Citrus Sinensis ID: 037159
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| 255539483 | 316 | conserved hypothetical protein [Ricinus | 0.993 | 0.965 | 0.452 | 7e-67 | |
| 356575953 | 305 | PREDICTED: F-box/LRR-repeat protein At3g | 0.993 | 1.0 | 0.436 | 4e-62 | |
| 356535883 | 304 | PREDICTED: F-box/LRR-repeat protein At3g | 0.967 | 0.976 | 0.444 | 4e-62 | |
| 224122416 | 291 | predicted protein [Populus trichocarpa] | 0.947 | 1.0 | 0.452 | 8e-62 | |
| 224134733 | 291 | predicted protein [Populus trichocarpa] | 0.947 | 1.0 | 0.438 | 2e-60 | |
| 388512841 | 305 | unknown [Medicago truncatula] | 0.993 | 1.0 | 0.423 | 3e-59 | |
| 217074224 | 305 | unknown [Medicago truncatula] | 0.993 | 1.0 | 0.416 | 3e-58 | |
| 357140792 | 401 | PREDICTED: F-box/LRR-repeat protein At3g | 0.957 | 0.733 | 0.442 | 1e-57 | |
| 255537381 | 315 | conserved hypothetical protein [Ricinus | 0.954 | 0.930 | 0.471 | 4e-57 | |
| 226505430 | 348 | uncharacterized protein LOC100273810 [Ze | 0.957 | 0.844 | 0.432 | 4e-57 |
| >gi|255539483|ref|XP_002510806.1| conserved hypothetical protein [Ricinus communis] gi|223549921|gb|EEF51408.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 260 bits (664), Expect = 7e-67, Method: Compositional matrix adjust.
Identities = 139/307 (45%), Positives = 192/307 (62%), Gaps = 2/307 (0%)
Query: 1 MTSQGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVL 60
M S R W+++ DILVKIF + + L ++ VCSSWR A DP+LW+TLDL++L
Sbjct: 12 MEEGDSLVRRWEDLDTDILVKIFQSFDIFQLTSGIAHVCSSWRLACCDPLLWKTLDLSML 71
Query: 61 LCNAFDILPSNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAA 120
N F +P DG S +L + LS + LIF++++Y+ DE L Y A
Sbjct: 72 KSN-FIKIPLEPYVYVDGRSD-KTLTRVLKISLNLSQGNITSLIFHFNLYVSDEQLTYTA 129
Query: 121 TRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSML 180
R P ++ L LP N I G AI+ W+ LESLT+P I+N +I+ I NC+NFS L
Sbjct: 130 ERCPRLRRLVLPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLIEEIANNCRNFSEL 189
Query: 181 KVMFSFDLDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIP 240
K+M F++ FA +L +P+L+VLSLR S++ K+AL LIL + SLE LNISHCLL ++P
Sbjct: 190 KIMGPFEIFFASTLAAYLPKLRVLSLRCSMLIKDALILILDSLQSLEVLNISHCLLIEVP 249
Query: 241 QFPGPLLAIEQLDNFILGKASRLREFFTCQVQSCSICQFEYDDDNIFGWYEYDKGLWRDD 300
P P I +LD+ IL KASRLREF TC +SC +CQ D+ + WY+Y++GLW+ D
Sbjct: 250 APPAPKRIIRELDHTILEKASRLREFLTCMDESCIMCQRTKSDEGLMRWYKYEEGLWKTD 309
Query: 301 EIRSLAF 307
E+RSLA
Sbjct: 310 EVRSLAL 316
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356575953|ref|XP_003556100.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356535883|ref|XP_003536472.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224122416|ref|XP_002318828.1| predicted protein [Populus trichocarpa] gi|222859501|gb|EEE97048.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224134733|ref|XP_002321893.1| predicted protein [Populus trichocarpa] gi|222868889|gb|EEF06020.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388512841|gb|AFK44482.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074224|gb|ACJ85472.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357140792|ref|XP_003571947.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|255537381|ref|XP_002509757.1| conserved hypothetical protein [Ricinus communis] gi|223549656|gb|EEF51144.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|226505430|ref|NP_001141683.1| uncharacterized protein LOC100273810 [Zea mays] gi|194705538|gb|ACF86853.1| unknown [Zea mays] gi|414870842|tpg|DAA49399.1| TPA: hypothetical protein ZEAMMB73_662744 [Zea mays] gi|414870843|tpg|DAA49400.1| TPA: hypothetical protein ZEAMMB73_662744 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| TAIR|locus:2099443 | 309 | AT3G48880 "AT3G48880" [Arabido | 0.957 | 0.951 | 0.38 | 5.8e-50 | |
| TAIR|locus:2139697 | 333 | AT4G11580 [Arabidopsis thalian | 0.697 | 0.642 | 0.292 | 5.9e-29 | |
| TAIR|locus:2115979 | 307 | AT4G05490 "AT4G05490" [Arabido | 0.166 | 0.166 | 0.352 | 4.6e-07 | |
| TAIR|locus:1005716270 | 246 | AT4G05497 "AT4G05497" [Arabido | 0.693 | 0.865 | 0.219 | 6.4e-07 | |
| TAIR|locus:2174398 | 300 | SKIP1 "SKP1 interacting partne | 0.547 | 0.56 | 0.262 | 0.00024 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.631 | 0.444 | 0.263 | 0.00028 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.631 | 0.444 | 0.263 | 0.00028 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.631 | 0.444 | 0.263 | 0.00028 | |
| TAIR|locus:2140715 | 220 | AT4G03630 "AT4G03630" [Arabido | 0.394 | 0.55 | 0.284 | 0.00093 |
| TAIR|locus:2099443 AT3G48880 "AT3G48880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 520 (188.1 bits), Expect = 5.8e-50, P = 5.8e-50
Identities = 114/300 (38%), Positives = 176/300 (58%)
Query: 9 RNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDIL 68
R W+ + DILV+IF V +L ++ VC WRAA DP+LW+T+DL+ + ++F +
Sbjct: 11 RRWEELDTDILVRIFQKFSVFELTSGLAHVCRGWRAACCDPILWKTVDLSNMR-SSFIKI 69
Query: 69 PSNSNGLSDGHSSWLNAM-HILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVK 127
P + S A+ IL + LS + + LIF+++++L D+ L Y A R P ++
Sbjct: 70 PLEPYVYVERRSD--EALTRILKLSMNLSGGSTRTLIFHFNLFLSDDQLTYTAERCPGLR 127
Query: 128 HLALPPCNEITVDGFRSAIQWWKGLESLTVPFISNASSIIQVIGANCKNFSMLKVMFSFD 187
+ LP N I G AI+ WK LESLT+P I+N ++ I NCKNF LK+M F+
Sbjct: 128 RVVLPAWNRIKKTGICKAIRIWKDLESLTMPSIANPPYLLTEIAKNCKNFKELKIMGPFE 187
Query: 188 LDFAMSLFMSIPELKVLSLRSSIVDKNALNLILTLMGSLEALNISHCLLGQIPQF-PGPL 246
+ FA +L +P +K LS+R S + + AL IL + SLE LNISH L + + P
Sbjct: 188 VFFANTLITCLPNIKTLSIRCSAIKREALMKILDGLPSLEVLNISHSHLVEYSGWQPQQK 247
Query: 247 LAIEQLDNFILGKASRLREFFTCQV-QSCSICQFEYDDDNIFGWYEYDKGLWRDDEIRSL 305
+ + +LD I+ K +RL++F TC ++C +CQ +D+ I WY+Y++G W+ DE+ SL
Sbjct: 248 VIVRELDKTIMEKTARLKKFLTCMDHKTCVMCQRTENDEGIVRWYKYEEGDWKVDEVSSL 307
|
|
| TAIR|locus:2139697 AT4G11580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115979 AT4G05490 "AT4G05490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140715 AT4G03630 "AT4G03630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_XII001171 | hypothetical protein (291 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 307 | |||
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 4e-06 |
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Score = 42.5 bits (101), Expect = 4e-06
Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
Query: 17 DILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLN 58
+IL++IF L DL+ ++ VC WR + D LW L L
Sbjct: 7 EILLQIFSYLDPRDLL-RLALVCRRWRELASDDSLWRRLCLR 47
|
This is an F-box-like family. Length = 47 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.95 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.91 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.66 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.45 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.29 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.28 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.16 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.09 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.98 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.86 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.83 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.76 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.54 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.49 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.36 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.34 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.27 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.17 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.16 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.88 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 97.84 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.71 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.71 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.63 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.58 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.57 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.45 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.41 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.37 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.31 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.26 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 97.23 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 97.16 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.13 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.92 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.89 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.85 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.77 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.72 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.62 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.59 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.41 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.41 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.33 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.26 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.88 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.86 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.73 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.6 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.41 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.35 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 94.8 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 94.73 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.71 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.69 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.63 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.21 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 93.43 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 92.92 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 92.09 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 92.02 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 92.01 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 91.79 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 91.29 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 91.14 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 91.02 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 91.01 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 90.82 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 90.67 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 90.65 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 89.7 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.33 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 88.26 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 88.23 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 87.89 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 87.71 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 87.49 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 86.12 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 85.76 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 84.38 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 84.31 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 84.27 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 84.17 | |
| KOG2502 | 355 | consensus Tub family proteins [General function pr | 81.41 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 80.65 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.95 E-value=6.6e-28 Score=202.12 Aligned_cols=231 Identities=19% Similarity=0.244 Sum_probs=172.2
Q ss_pred CCCCCCCCCCCCHHHHHHHHhcCChHHHhhHHhhhhHHHHHhcCCCCcceeeecCccc--cc--------------cccc
Q 037159 4 QGSNSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLL--CN--------------AFDI 67 (307)
Q Consensus 4 ~~~~~~~w~~LP~eiL~~If~~L~~~d~~~~~s~VCk~Wr~~~~~p~lw~~i~l~~~~--~~--------------~~~~ 67 (307)
...++.+|+.|||||+..||+.|..+++++ ++.|||+|++++++.++|...|+..-. +. ....
T Consensus 91 ~~npgv~~~slpDEill~IFs~L~kk~LL~-~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p~~l~~l~~rgV~v~Rlar~ 169 (419)
T KOG2120|consen 91 ENNPGVSWDSLPDEILLGIFSCLCKKELLK-VSGVCKRFYRLASDESLWQTLDLTGRNIHPDVLGRLLSRGVIVFRLARS 169 (419)
T ss_pred ccCCCCCcccCCHHHHHHHHHhccHHHHHH-HHHHHHHHhhccccccceeeeccCCCccChhHHHHHHhCCeEEEEcchh
Confidence 344667799999999999999999999999 999999999999999999999976431 00 0000
Q ss_pred cCCCCC-c--cccCC--CCHHHHH-----HHHHHHHHhcCCCccEEEeccCCCCCHHHHHHHHhhCCCccEEecCCCCCC
Q 037159 68 LPSNSN-G--LSDGH--SSWLNAM-----HILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEI 137 (307)
Q Consensus 68 ~~~~~~-~--~~~~~--~~~~~l~-----~~l~~~~~~s~~~l~~L~l~~~~~~~d~~l~~i~~~~~~L~~L~L~~~~~~ 137 (307)
..+.+. + +.+-+ ....++. .---..+-..|..++.+.+++ ..++|.....||++ .+|+.|+|++|.++
T Consensus 170 ~~~~prlae~~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg-~~LdD~I~~~iAkN-~~L~~lnlsm~sG~ 247 (419)
T KOG2120|consen 170 FMDQPRLAEHFSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEG-LRLDDPIVNTIAKN-SNLVRLNLSMCSGF 247 (419)
T ss_pred hhcCchhhhhhhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccc-cccCcHHHHHHhcc-ccceeecccccccc
Confidence 001110 0 00000 0000000 000011223466778887776 56688888888875 89999999999999
Q ss_pred CHHHHHHHHhcCCCCCeEEecCCCCCHHHHHHHH-hcCCCCceEEeecc---CCHHHHHHHHhcCCCCCEEEecCCC-CC
Q 037159 138 TVDGFRSAIQWWKGLESLTVPFISNASSIIQVIG-ANCKNFSMLKVMFS---FDLDFAMSLFMSIPELKVLSLRSSI-VD 212 (307)
Q Consensus 138 ~~~~l~~~~~~~~~L~~L~L~~~~~~~~~l~~i~-~~c~~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it 212 (307)
+..++..++..|..|.+|+|++|..+.+.+..+. .-.++|+.|+++|+ +.+..+..++..||+|.+|+|+.|. ++
T Consensus 248 t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~ 327 (419)
T KOG2120|consen 248 TENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLK 327 (419)
T ss_pred chhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccccC
Confidence 9999999999999999999999987555454443 34589999999987 5567788888999999999999998 88
Q ss_pred HHHHHHHHHcCCCCcEEeccCCcCCC
Q 037159 213 KNALNLILTLMGSLEALNISHCLLGQ 238 (307)
Q Consensus 213 ~~~l~~l~~~~~~L~~L~l~~C~~i~ 238 (307)
+ +....+..++.|++|.++.|+.+.
T Consensus 328 ~-~~~~~~~kf~~L~~lSlsRCY~i~ 352 (419)
T KOG2120|consen 328 N-DCFQEFFKFNYLQHLSLSRCYDII 352 (419)
T ss_pred c-hHHHHHHhcchheeeehhhhcCCC
Confidence 8 555666779999999999999886
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >KOG2502 consensus Tub family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 307 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 5e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-04 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-04 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 1e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 64.5 bits (157), Expect = 5e-12
Identities = 41/233 (17%), Positives = 89/233 (38%), Gaps = 16/233 (6%)
Query: 10 NWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLLCNAFDILP 69
+W ++ ++L+ IF L + +L+ VS VC W + D LW+TLDL N +
Sbjct: 8 SWDSLPDELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLWQTLDLT--GKNLHPDVT 64
Query: 70 SNSNGLSDGHSSWLNAMHILNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHL 129
+ A S V+ + + S+ ++ L ++ +++L
Sbjct: 65 GRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSV-IEVSTLHGILSQCSKLQNL 123
Query: 130 ALPPCNEITVDGFRSAIQWWKGLESLT---VPFISNASSIIQVIGANCKNFSMLKVMFSF 186
+L ++ + L L S + +Q + ++C L + + F
Sbjct: 124 SLEGLR-LSDPIVN-TLAKNSNLVRLNLSGCSGFSEFA--LQTLLSSCSRLDELNLSWCF 179
Query: 187 DLD---FAMSLFMSIPELKVLSLR--SSIVDKNALNLILTLMGSLEALNISHC 234
D +++ + L+L + K+ L+ ++ +L L++S
Sbjct: 180 DFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS 232
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.94 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.87 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.81 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.55 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.53 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.52 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.48 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.4 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.36 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.27 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.25 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.23 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.17 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.17 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.17 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.12 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.08 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.93 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.9 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.89 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.85 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.84 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.79 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.7 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.68 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.68 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.64 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.61 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.56 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.53 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.5 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.41 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.38 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.32 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.32 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.31 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.27 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.27 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.26 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.22 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.2 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.19 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.18 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.16 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.16 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.16 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.15 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.14 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.12 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.12 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.12 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.11 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.1 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.09 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.09 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.04 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.02 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.99 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.98 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.98 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.96 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.95 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.94 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.89 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.88 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.87 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.86 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.84 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.84 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.83 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.83 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.83 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.81 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.8 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.79 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.79 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.78 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.76 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.76 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.76 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.76 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.75 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.74 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.73 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.73 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.73 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.71 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.71 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.7 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.7 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.69 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.69 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.68 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.68 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.66 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.66 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.65 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.65 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.64 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.64 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.63 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.62 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.61 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.61 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.6 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.6 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.6 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.59 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.56 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.56 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.54 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.53 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.51 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.51 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.49 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.49 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.49 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.46 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.46 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.46 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.46 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.45 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.41 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.4 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.35 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.33 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.33 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.32 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.29 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.21 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.17 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.04 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.01 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.95 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.92 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.83 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.78 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.78 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.72 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.7 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.65 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.62 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.52 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.43 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.42 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.4 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.3 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.07 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.51 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.93 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.58 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 92.48 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 85.31 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 85.23 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 80.85 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.94 E-value=8.4e-26 Score=201.25 Aligned_cols=225 Identities=20% Similarity=0.284 Sum_probs=122.6
Q ss_pred CCCCCCCCCHHHHHHHHhcCChHHHhhHHhhhhHHHHHhcCCCCcceeeecCccc--cc----c--ccc--cCCC-----
Q 037159 7 NSRNWQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLWETLDLNVLL--CN----A--FDI--LPSN----- 71 (307)
Q Consensus 7 ~~~~w~~LP~eiL~~If~~L~~~d~~~~~s~VCk~Wr~~~~~p~lw~~i~l~~~~--~~----~--~~~--~~~~----- 71 (307)
+.+.|++||+|++.+||+||+..|+.+ +++|||+|+.++.+|.+|+.++++... +. + ... +...
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~-~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~ 83 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMD 83 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHH-TTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEEC
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHH-HHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCcccc
Confidence 467899999999999999999999998 999999999999999999999987641 00 0 000 0000
Q ss_pred ---CCccc-c-----CCCCHHHHHHH-HHHHHHhcCCCccEEEeccCCCCCHHHHHHHHhhCCCccEEecCCCCCCCHHH
Q 037159 72 ---SNGLS-D-----GHSSWLNAMHI-LNNASILSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDG 141 (307)
Q Consensus 72 ---~~~~~-~-----~~~~~~~l~~~-l~~~~~~s~~~l~~L~l~~~~~~~d~~l~~i~~~~~~L~~L~L~~~~~~~~~~ 141 (307)
+..+. . +.... .+... +.. .-..+.++++|+++.+ .+++.....++. +++|++|+|++|..+++.+
T Consensus 84 ~~~~~~~~~~~L~~L~L~~~-~l~~~~~~~-~~~~~~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~L~~~~~l~~~~ 159 (336)
T 2ast_B 84 QPLAEHFSPFRVQHMDLSNS-VIEVSTLHG-ILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFA 159 (336)
T ss_dssp SCCCSCCCCBCCCEEECTTC-EECHHHHHH-HHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHH
T ss_pred ccchhhccCCCCCEEEccCC-CcCHHHHHH-HHhhCCCCCEEeCcCc-ccCHHHHHHHhc-CCCCCEEECCCCCCCCHHH
Confidence 00000 0 00000 00000 111 1122345555555543 244444444433 5555555555554455555
Q ss_pred HHHHHhcCCCCCeEEecCC-CCCHHHHHHHHhcCC-CCceEEeecc---CCHHHHHHHHhcCCCCCEEEecCCC-CCHHH
Q 037159 142 FRSAIQWWKGLESLTVPFI-SNASSIIQVIGANCK-NFSMLKVMFS---FDLDFAMSLFMSIPELKVLSLRSSI-VDKNA 215 (307)
Q Consensus 142 l~~~~~~~~~L~~L~L~~~-~~~~~~l~~i~~~c~-~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it~~~ 215 (307)
+..++..+++|++|++++| .+++..+..+...++ +|++|+++++ +++..+......+|+|++|++++|. +++.+
T Consensus 160 l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~ 239 (336)
T 2ast_B 160 LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDC 239 (336)
T ss_dssp HHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGG
T ss_pred HHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHH
Confidence 5555555555555555555 455554444445555 5555555543 3334444444455555555555555 55544
Q ss_pred HHHHHHcCCCCcEEeccCCcCC
Q 037159 216 LNLILTLMGSLEALNISHCLLG 237 (307)
Q Consensus 216 l~~l~~~~~~L~~L~l~~C~~i 237 (307)
+..+ ..+++|++|++++|..+
T Consensus 240 ~~~l-~~l~~L~~L~l~~~~~~ 260 (336)
T 2ast_B 240 FQEF-FQLNYLQHLSLSRCYDI 260 (336)
T ss_dssp GGGG-GGCTTCCEEECTTCTTC
T ss_pred HHHH-hCCCCCCEeeCCCCCCC
Confidence 4432 34555555555555533
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 307 | ||||
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 4e-05 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 7e-04 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 37.7 bits (88), Expect = 4e-05
Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
Query: 11 WQNMHYDILVKIFMALRVTDLIFAVSKVCSSWRAASRDPVLW 52
W ++ ++L+ IF L + +L+ VS VC W + D LW
Sbjct: 1 WDSLPDELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLW 41
|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.76 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.71 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.09 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.07 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.06 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.03 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.02 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.93 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.91 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.88 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.81 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.65 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.63 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.55 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.39 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.23 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.14 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.08 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.07 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.95 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.84 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.77 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.75 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.7 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.63 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.46 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.44 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.39 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.37 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.32 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.76 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.73 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.67 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.63 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.49 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.41 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.26 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.15 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.1 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.22 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.43 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 92.16 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 89.95 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 88.39 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76 E-value=1.6e-18 Score=148.88 Aligned_cols=142 Identities=15% Similarity=0.205 Sum_probs=98.0
Q ss_pred hcCCCccEEEeccCCCCCHHHHHHHHhhCCCccEEecCCCCCCCHHHHHHHHhcCCCCCeEEecCCC-CCHHHHH-HHHh
Q 037159 95 LSCKTVKRLIFNYSIYLKDEHLVYAATRFPMVKHLALPPCNEITVDGFRSAIQWWKGLESLTVPFIS-NASSIIQ-VIGA 172 (307)
Q Consensus 95 ~s~~~l~~L~l~~~~~~~d~~l~~i~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-~~~~~l~-~i~~ 172 (307)
..+.++++|.+.++ .+++..+..++. +++|++|++++|..+++.++..++..||+|++|++++|. +++..+. .+..
T Consensus 68 ~~c~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~ 145 (284)
T d2astb2 68 SQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH 145 (284)
T ss_dssp TTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHH
T ss_pred HhCCCccccccccc-CCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcc
Confidence 34567777777665 466766666653 677777777777777777777777777777777777764 4565554 3445
Q ss_pred cCCCCceEEeecc---CCHHHHHHHHhcCCCCCEEEecCCC-CCHHHHHHHHHcCCCCcEEeccCCcCCCc
Q 037159 173 NCKNFSMLKVMFS---FDLDFAMSLFMSIPELKVLSLRSSI-VDKNALNLILTLMGSLEALNISHCLLGQI 239 (307)
Q Consensus 173 ~c~~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it~~~l~~l~~~~~~L~~L~l~~C~~i~~ 239 (307)
.|++|+.|+++++ +++..+..++..+|+|++|++++|. ++++++..+. .||+|++|++++|..++.
T Consensus 146 ~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L~~L~L~~C~~i~~ 215 (284)
T d2astb2 146 VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIP 215 (284)
T ss_dssp SCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTCTTCCG
T ss_pred cccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcCCEEECCCCCCCCh
Confidence 5677777777654 5666677776677777777777765 7777665543 477777777777777764
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|