Citrus Sinensis ID: 037241

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MPEDEGGGGGGEGGLLHEGFFMENPAWAPLVSDTTLAPPQPSSSKIPKLNKKQETSQGSSKKRARGEGGGEVGKDGNLLKGSDDKKAVKVKEGESEHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIKTLQQTLRKLQKQKLERLQGVASFGFEASAAITPQNKLAIVAHDHQQGSSSNLLGANSTDATNNSSNLLSVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGASDQFSEALPVEEMYKQAA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEccccccccccccHHHHHHHHc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEccccccccccccHHHHHHHHc
mpedeggggggeggllhegffmenpawaplvsdttlappqpssskipklnkkqetsqgsskkrargegggevgkdgnllkgsddkkavkvkegeseheIHIWTERERRKKMRNMFANLHSllpqlppkadkssiVDEAVSYIKTLQQTLRKLQKQKLERLQGvasfgfeasaaitpqnkLAIVAhdhqqgsssnllganstdatnnssnllsvsptypvIFQTWTSsnvvlnicgdeahisicspkkpgmfSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNgasdqfsealpvEEMYKQAA
MPEDEGGGGGGEGGLLHEGFFMENPAWAPLVSDTTLAPPQpssskipklnkkqetsqgsskkrargegggevgkdgnllkgsddkkavkvkegeseheihiwtERERRKKMRNMFANLHsllpqlppkaDKSSIVDEAVSYIKTLQQTLRKLQKQKLERLQGVASFGFEASAAITPQNKLAIVAHDHQQGSSSNLLGANSTDATNNSSNLLSVSPTYPVIFQTWTSSNVVLNICGDEAHisicspkkpGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGasdqfsealpVEEMYKQAA
MPEDeggggggeggllhegFFMENPAWAPLVSDTTLAPPQPSSSKIPKLNKKQETSQgsskkrargegggevgkdgNLLKGSDDKKAVKVKEGESEHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIktlqqtlrklqkqklerlqGVASFGFEASAAITPQNKLAIVAHDHQQGSSSNLLGanstdatnnssnllsVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGASDQFSEALPVEEMYKQAA
**************************W*************************************************************************IW*******************************IVDEAVSYIKTLQQTLRKLQKQKLERLQGVASFGFEASAAITPQNKLAIV***************************LSVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNG*******************
*********************************************************************************************************ERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIKTLQQ***************************************************************************TWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQV***************EEMYKQAA
**********GEGGLLHEGFFMENPAWAPLVSDT************************************EVGKDGNLLKGSDD*************EIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIKTLQQTLRKLQKQKLERLQGVASFGFEASAAITPQNKLAIVAHDHQQGSSSNLLGANSTDATNNSSNLLSVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGASDQFSEALPVEEMYKQAA
**************************************************************************************************IHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIKTLQQTLRKLQKQKLE*****************************************************SVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGA******ALP*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEDEGGGGGGEGGLLHEGFFMENPAWAPLVSDTTLAPPQPSSSKIPKLNKKQETSQGSSKKRARGEGGGEVGKDGNLLKGSDDKKAVKVKEGESEHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIxxxxxxxxxxxxxxxxxxxxxKLERLQGVASFGFEASAAITPQNKLAIVAHDHQQGSSSNLLGANSTDATNNSSNLLSVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGASDQFSEALPVEEMYKQAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q9FXA3308 Transcription factor bHLH yes no 0.725 0.720 0.443 3e-46
Q9LNJ5590 Transcription factor bHLH no no 0.418 0.216 0.328 3e-07
Q1PF16295 Transcription factor bHLH no no 0.183 0.189 0.473 1e-06
Q9ZPY8566 Transcription factor ABA- no no 0.372 0.201 0.301 1e-06
Q9M8K6202 Transcription factor MUTE no no 0.549 0.831 0.264 5e-06
Q56YJ8414 Transcription factor FAMA no no 0.235 0.173 0.369 6e-06
Q56XR0327 Transcription factor bHLH no no 0.215 0.201 0.402 1e-05
Q9T072328 Transcription factor bHLH no no 0.241 0.225 0.386 2e-05
Q9LND0420 Transcription factor bHLH no no 0.241 0.176 0.361 2e-05
P13027612 Anthocyanin regulatory R- N/A no 0.183 0.091 0.385 2e-05
>sp|Q9FXA3|BH095_ARATH Transcription factor bHLH95 OS=Arabidopsis thaliana GN=BHLH95 PE=2 SV=2 Back     alignment and function desciption
 Score =  185 bits (470), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 151/241 (62%), Gaps = 19/241 (7%)

Query: 85  KKAVKVKEGES-EHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIK 143
           K+  K  E ES +HEIHIWTERERRKKMR+MF+ LH+LLPQLPPKADKS+IVDEAVS IK
Sbjct: 58  KRNDKNHEEESPDHEIHIWTERERRKKMRDMFSKLHALLPQLPPKADKSTIVDEAVSSIK 117

Query: 144 TLQQTLRKLQKQKLERLQGVAS---------FGF------EASAAITPQNKLAIVAHDHQ 188
           +L+QTL+KL+ QKLE+LQ  ++         F +        +A +TP +   I A    
Sbjct: 118 SLEQTLQKLEMQKLEKLQYSSASTNTTPTTTFAYAPSSSSSPTALLTPISNHPIDATATD 177

Query: 189 QGSSSNLLGANSTDATNNSSNLLSVSPTYPVIFQTWTSSNVVLNICGDEAHISICSPK-K 247
               +  L    + ++  ++NL        V F TW+S NVVL ICG+EA  ++C PK K
Sbjct: 178 SYPRAAFLADQVSSSSAAAANLPYPCNDPIVNFDTWSSRNVVLTICGNEAFFNLCVPKHK 237

Query: 248 PGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGASDQ--FSEALPVEEMYKQA 305
           PG+F+++CY+ EK+ +EV+ A VSS++    Y+IQ  VN + +       L V +++KQ 
Sbjct: 238 PGVFTSVCYLFEKYNMEVLFANVSSNVFWSTYVIQAQVNPSCENQLLGNGLGVVDVFKQV 297

Query: 306 A 306
           +
Sbjct: 298 S 298
Controls embryo growth.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LNJ5|BH013_ARATH Transcription factor bHLH13 OS=Arabidopsis thaliana GN=BHLH13 PE=2 SV=1 Back     alignment and function description
>sp|Q1PF16|BH019_ARATH Transcription factor bHLH19 OS=Arabidopsis thaliana GN=BHLH19 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPY8|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE OS=Arabidopsis thaliana GN=AIB PE=2 SV=2 Back     alignment and function description
>sp|Q9M8K6|MUTE_ARATH Transcription factor MUTE OS=Arabidopsis thaliana GN=MUTE PE=2 SV=1 Back     alignment and function description
>sp|Q56YJ8|FAMA_ARATH Transcription factor FAMA OS=Arabidopsis thaliana GN=FMA PE=1 SV=1 Back     alignment and function description
>sp|Q56XR0|BH071_ARATH Transcription factor bHLH71 OS=Arabidopsis thaliana GN=BHLH71 PE=1 SV=1 Back     alignment and function description
>sp|Q9T072|BH025_ARATH Transcription factor bHLH25 OS=Arabidopsis thaliana GN=BHLH25 PE=2 SV=2 Back     alignment and function description
>sp|Q9LND0|BH089_ARATH Transcription factor bHLH89 OS=Arabidopsis thaliana GN=BHLH89 PE=2 SV=1 Back     alignment and function description
>sp|P13027|ARRS_MAIZE Anthocyanin regulatory R-S protein OS=Zea mays GN=R-S PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
225428845305 PREDICTED: transcription factor bHLH95 [ 0.931 0.934 0.553 6e-79
255555415278 conserved hypothetical protein [Ricinus 0.594 0.654 0.702 7e-60
147845459333 hypothetical protein VITISV_042279 [Viti 0.800 0.735 0.511 1e-56
302142295291 unnamed protein product [Vitis vinifera] 0.679 0.714 0.548 3e-56
449495725253 PREDICTED: transcription factor bHLH95-l 0.686 0.830 0.515 4e-56
449438671297 PREDICTED: transcription factor bHLH95-l 0.686 0.707 0.515 5e-56
255538252247 conserved hypothetical protein [Ricinus 0.656 0.813 0.522 3e-55
224137578291 predicted protein [Populus trichocarpa] 0.673 0.707 0.574 1e-53
297847302294 basic helix-loop-helix family protein [A 0.725 0.755 0.480 3e-47
116783198297 unknown [Picea sitchensis] 0.767 0.791 0.433 3e-47
>gi|225428845|ref|XP_002282369.1| PREDICTED: transcription factor bHLH95 [Vitis vinifera] gi|147766738|emb|CAN74162.1| hypothetical protein VITISV_026442 [Vitis vinifera] gi|297741258|emb|CBI32389.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  300 bits (768), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 205/311 (65%), Gaps = 26/311 (8%)

Query: 5   EGGGGGGEGGLLHEGFFMENPAWAPLVSDTTLAPPQPSSSKIPKLNKKQETSQGS----- 59
           EGGG        HEGF  EN +W    SD +    + S  K P      +T+        
Sbjct: 3   EGGG--------HEGFLWENQSWGFSNSDNSGGSDKKSGEKQPGSASNSQTAATGMDLVP 54

Query: 60  -SKKRARGEGGGEVGKDGNLLKGSDDKKAVKVKEGESEHEIHIWTERERRKKMRNMFANL 118
             KKR RG G  + GK+G      ++ K+     GES+HEIHIWTERERRKKMRNMF++L
Sbjct: 55  PDKKRGRG-GAIKNGKNGKGSGEGNEGKSGGGGGGESDHEIHIWTERERRKKMRNMFSSL 113

Query: 119 HSLLPQLPPKADKSSIVDEAVSYIKTLQQTLRKLQKQKLERLQGVASFGFEASAAITPQN 178
           H+LLPQLPPKADKS+IVDEAV+YIKTLQ TL+KLQKQKLERLQG  +  +E S  I    
Sbjct: 114 HALLPQLPPKADKSTIVDEAVNYIKTLQHTLQKLQKQKLERLQGATTVNYEPS--IITSQ 171

Query: 179 KLAIVAHDH---QQGSSSNLLGANSTDATNNSSNLLSVSPTYPVIFQTWTSSNVVLNICG 235
           KLA  + +     QGSSSNL    S     NSSN LSV+   P +FQ+WTS NV LN+CG
Sbjct: 172 KLAFDSREAFLADQGSSSNLAITPS-----NSSNSLSVA-RVPAVFQSWTSPNVTLNVCG 225

Query: 236 DEAHISICSPKKPGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVNGASDQFSEA 295
           +EA IS+CSPKKPG+ +TICYVLEKHK+EVISA VSSD  R MYMIQ + NGA DQF   
Sbjct: 226 NEAQISVCSPKKPGLLTTICYVLEKHKLEVISAHVSSDYNRSMYMIQTNANGALDQFPVG 285

Query: 296 LPVEEMYKQAA 306
            P+EE+YKQAA
Sbjct: 286 FPMEEVYKQAA 296

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255555415|ref|XP_002518744.1| conserved hypothetical protein [Ricinus communis] gi|223542125|gb|EEF43669.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147845459|emb|CAN83348.1| hypothetical protein VITISV_042279 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142295|emb|CBI19498.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449495725|ref|XP_004159926.1| PREDICTED: transcription factor bHLH95-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438671|ref|XP_004137111.1| PREDICTED: transcription factor bHLH95-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255538252|ref|XP_002510191.1| conserved hypothetical protein [Ricinus communis] gi|223550892|gb|EEF52378.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224137578|ref|XP_002327161.1| predicted protein [Populus trichocarpa] gi|222835476|gb|EEE73911.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297847302|ref|XP_002891532.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] gi|297337374|gb|EFH67791.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|116783198|gb|ABK22833.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
TAIR|locus:2012146308 RGE1 "AT1G49770" [Arabidopsis 0.660 0.655 0.401 1.7e-34
UNIPROTKB|Q6YYG9327 OSJNBa0051E21.18 "Putative unc 0.287 0.269 0.370 1.6e-23
UNIPROTKB|Q6YYG5365 OSJNBa0051E21.28 "Putative unc 0.127 0.106 0.487 1.6e-08
UNIPROTKB|Q84LF9310 RERJ1 "Transcription Factor" [ 0.581 0.574 0.25 0.00011
TAIR|locus:2165311174 AT5G51780 "AT5G51780" [Arabido 0.153 0.270 0.448 0.00014
UNIPROTKB|Q7XT88239 OSJNBa0042L16.11 "OSJNBa0042L1 0.300 0.384 0.285 0.0002
TAIR|locus:2035237590 AT1G01260 "AT1G01260" [Arabido 0.186 0.096 0.379 0.00024
UNIPROTKB|Q657A4370 P0022F12.30 "Regulatory protei 0.137 0.113 0.441 0.00057
TAIR|locus:2012146 RGE1 "AT1G49770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 1.7e-34, P = 1.7e-34
 Identities = 88/219 (40%), Positives = 120/219 (54%)

Query:    85 KKAVKVKEGES-EHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIX 143
             K+  K  E ES +HEIHIWTERERRKKMR+MF+ LH+LLPQLPPKADKS+IVDEAVS I 
Sbjct:    58 KRNDKNHEEESPDHEIHIWTERERRKKMRDMFSKLHALLPQLPPKADKSTIVDEAVSSIK 117

Query:   144 XXXXXXXXXX---------XXXXXXXXGVASFGFEASAAITPQNKLAIVA-HDHQQGSSS 193
                                           +F +  S++ +P   L  ++ H     ++ 
Sbjct:   118 SLEQTLQKLEMQKLEKLQYSSASTNTTPTTTFAYAPSSSSSPTALLTPISNHPIDATATD 177

Query:   194 NLLGXXXXXXXXXXXXXXXVSPTYP-----VIFQTWTSSNVVLNICGDEAHISICSPK-K 247
             +                   +  YP     V F TW+S NVVL ICG+EA  ++C PK K
Sbjct:   178 SYPRAAFLADQVSSSSAAAANLPYPCNDPIVNFDTWSSRNVVLTICGNEAFFNLCVPKHK 237

Query:   248 PGMFSTICYVLEKHKIEVISAQVSSDLTRRMYMIQVHVN 286
             PG+F+++CY+ EK+ +EV+ A VSS++    Y+IQ  VN
Sbjct:   238 PGVFTSVCYLFEKYNMEVLFANVSSNVFWSTYVIQAQVN 276
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009790 "embryo development" evidence=IMP
UNIPROTKB|Q6YYG9 OSJNBa0051E21.18 "Putative uncharacterized protein OSJNBa0051E21.18" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YYG5 OSJNBa0051E21.28 "Putative uncharacterized protein OSJNBa0051E21.28" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84LF9 RERJ1 "Transcription Factor" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2165311 AT5G51780 "AT5G51780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XT88 OSJNBa0042L16.11 "OSJNBa0042L16.11 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2035237 AT1G01260 "AT1G01260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q657A4 P0022F12.30 "Regulatory protein B-Peru-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 6e-13
smart0035353 smart00353, HLH, helix loop helix domain 2e-11
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 7e-11
cd0211660 cd02116, ACT, ACT domains are commonly involved in 9e-04
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information 
 Score = 62.2 bits (152), Expect = 6e-13
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 94  ESEHEIHIWTERERRKKMRNMFANLHSLLPQLPP--KADKSSIVDEAVSYIKTLQQTLR 150
           +S  E H   ER RR+++ + F  L SLLP LPP  K  K+ I+ +AV YIK+LQ+ L+
Sbjct: 2   KSRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELLQ 60

A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins. Length = 60
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.46
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.42
smart0035353 HLH helix loop helix domain. 99.35
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 99.13
KOG1318411 consensus Helix loop helix transcription factor EB 99.0
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.69
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.49
KOG3960284 consensus Myogenic helix-loop-helix transcription 98.46
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.43
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 98.23
KOG0561 373 consensus bHLH transcription factor [Transcription 98.2
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.06
PLN0321793 transcription factor ATBS1; Provisional 98.04
KOG4029228 consensus Transcription factor HAND2/Transcription 98.04
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.0
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 97.95
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 97.8
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 97.8
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.6
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.56
KOG3910632 consensus Helix loop helix transcription factor [T 97.39
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.37
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.3
KOG4447173 consensus Transcription factor TWIST [Transcriptio 96.94
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 96.84
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 96.7
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.5
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 96.47
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.29
PRK05007884 PII uridylyl-transferase; Provisional 96.13
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 95.82
PRK03381774 PII uridylyl-transferase; Provisional 95.79
KOG3898254 consensus Transcription factor NeuroD and related 95.67
PRK00275895 glnD PII uridylyl-transferase; Provisional 95.61
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 95.56
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 95.48
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 95.41
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 95.4
PRK04374869 PII uridylyl-transferase; Provisional 95.35
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.34
PRK0019490 hypothetical protein; Validated 95.34
PRK03059856 PII uridylyl-transferase; Provisional 95.23
PRK03381 774 PII uridylyl-transferase; Provisional 95.14
PRK05092931 PII uridylyl-transferase; Provisional 95.11
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 94.85
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 94.77
PRK01759 854 glnD PII uridylyl-transferase; Provisional 94.56
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 94.54
KOG4395285 consensus Transcription factor Atonal, contains HT 94.54
PRK05007 884 PII uridylyl-transferase; Provisional 94.49
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 94.44
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 94.31
PRK00275 895 glnD PII uridylyl-transferase; Provisional 94.14
PRK03059 856 PII uridylyl-transferase; Provisional 94.12
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 93.81
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.76
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 93.71
cd0211660 ACT ACT domains are commonly involved in specifica 93.58
PRK04435147 hypothetical protein; Provisional 93.45
PRK04374 869 PII uridylyl-transferase; Provisional 93.39
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 93.23
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 93.23
PRK05092 931 PII uridylyl-transferase; Provisional 93.08
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 92.95
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 92.83
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 92.83
PRK08577136 hypothetical protein; Provisional 92.58
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 92.32
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 92.28
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 92.07
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 91.85
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 91.33
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 91.25
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 91.21
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 91.07
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 90.92
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 90.76
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 90.66
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 90.5
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 89.59
PRK07334403 threonine dehydratase; Provisional 89.55
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 89.4
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 89.05
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 89.04
KOG3582856 consensus Mlx interactors and related transcriptio 88.82
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 88.67
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 88.58
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 86.95
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 86.85
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 86.69
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 86.17
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 85.76
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 85.26
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 83.51
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 82.91
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 82.56
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 81.9
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 81.79
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 80.68
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 80.31
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information 
Probab=99.46  E-value=1.1e-13  Score=97.96  Aligned_cols=51  Identities=39%  Similarity=0.625  Sum_probs=47.9

Q ss_pred             hhhhccHHHHHHHHHHHHHHHHHHhcCCCC----CCCCChhhHHHHHHHHHHHHH
Q 037241           96 EHEIHIWTERERRKKMRNMFANLHSLLPQL----PPKADKSSIVDEAVSYIKTLQ  146 (306)
Q Consensus        96 ~~~~h~~~Er~RR~~~~~~~~~Lr~lvP~~----~~k~~k~~iL~~ai~YIk~Lq  146 (306)
                      +|..|+..||+||.+||++|..|+.+||..    ..|.+|++||..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            468999999999999999999999999987    378999999999999999997

; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>KOG3582 consensus Mlx interactors and related transcription factors [Transcription] Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-13
1hlo_A80 Protein (transcription factor MAX); transcriptiona 2e-12
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 2e-12
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 5e-12
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 5e-10
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 1e-09
1a0a_A63 BHLH, protein (phosphate system positive regulator 9e-06
4f3l_A 361 Mclock, circadian locomoter output cycles protein 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 4e-05
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 5e-05
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 6e-05
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 3e-04
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
 Score = 63.9 bits (156), Expect = 2e-13
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 15/80 (18%)

Query: 98  EIHIWTERERRKKMRNMFANLHSLLPQLP--PKADKSSIVDEAVSYIKTLQQTLRKLQ-- 153
             H   ER+RR +++  F  L   +P+L    KA K  I+ +A +YI ++Q   +KL   
Sbjct: 8   RTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISE 67

Query: 154 -----------KQKLERLQG 162
                      K KLE+L G
Sbjct: 68  EDLLRKRREQLKHKLEQLGG 87
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Length = 60 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.71
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.65
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.65
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.62
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.62
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.6
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.57
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.55
4ati_A118 MITF, microphthalmia-associated transcription fact 99.55
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.48
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.47
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.41
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.39
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 99.06
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.88
4ath_A83 MITF, microphthalmia-associated transcription fact 98.75
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.72
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.69
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 96.52
2nyi_A 195 Unknown protein; protein structure initiative, PSI 95.97
1u8s_A 192 Glycine cleavage system transcriptional repressor, 95.77
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 95.61
2nyi_A195 Unknown protein; protein structure initiative, PSI 93.98
1u8s_A192 Glycine cleavage system transcriptional repressor, 92.37
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 89.71
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 89.4
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 89.04
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 88.82
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 87.72
2pc6_A165 Probable acetolactate synthase isozyme III (small; 87.31
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 87.0
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 86.85
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 86.13
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 85.63
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 84.7
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.71  E-value=2.3e-17  Score=125.36  Aligned_cols=68  Identities=24%  Similarity=0.378  Sum_probs=64.1

Q ss_pred             chhhhccHHHHHHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Q 037241           95 SEHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIKTLQQTLRKLQKQKLERLQG  162 (306)
Q Consensus        95 ~~~~~h~~~Er~RR~~~~~~~~~Lr~lvP~~~~k~~k~~iL~~ai~YIk~Lq~~~~~L~~~~~~~~~~  162 (306)
                      .+|..|+.+||+||.+||++|.+|++|||....|++|++||.+||+||++|+.+++.|+.+.+.|...
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~   72 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA   72 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            47789999999999999999999999999977899999999999999999999999999999988654
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 4e-14
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 1e-13
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 3e-13
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 3e-13
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 9e-12
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-11
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-11
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 4e-11
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Mad protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.2 bits (156), Expect = 4e-14
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 100 HIWTERERRKKMRNMFANLHSLLPQLPP--KADKSSIVDEAVSYIKTLQQTLRKLQKQKL 157
           H   E+ RR  +R     L  L+P  P   +    S++ +A  +IK L+ + RK   Q  
Sbjct: 5   HNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQI- 63

Query: 158 ERLQ 161
           ++LQ
Sbjct: 64  DQLQ 67
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.6
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.58
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.57
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.48
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 96.73
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.53
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 95.24
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 94.84
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 94.53
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 93.54
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 91.98
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 87.38
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 86.92
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 85.39
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.67  E-value=4e-17  Score=121.73  Aligned_cols=67  Identities=24%  Similarity=0.381  Sum_probs=63.1

Q ss_pred             chhhhccHHHHHHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 037241           95 SEHEIHIWTERERRKKMRNMFANLHSLLPQLPPKADKSSIVDEAVSYIKTLQQTLRKLQKQKLERLQ  161 (306)
Q Consensus        95 ~~~~~h~~~Er~RR~~~~~~~~~Lr~lvP~~~~k~~k~~iL~~ai~YIk~Lq~~~~~L~~~~~~~~~  161 (306)
                      .+|..|+.+||+||.+||++|..|++|||....|++|++||..||+||++|+++++.|..+...+..
T Consensus         5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~   71 (80)
T d1am9a_           5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT   71 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4678999999999999999999999999998789999999999999999999999999999988754
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure