Citrus Sinensis ID: 037185
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 533 | ||||||
| 224128031 | 545 | predicted protein [Populus trichocarpa] | 0.926 | 0.906 | 0.492 | 1e-127 | |
| 255559731 | 540 | Myosin heavy chain, embryonic smooth mus | 0.904 | 0.892 | 0.447 | 1e-112 | |
| 225434325 | 617 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.860 | 0.402 | 1e-102 | |
| 225448731 | 539 | PREDICTED: uncharacterized protein LOC10 | 0.898 | 0.888 | 0.446 | 1e-102 | |
| 255565935 | 628 | RAB6-interacting protein, putative [Rici | 0.968 | 0.821 | 0.408 | 1e-101 | |
| 356553178 | 623 | PREDICTED: uncharacterized protein LOC10 | 0.969 | 0.829 | 0.389 | 2e-92 | |
| 356500946 | 621 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.829 | 0.380 | 4e-91 | |
| 357491507 | 604 | Viral A-type inclusion protein repeat co | 0.969 | 0.855 | 0.383 | 1e-89 | |
| 224145419 | 613 | predicted protein [Populus trichocarpa] | 0.951 | 0.827 | 0.395 | 2e-89 | |
| 449439197 | 620 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.835 | 0.366 | 1e-84 |
| >gi|224128031|ref|XP_002329237.1| predicted protein [Populus trichocarpa] gi|222871018|gb|EEF08149.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 462 bits (1190), Expect = e-127, Method: Compositional matrix adjust.
Identities = 280/569 (49%), Positives = 374/569 (65%), Gaps = 75/569 (13%)
Query: 16 MDRSVKQMQKLIE-DGESLSKF------HRPELTAHIEDFYHLYQSLAERYDHLTGELQK 68
M+RSVKQM KLIE DG SL+K RP+L + I++F + QSLAE Y+++T EL
Sbjct: 1 MERSVKQMLKLIEEDGVSLAKKAEMCRQTRPDLISKIKEFNSMQQSLAECYEYVTTELTN 60
Query: 69 NVPSDIPLQGSGNTKSGFAQGSPLLTPDRKMGLHNTSCQATS-STSGGSSNFSLKEGAEL 127
++PS+ +QG N++SG PLLTPD+K+G H S +A S S+ G SS+ SLKEG+E
Sbjct: 61 SIPSEFDVQGVDNSESGHGHDPPLLTPDQKLGFHKASNRAPSVSSHGASSDLSLKEGSES 120
Query: 128 SSPSSSDSESEFSNSSVKIHRDAPINMDGKELTE-------------------------- 161
S SSSDSESE NSS + P+N D EL +
Sbjct: 121 FSFSSSDSESESFNSSGNAYYSLPVNTDRSELHKKIIVMGTDLSSMEEKLRMHEEENRDS 180
Query: 162 ----EANETYEELLGRVIQYEDKLRVLNLSLQLSEEEVARLKSEL-------------HS 204
E N YEELL R+I YE++LR+ + LQLSE++V RLK EL +
Sbjct: 181 MLNGEENRNYEELLSRIIGYEEELRLTKVKLQLSEDDVTRLKIELEKSVFFRDLSGTLQA 240
Query: 205 QIESAKRDVNIKEADLEMERRQVFELQNYVRELETRLSESNFEIERLMKELEGTHQLQGQ 264
Q+E A +D+ ++E DL++ER++V ELQ V E G+ +LQGQ
Sbjct: 241 QLELALKDIQMREDDLQVERKRVLELQKKVAE--------------------GSEELQGQ 280
Query: 265 LKLAQDDVTTLNAKLDYERMQVLKFQERIAKVETNLSDRNNEVAELKIALSDAEEKFTLD 324
LK+A++++T LNAKL+ E +VL QERI +++LSD ++E+ AL DA+E +++
Sbjct: 281 LKVAEEEITMLNAKLNTESRRVLDLQERITCYKSDLSDHDHEIK----ALKDAQENLSVE 336
Query: 325 KAQLQSEMFCLLEKQALLDARLKEWELQGKALEDKIRQCETEKMEITGLHEAQERGMQSE 384
KA LQSE+ L EKQ +L+ +L+EW+LQGK +EDK+RQCE EKM++ LH+AQE +Q E
Sbjct: 337 KAHLQSEILDLSEKQNMLEVKLREWDLQGKFMEDKLRQCEAEKMQMKNLHDAQEIALQGE 396
Query: 385 INQLKVEVCERDNRIEALNKIMDSLKLKYDMLMAEKDEINAKVNTLMAEARSRDNHIGQI 444
I+QLKVE+ +R +E LNK DSLK KYDMLMAEKD ++AKVNTL+A+ SRDN I Q+
Sbjct: 397 ISQLKVELIDRGEHVEVLNKKFDSLKSKYDMLMAEKDGMSAKVNTLIADVNSRDNQIRQM 456
Query: 445 EEHSRKLHMEHAELIAASESSRKLVDELRFRVKELENEVDRQRMVILDAAEEKREAIRQL 504
E H ++LH EH +LIA S+SSRKLVDELR +V ELE EVD QR+ + AEEKR AIRQL
Sbjct: 457 EGHLQQLHTEHEKLIAGSQSSRKLVDELRLKVVELEKEVDGQRVELSAVAEEKRAAIRQL 516
Query: 505 CFSLEHYRSGYQELRQAFLGYKRPAVMAA 533
CFSLEHYRSGY+ELR+AFLG+KR +VMA+
Sbjct: 517 CFSLEHYRSGYKELREAFLGHKRHSVMAS 545
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255559731|ref|XP_002520885.1| Myosin heavy chain, embryonic smooth muscle isoform, putative [Ricinus communis] gi|223540016|gb|EEF41594.1| Myosin heavy chain, embryonic smooth muscle isoform, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225434325|ref|XP_002276254.1| PREDICTED: uncharacterized protein LOC100248527 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225448731|ref|XP_002275508.1| PREDICTED: uncharacterized protein LOC100260478 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255565935|ref|XP_002523956.1| RAB6-interacting protein, putative [Ricinus communis] gi|223536803|gb|EEF38443.1| RAB6-interacting protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356553178|ref|XP_003544935.1| PREDICTED: uncharacterized protein LOC100819525 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356500946|ref|XP_003519291.1| PREDICTED: uncharacterized protein LOC100816215 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357491507|ref|XP_003616041.1| Viral A-type inclusion protein repeat containing protein expressed [Medicago truncatula] gi|355517376|gb|AES98999.1| Viral A-type inclusion protein repeat containing protein expressed [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224145419|ref|XP_002325636.1| predicted protein [Populus trichocarpa] gi|222862511|gb|EEF00018.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449439197|ref|XP_004137373.1| PREDICTED: uncharacterized protein LOC101208541 isoform 1 [Cucumis sativus] gi|449439199|ref|XP_004137374.1| PREDICTED: uncharacterized protein LOC101208541 isoform 2 [Cucumis sativus] gi|449528361|ref|XP_004171173.1| PREDICTED: uncharacterized LOC101208541 isoform 1 [Cucumis sativus] gi|449528363|ref|XP_004171174.1| PREDICTED: uncharacterized LOC101208541 isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 533 | ||||||
| TAIR|locus:2064387 | 517 | NET4B "AT2G30500" [Arabidopsis | 0.469 | 0.483 | 0.328 | 3.2e-38 | |
| TAIR|locus:2161268 | 558 | NET4A "Networked 4A" [Arabidop | 0.497 | 0.474 | 0.280 | 6.6e-38 | |
| TAIR|locus:2156794 | 432 | AT5G05180 [Arabidopsis thalian | 0.542 | 0.668 | 0.343 | 2e-31 | |
| TAIR|locus:2103187 | 319 | AT3G10880 "AT3G10880" [Arabido | 0.523 | 0.874 | 0.302 | 1.8e-21 | |
| TAIR|locus:2007569 | 1733 | NET1D "AT1G03080" [Arabidopsis | 0.123 | 0.038 | 0.479 | 5.2e-19 | |
| TAIR|locus:2014240 | 555 | AT1G64330 "AT1G64330" [Arabido | 0.590 | 0.567 | 0.227 | 7.4e-18 | |
| TAIR|locus:2130210 | 1710 | NET1B "Networked 1B" [Arabidop | 0.120 | 0.037 | 0.464 | 1.3e-15 | |
| TAIR|locus:2014245 | 476 | AT1G64320 "AT1G64320" [Arabido | 0.613 | 0.686 | 0.254 | 1.7e-14 | |
| TAIR|locus:2132348 | 1111 | NET1C "AT4G02710" [Arabidopsis | 0.120 | 0.057 | 0.450 | 2e-14 | |
| TAIR|locus:2152985 | 1586 | CIP1 "COP1-interactive protein | 0.579 | 0.194 | 0.216 | 3.6e-14 |
| TAIR|locus:2064387 NET4B "AT2G30500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 282 (104.3 bits), Expect = 3.2e-38, Sum P(2) = 3.2e-38
Identities = 87/265 (32%), Positives = 144/265 (54%)
Query: 177 YEDKLRVLNLSLQL-----SEEEVARLKSELHSQIESAKRD-VNIKEADLEMERRQVFE- 229
+ED++ L LQ +E+ + + + E K D V K LE E E
Sbjct: 216 HEDEIANLKNQLQSFMSFDTEDHLGAEQKSVDLDKEDTKEDAVATKVLALEEELSIAKEK 275
Query: 230 LQNYVRELETRLSESNFEIERLMKELEGTHQLQGQLKLAQDDVTTLNAKLDYERMQVLKF 289
LQ++ E ET ++ EI + +E LQ +L+LAQ D T KL+ E+ +VLK
Sbjct: 276 LQHF--EKETYSLKNELEIGKAAEEK--LKSLQHELELAQRDADTYINKLNAEKKEVLKL 331
Query: 290 QERIAKVETNLSDRNNEVAELKIALSDAEEKFTLDKAQLQSEMFCLLEKQALLDARLKEW 349
QER+A V+T+L DR+NE+ LK A+SDAE+K +KAQ++ EM +LE+++ L +L+E
Sbjct: 332 QERLAMVKTSLQDRDNEIRALKTAVSDAEQKIFPEKAQIKGEMSKMLEERSQLGEQLREL 391
Query: 350 ELQGKALEDKIRQCETEKMEITGLHEAQERGMQSEINQLKVEVCERDNRIEALNKIMDSL 409
E + ++++ + ETE+ ++ G E + GM+ E N L+ E+ +R+ +I+ K M+ L
Sbjct: 392 ESHIRLIKEE--KAETEE-KLRGGTE-KISGMRDESNVLREEIGKREEKIKETEKHMEEL 447
Query: 410 KLKYDMLMAEKDEINAKVNTLMAEA 434
++ L E+ +V A
Sbjct: 448 HMEQVRLRRRSSELTEEVERTRVSA 472
|
|
| TAIR|locus:2161268 NET4A "Networked 4A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156794 AT5G05180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2103187 AT3G10880 "AT3G10880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007569 NET1D "AT1G03080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014240 AT1G64330 "AT1G64330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130210 NET1B "Networked 1B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014245 AT1G64320 "AT1G64320" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132348 NET1C "AT4G02710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152985 CIP1 "COP1-interactive protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 533 | |||
| pfam07765 | 74 | pfam07765, KIP1, KIP1-like protein | 4e-15 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-11 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 2e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 7e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.003 |
| >gnl|CDD|116379 pfam07765, KIP1, KIP1-like protein | Back alignment and domain information |
|---|
Score = 69.7 bits (171), Expect = 4e-15
Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 7/63 (11%)
Query: 5 SSRWLAENLEEMDRSVKQMQKLI-EDGESLSKF------HRPELTAHIEDFYHLYQSLAE 57
+S+WL ENL+EMD VK+M KLI ED +S +K RPEL A +E+FY Y++LAE
Sbjct: 12 NSKWLEENLQEMDSKVKEMLKLIEEDADSFAKRAEMYYKKRPELIALVEEFYRAYRALAE 71
Query: 58 RYD 60
RYD
Sbjct: 72 RYD 74
|
This is a family of sequences found exclusively in plants. They are similar to kinase interacting protein 1 (KIP1), which has been found to interact with the kinase domain of PRK1, a receptor-like kinase. This particular region contains two coiled-coils, which are described as motifs involved in protein-protein interactions. It has also been suggested that the protein's coiled- coils allow it to dimerise in vivo. Length = 74 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 533 | |||
| PF07765 | 74 | KIP1: KIP1-like protein; InterPro: IPR011684 This | 99.94 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.22 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.16 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.15 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.14 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.11 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.09 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.01 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.0 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.99 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.93 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.91 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.8 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.8 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.74 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.74 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.62 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.57 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.54 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.52 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.51 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.49 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.48 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.44 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.42 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.4 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.4 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.32 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.32 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.32 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.32 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.29 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.29 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.28 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.25 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 98.23 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.19 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 98.17 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 98.12 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.12 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.07 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.06 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.02 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.97 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.92 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.9 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.86 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.85 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.8 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.78 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.77 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.76 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.75 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.74 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.74 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.7 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.67 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.63 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.62 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.61 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.57 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.53 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.52 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.5 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.46 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.45 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.36 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.35 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 97.34 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.29 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.28 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.28 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 97.26 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.24 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.24 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.15 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.15 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.1 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.05 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.0 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.0 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 96.95 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.93 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.93 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.92 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.9 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 96.89 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.87 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.86 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.86 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.85 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.82 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 96.77 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.74 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.7 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.7 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.69 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.66 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.65 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.65 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.62 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.56 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.55 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.47 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.41 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.27 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.21 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.14 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.11 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.1 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 96.05 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 96.03 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.03 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.0 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 95.98 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.97 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.87 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.86 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.77 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.73 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.59 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.58 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.49 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.49 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.45 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.27 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 95.24 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.14 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.13 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.06 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.04 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.01 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.0 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.96 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 94.9 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.86 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 94.85 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.75 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.71 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.68 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.62 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.62 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.41 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.34 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.32 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 94.29 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 94.03 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 93.86 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.74 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.65 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 93.64 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.58 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 93.4 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 93.35 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 93.34 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 93.27 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 93.25 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 93.03 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 92.99 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 92.83 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.82 | |
| KOG3850 | 455 | consensus Predicted membrane protein [Function unk | 92.81 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 92.76 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 92.72 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 92.65 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.62 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 92.57 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 92.56 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 92.53 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 92.53 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 92.51 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 92.46 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 92.41 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 92.21 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 92.1 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 91.95 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.94 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 91.89 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 91.88 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 91.87 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 91.77 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 91.68 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 91.64 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 91.57 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.55 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 91.55 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 91.43 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 91.37 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 91.34 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 91.28 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 91.08 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 91.01 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 90.93 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 90.6 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 90.57 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 90.51 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 90.51 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 90.37 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 90.28 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 90.24 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 90.15 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 90.09 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 90.0 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 89.95 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 89.93 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 89.89 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 89.71 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 89.46 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 89.43 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 89.24 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.94 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 88.93 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 88.72 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 88.58 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 88.54 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 88.32 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 88.02 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 87.87 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 87.84 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 87.67 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 87.62 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 87.47 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 87.33 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 87.08 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 86.87 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 86.76 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 86.62 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 86.07 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 85.85 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 85.81 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 85.43 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 85.0 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 84.71 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 84.58 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 84.39 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 83.88 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 83.54 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 83.54 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 83.34 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 83.23 | |
| PF13166 | 712 | AAA_13: AAA domain | 83.2 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 83.08 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 82.6 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 82.42 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 82.35 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 82.35 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 82.1 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 81.97 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 81.79 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 81.34 | |
| PF01496 | 759 | V_ATPase_I: V-type ATPase 116kDa subunit family ; | 80.95 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 80.77 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 80.54 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 80.52 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 80.47 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 80.09 |
| >PF07765 KIP1: KIP1-like protein; InterPro: IPR011684 This is a group of sequences found exclusively in plants | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.1e-27 Score=198.73 Aligned_cols=59 Identities=59% Similarity=0.970 Sum_probs=58.3
Q ss_pred CCccchhHHHhHHHHHHHHHHHHHHhh-ccccccc------ccchhHHHHHHHHHHHHHHHHHHhh
Q 037185 2 SRSSSRWLAENLEEMDRSVKQMQKLIE-DGESLSK------FHRPELTAHIEDFYHLYQSLAERYD 60 (533)
Q Consensus 2 s~~~skWl~~nL~~me~~vk~mlklie-d~dSfak------~~RpeLi~~vee~yr~yraLAeryd 60 (533)
+|+|||||++||+|||.+||.|||||+ ||||||+ ++||+||++||+|||+||+||||||
T Consensus 9 ~~~~skWL~~~l~dmd~kvk~mlklieedgdSfakrAEmyy~kRp~Li~~vee~yr~YrsLAerYD 74 (74)
T PF07765_consen 9 SPKQSKWLQENLSDMDEKVKAMLKLIEEDGDSFAKRAEMYYKKRPELISLVEEFYRSYRSLAERYD 74 (74)
T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHhccCcchHHHhhHHHhcccHHHHHHHHHHHHHHHHHHHhcC
Confidence 799999999999999999999999999 9999999 9999999999999999999999998
|
They are similar to kinase interacting protein 1 (KIP1), which has been found to interact with the kinase domain of PRK1, a receptor-like kinase []. This particular region contains two coiled-coils, which are described as motifs involved in protein-protein interactions []. It has also been suggested that the coiled-coils of the protein allow it to dimerise in vivo []. |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG3850 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF01496 V_ATPase_I: V-type ATPase 116kDa subunit family ; InterPro: IPR002490 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 533 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-06 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 4e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 79.9 bits (197), Expect = 9e-16
Identities = 53/331 (16%), Positives = 126/331 (38%), Gaps = 19/331 (5%)
Query: 160 TEEANETYEELLGRVIQYEDKLRVLNLSLQLSEEEVARLKSELHSQIESAKRDVNIKEAD 219
EE + +E L R + + K L+ ++ K+ L ++++ E
Sbjct: 855 QEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEM 914
Query: 220 LEMERRQVFELQNYVRELETRLS---ESNFEIERLMKELEGTH-QLQGQLKLAQDDVTTL 275
+ EL+ + E+E R+ E + +++ K+++ L+ QL+ + L
Sbjct: 915 RVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKL 974
Query: 276 NAKLDYERMQVLKFQERIAKVETNLSDRNNEVAELKIALSDAEEKFTLDKAQLQSEMFCL 335
+ ++ K ++ I +E + E L+ +SD L E
Sbjct: 975 QLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTT-------NLAEEE--- 1024
Query: 336 LEKQALLDARLKEWELQGKALEDKIRQCETEKMEITGLHEAQERGMQSEINQLKVEVCER 395
EK L + E LE ++++ E + E+ E +R ++ E + L ++ E
Sbjct: 1025 -EKAKNLTKLKNKHESMISELEVRLKKEEKSRQEL----EKIKRKLEGESSDLHEQIAEL 1079
Query: 396 DNRIEALNKIMDSLKLKYDMLMAEKDEINAKVNTLMAEARSRDNHIGQIEEHSRKLHMEH 455
+I L + + + +A ++ ++ N + + R ++HI ++E
Sbjct: 1080 QAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAAR 1139
Query: 456 AELIAASESSRKLVDELRFRVKELENEVDRQ 486
+ + ++ L+ +++ + Q
Sbjct: 1140 NKAEKQKRDLSEELEALKTELEDTLDTTATQ 1170
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 533 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.31 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.99 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.89 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.85 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.81 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.62 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.4 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.35 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.34 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.9 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.56 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.5 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.18 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.9 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 95.84 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.57 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.54 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 95.14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.91 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 94.6 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 94.48 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.34 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 93.64 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 93.3 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 93.11 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 92.9 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 92.3 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 91.8 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 91.52 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 91.44 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 90.85 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 90.78 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 90.75 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 88.83 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 88.7 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 88.54 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 88.05 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 87.94 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 87.51 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 87.17 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 85.78 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 85.48 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 84.89 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 84.87 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 84.64 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 84.37 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 84.07 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 83.37 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 83.17 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 83.06 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 81.9 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 81.55 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 81.07 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 80.09 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=99.31 E-value=2.2e-07 Score=83.52 Aligned_cols=31 Identities=3% Similarity=-0.126 Sum_probs=21.1
Q ss_pred HHHHHHHhhHHHHHHHHHHHhhhHHHHHhhH
Q 037185 169 ELLGRVIQYEDKLRVLNLSLQLSEEEVARLK 199 (533)
Q Consensus 169 ~L~~RiielEdELreaneKL~~sEEe~~rlk 199 (533)
+|-+++..++.++..+...+..++.++..+.
T Consensus 3 ~~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~ 33 (284)
T 1c1g_A 3 AIKKKMQMLKLDKENALDRADEAEADKKAAE 33 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Confidence 5666777777777777777777666666664
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00