~~--~~--------------~~~~   67 (307)
                      ...++.+|+.|||||+..||+.|..+++++ ++.|||+|++++++.++|...|+..-.  +.              ....
T Consensus        91 ~~npgv~~~slpDEill~IFs~L~kk~LL~-~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p~~l~~l~~rgV~v~Rlar~  169 (419)
T KOG2120|consen   91 ENNPGVSWDSLPDEILLGIFSCLCKKELLK-VSGVCKRFYRLASDESLWQTLDLTGRNIHPDVLGRLLSRGVIVFRLARS  169 (419)
T ss_pred             ccCCCCCcccCCHHHHHHHHHhccHHHHHH-HHHHHHHHhhccccccceeeeccCCCccChhHHHHHHhCCeEEEEcchh
Confidence            344667799999999999999999999999 999999999999999999999976431  00              0000


Q ss_pred             cCCCCC-c--cccCC--CCHHHHH-----HHHHHHHHhcCCCccEEEeccCCCCCHHHHHHHHhhCCCccEEecCCCCCC
Q 037159           68 LPSNSN-G--LSDGH--SSWLNAM-----HILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEI  137 (307)
Q Consensus        68 ~~~~~~-~--~~~~~--~~~~~l~-----~~l~~~~~~s~~~l~~L~l~~~~~~~d~~l~~i~~~~~~L~~L~L~~~~~~  137 (307)
                      ..+.+. +  +.+-+  ....++.     .---..+-..|..++.+.+++ ..++|.....||++ .+|+.|+|++|.++
T Consensus       170 ~~~~prlae~~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg-~~LdD~I~~~iAkN-~~L~~lnlsm~sG~  247 (419)
T KOG2120|consen  170 FMDQPRLAEHFSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEG-LRLDDPIVNTIAKN-SNLVRLNLSMCSGF  247 (419)
T ss_pred             hhcCchhhhhhhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccc-cccCcHHHHHHhcc-ccceeecccccccc
Confidence            001110 0  00000  0000000     000011223466778887776 56688888888875 89999999999999


Q ss_pred             CHHHHHHHHhcCCCCCeEEecCCCCCHHHHHHHH-hcCCCCceEEeecc---CCHHHHHHHHhcCCCCCEEEecCCC-CC
Q 037159          138 TVDGFRSAIQWWKGLESLTVPFISNASSIIQVIG-ANCKNFSMLKVMFS---FDLDFAMSLFMSIPELKVLSLRSSI-VD  212 (307)
Q Consensus       138 ~~~~l~~~~~~~~~L~~L~L~~~~~~~~~l~~i~-~~c~~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it  212 (307)
                      +..++..++..|..|.+|+|++|..+.+.+..+. .-.++|+.|+++|+   +.+..+..++..||+|.+|+|+.|. ++
T Consensus       248 t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~  327 (419)
T KOG2120|consen  248 TENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLK  327 (419)
T ss_pred             chhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccccC
Confidence            9999999999999999999999987555454443 34589999999987   5567788888999999999999998 88


Q ss_pred             HHHHHHHHHcCCCCcEEeccCCcCCC
Q 037159          213 KNALNLILTLMGSLEALNISHCLLGQ  238 (307)
Q Consensus       213 ~~~l~~l~~~~~~L~~L~l~~C~~i~  238 (307)
                      + +....+..++.|++|.++.|+.+.
T Consensus       328 ~-~~~~~~~kf~~L~~lSlsRCY~i~  352 (419)
T KOG2120|consen  328 N-DCFQEFFKFNYLQHLSLSRCYDII  352 (419)
T ss_pred             c-hHHHHHHhcchheeeehhhhcCCC
Confidence            8 555666779999999999999886



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins Back     alignment and domain information
>KOG2502 consensus Tub family proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 1e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 64.5 bits (157), Expect = 5e-12
 Identities = 41/233 (17%), Positives = 89/233 (38%), Gaps = 16/233 (6%)

Query: 10  NWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILP 69
           +W ++  ++L+ IF  L + +L+  VS VC  W   + D  LW+TLDL     N    + 
Sbjct: 8   SWDSLPDELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLWQTLDLT--GKNLHPDVT 64

Query: 70  SNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHL 129
                          +      A   S   V+ +  + S+ ++   L    ++   +++L
Sbjct: 65  GRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSV-IEVSTLHGILSQCSKLQNL 123

Query: 130 ALPPCNEITVDGFRSAIQWWKGLESLT---VPFISNASSIIQVIGANCKNFSMLKVMFSF 186
           +L     ++       +     L  L        S  +  +Q + ++C     L + + F
Sbjct: 124 SLEGLR-LSDPIVN-TLAKNSNLVRLNLSGCSGFSEFA--LQTLLSSCSRLDELNLSWCF 179

Query: 187 DLD---FAMSLFMSIPELKVLSLR--SSIVDKNALNLILTLMGSLEALNISHC 234
           D       +++      +  L+L      + K+ L+ ++    +L  L++S  
Sbjct: 180 DFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS 232


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.94
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.93
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.9
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.89
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.84
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.68
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.61
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.56
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.53
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.5
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.38
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.2
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.16
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.15
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.14
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.12
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.11
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.1
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.09
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.06
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.02
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.99
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.98
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.96
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.95
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.94
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.89
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.88
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.8
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.78
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.76
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.76
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.76
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.73
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.71
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.7
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.7
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.69
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.68
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.68
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.66
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.65
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.65
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.64
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.64
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.62
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.61
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.61
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.6
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.59
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.56
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.53
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.51
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.51
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.49
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.46
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.46
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.46
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.46
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.45
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.41
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.4
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.33
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.21
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.04
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.01
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.95
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.92
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.72
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.7
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.42
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.4
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.3
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.51
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.93
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.58
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 92.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 85.31
4fdw_A401 Leucine rich hypothetical protein; putative cell s 85.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 80.85
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.94  E-value=8.4e-26  Score=201.25  Aligned_cols=225  Identities=20%  Similarity=0.284  Sum_probs=122.6

Q ss_pred             CCCCCCCCCHHHHHHHHhcCChHHHhhHHhhhhHHHHHhcCCCCcceeeecCccc--cc----c--ccc--cCCC-----
Q 037159            7 NSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLL--CN----A--FDI--LPSN-----   71 (307)
Q Consensus         7 ~~~~w~~LP~eiL~~If~~L~~~d~~~~~s~VCk~Wr~~~~~p~lw~~i~l~~~~--~~----~--~~~--~~~~-----   71 (307)
                      +.+.|++||+|++.+||+||+..|+.+ +++|||+|+.++.+|.+|+.++++...  +.    +  ...  +...     
T Consensus         5 ~~~~~~~LP~eil~~If~~L~~~d~~~-~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~   83 (336)
T 2ast_B            5 PGVSWDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMD   83 (336)
T ss_dssp             --CCSSSSCHHHHHHHHTTSCHHHHHH-TTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEEC
T ss_pred             ccCChhhCCHHHHHHHHHhCCHHHHHH-HHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCcccc
Confidence            467899999999999999999999998 999999999999999999999987641  00    0  000  0000     


Q ss_pred             ---CCccc-c-----CCCCHHHHHHH-HHHHHHhcCCCccEEEeccCCCCCHHHHHHHHhhCCCccEEecCCCCCCCHHH
Q 037159           72 ---SNGLS-D-----GHSSWLNAMHI-LNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDG  141 (307)
Q Consensus        72 ---~~~~~-~-----~~~~~~~l~~~-l~~~~~~s~~~l~~L~l~~~~~~~d~~l~~i~~~~~~L~~L~L~~~~~~~~~~  141 (307)
                         +..+. .     +.... .+... +.. .-..+.++++|+++.+ .+++.....++. +++|++|+|++|..+++.+
T Consensus        84 ~~~~~~~~~~~L~~L~L~~~-~l~~~~~~~-~~~~~~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~L~~~~~l~~~~  159 (336)
T 2ast_B           84 QPLAEHFSPFRVQHMDLSNS-VIEVSTLHG-ILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFA  159 (336)
T ss_dssp             SCCCSCCCCBCCCEEECTTC-EECHHHHHH-HHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHH
T ss_pred             ccchhhccCCCCCEEEccCC-CcCHHHHHH-HHhhCCCCCEEeCcCc-ccCHHHHHHHhc-CCCCCEEECCCCCCCCHHH
Confidence               00000 0     00000 00000 111 1122345555555543 244444444433 5555555555554455555


Q ss_pred             HHHHHhcCCCCCeEEecCC-CCCHHHHHHHHhcCC-CCceEEeecc---CCHHHHHHHHhcCCCCCEEEecCCC-CCHHH
Q 037159          142 FRSAIQWWKGLESLTVPFI-SNASSIIQVIGANCK-NFSMLKVMFS---FDLDFAMSLFMSIPELKVLSLRSSI-VDKNA  215 (307)
Q Consensus       142 l~~~~~~~~~L~~L~L~~~-~~~~~~l~~i~~~c~-~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it~~~  215 (307)
                      +..++..+++|++|++++| .+++..+..+...++ +|++|+++++   +++..+......+|+|++|++++|. +++.+
T Consensus       160 l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~  239 (336)
T 2ast_B          160 LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDC  239 (336)
T ss_dssp             HHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGG
T ss_pred             HHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHH
Confidence            5555555555555555555 455554444445555 5555555543   3334444444455555555555555 55544


Q ss_pred             HHHHHHcCCCCcEEeccCCcCC
Q 037159          216 LNLILTLMGSLEALNISHCLLG  237 (307)
Q Consensus       216 l~~l~~~~~~L~~L~l~~C~~i  237 (307)
                      +..+ ..+++|++|++++|..+
T Consensus       240 ~~~l-~~l~~L~~L~l~~~~~~  260 (336)
T 2ast_B          240 FQEF-FQLNYLQHLSLSRCYDI  260 (336)
T ss_dssp             GGGG-GGCTTCCEEECTTCTTC
T ss_pred             HHHH-hCCCCCCEeeCCCCCCC
Confidence            4432 34555555555555533



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 307
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 4e-05
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 7e-04
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.7 bits (88), Expect = 4e-05
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 11 WQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLW 52
          W ++  ++L+ IF  L + +L+  VS VC  W   + D  LW
Sbjct: 1  WDSLPDELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLW 41


>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.76
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.71
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.07
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.06
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 99.03
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.02
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.93
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.91
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.88
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.81
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.14
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.08
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.95
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.46
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.37
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.32
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 96.63
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.41
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 96.26
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.15
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.22
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 94.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 92.16
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 89.95
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 88.39
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=1.6e-18  Score=148.88  Aligned_cols=142  Identities=15%  Similarity=0.205  Sum_probs=98.0

Q ss_pred             hcCCCccEEEeccCCCCCHHHHHHHHhhCCCccEEecCCCCCCCHHHHHHHHhcCCCCCeEEecCCC-CCHHHHH-HHHh
Q 037159           95 LSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFIS-NASSIIQ-VIGA  172 (307)
Q Consensus        95 ~s~~~l~~L~l~~~~~~~d~~l~~i~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-~~~~~l~-~i~~  172 (307)
                      ..+.++++|.+.++ .+++..+..++. +++|++|++++|..+++.++..++..||+|++|++++|. +++..+. .+..
T Consensus        68 ~~c~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~  145 (284)
T d2astb2          68 SQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH  145 (284)
T ss_dssp             TTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHH
T ss_pred             HhCCCccccccccc-CCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcc
Confidence            34567777777665 466766666653 677777777777777777777777777777777777764 4565554 3445


Q ss_pred             cCCCCceEEeecc---CCHHHHHHHHhcCCCCCEEEecCCC-CCHHHHHHHHHcCCCCcEEeccCCcCCCc
Q 037159          173 NCKNFSMLKVMFS---FDLDFAMSLFMSIPELKVLSLRSSI-VDKNALNLILTLMGSLEALNISHCLLGQI  239 (307)
Q Consensus       173 ~c~~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it~~~l~~l~~~~~~L~~L~l~~C~~i~~  239 (307)
                      .|++|+.|+++++   +++..+..++..+|+|++|++++|. ++++++..+. .||+|++|++++|..++.
T Consensus       146 ~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L~~L~L~~C~~i~~  215 (284)
T d2astb2         146 VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIP  215 (284)
T ss_dssp             SCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTCTTCCG
T ss_pred             cccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcCCEEECCCCCCCCh
Confidence            5677777777654   5666677776677777777777765 7777665543 477777777777777764



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure