Citrus Sinensis ID: 037441


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNLKQSLSTSESYSSYPNNNNNGKSQTSFDERPNKLLKTYSWKSTTTTDRASADHSSPTPQPHFLNFDQKPISSNPNKQLYGNLNMYSCSLKPKVEAPPSTGNTTSPPPFPPLGSQNYETVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGTDDESSSCDDNSEISTSDATLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
ccccHHHHHccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEccccccHHHHHHHHHccccEEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHc
ccccHHHHHHHcccccccccccccHHHHccccccccHHHHHHccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccEEEEEEEccccccHHHHHHHHHHHcccEEEEcEEccccccEEEEEEEEEEcccccEcHHHHHHHHHHHHHHHc
MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGnlkqslstsesyssypnnnnngksqtsfderpnkllktyswksttttdrasadhssptpqphflnfdqkpissnpnkqlygnlnmyscslkpkveappstgnttspppfpplgsqnyetvinpnhgtkrsypvtrtpalaqDHIMAERKRREKLSQRFIALSAIlpglkkmdkaSVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLvvsgtddessscddnseistsdatlpeiearvsdkdVLIRIHCEKQKGLLPKLISQLEMLHLSitntsvlpfgnstLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNLKQSLSTSESYssypnnnnngksqtsfderpnKLLKTYSWKsttttdrasadhssptpqPHFLNFDQKPISSNPNKQLYGNLNMYSCSLKPKVEAPPSTGNTTSPPPFPPLGSQNYETVINPNhgtkrsypvtrtpalaqdHIMAERKRREKLSQRFIALsailpglkkmdkASVLGDAIRYVKELQERVKVleeqtkkrtvesvvyvkksqlvvsgtddessscddnseistsdatlpeiearvsdkdvlIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNLKQslstsesyssypnnnnngksQTSFDERPNKLLKTYSWKSTTTTDRASADHSSPTPQPHFLNFDQKPISSNPNKQLYGNLNMYSCSLKPKVEAppstgnttspppfpplgsQNYETVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGtddessscddnseistsDATLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
*******WLAELGMDEYNIIHQCHMESVADLFSS***I*****************************************************************************************************************************************************************QRFIALSAILPGLKKMDKASVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLV******************************VSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLK**
***SSAKWLAELGMDEYNIIHQCH*************************************************************************************************************************************************************************RREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVKELQERV**************************************************IEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIAL**********DLVKDIRLAFLKLM
MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNL**************************DERPNKLLKTYSWK*****************QPHFLNFDQKPISSNPNKQLYGNLNMYSCSLKPKV**********SPPPFPPLGSQNYETVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLV*******************SDATLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
*****AKWLAELGMDEYNIIHQCHMESVADLFSSKQD*TAALG********************************************************************************************************************************************AQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKS************************ATLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNLKQSLSTSESYSSYPNNNNNGKSQTSFDERPNKLLKTYSWKSTTTTDRASADHSSPTPQPHFLNFDQKPISSNPNKQLYGNLNMYSCSLKPKVEAPPSTGNTTSPPPFPPLGSQNYETVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVVYVKKSQLVVSGTDDESSSCDDNSEISTSDATLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIRLAFLKLM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query366 2.2.26 [Sep-21-2011]
Q9T072328 Transcription factor bHLH yes no 0.882 0.984 0.415 2e-60
Q1PF17305 Transcription factor bHLH no no 0.532 0.639 0.586 1e-49
Q1PF16295 Transcription factor bHLH no no 0.521 0.647 0.495 2e-44
Q8S3F1320 Transcription factor NAI1 no no 0.527 0.603 0.473 2e-43
Q39204623 Transcription factor MYC2 no no 0.415 0.243 0.356 3e-18
Q9ZPY8566 Transcription factor ABA- no no 0.286 0.185 0.371 3e-16
O49687589 Transcription factor MYC4 no no 0.442 0.275 0.308 7e-16
Q9FIP9592 Transcription factor ATR2 no no 0.404 0.25 0.326 8e-16
P13526610 Anthocyanin regulatory Lc N/A no 0.371 0.222 0.333 2e-15
P13027612 Anthocyanin regulatory R- N/A no 0.371 0.222 0.333 3e-15
>sp|Q9T072|BH025_ARATH Transcription factor bHLH25 OS=Arabidopsis thaliana GN=BHLH25 PE=2 SV=2 Back     alignment and function desciption
 Score =  233 bits (593), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 151/363 (41%), Positives = 213/363 (58%), Gaps = 40/363 (11%)

Query: 1   MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNLKQSLSTSESYSSYP 60
           M   S +W +E  ++E +II Q HM S+       Q I          S +T        
Sbjct: 1   MSILSTRWFSEQEIEENSIIQQFHMNSIVGEVQEAQYI-------FPHSFTT-------- 45

Query: 61  NNNNNGKSQTSFDERPNKLLKTYSWKSTTTTDRASADHSSPTPQPHFLNFDQKPISSNPN 120
             NN+       + +P K+L+T        T  + + H  P  +PH ++  +   S   +
Sbjct: 46  --NNDPSYDDLIEMKPPKILET--------TYISPSSHLPPNSKPHHIH--RHSSSRILS 93

Query: 121 KQLYGNLNMYSCSLKPKVEAPPSTGNTTSPPPFPPLGSQNYETVINPNHGTKRSYPVTRT 180
            + YG+ +M       + E  P+  N+   P        + ++      GTKR+ P +R 
Sbjct: 94  FEDYGSNDM-------EHEYSPTYLNSIFSPKLEAQVQPHQKSDEFNRKGTKRAQPFSRN 146

Query: 181 PALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVKELQERVKVLEE 240
            + AQDHI+AERKRREKL+QRF+ALSA++PGLKKMDKASVLGDA++++K LQERV  LEE
Sbjct: 147 QSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDALKHIKYLQERVGELEE 206

Query: 241 QTKKRTVESVVYVKKSQLVVSGTDDE-SSSCDDNSEISTSDATLPEIEARVSDKDVLIRI 299
           Q K+R +ES+V VKKS+L++   +   SSSC+D      SD  LPEIE R SD+DVLI+I
Sbjct: 207 QKKERRLESMVLVKKSKLILDDNNQSFSSSCEDG----FSDLDLPEIEVRFSDEDVLIKI 262

Query: 300 HCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCTTMKDLVKDIR 359
            CEKQKG L K+++++E LH+ ITN+SVL FG  TLDITIIA K ++F  T+ D+VK +R
Sbjct: 263 LCEKQKGHLAKIMAEIEKLHILITNSSVLNFG-PTLDITIIAKKESDFDMTLMDVVKSLR 321

Query: 360 LAF 362
            A 
Sbjct: 322 SAL 324





Arabidopsis thaliana (taxid: 3702)
>sp|Q1PF17|BH018_ARATH Transcription factor bHLH18 OS=Arabidopsis thaliana GN=BHLH18 PE=2 SV=1 Back     alignment and function description
>sp|Q1PF16|BH019_ARATH Transcription factor bHLH19 OS=Arabidopsis thaliana GN=BHLH19 PE=2 SV=1 Back     alignment and function description
>sp|Q8S3F1|BH020_ARATH Transcription factor NAI1 OS=Arabidopsis thaliana GN=NAI1 PE=2 SV=1 Back     alignment and function description
>sp|Q39204|RAP1_ARATH Transcription factor MYC2 OS=Arabidopsis thaliana GN=RAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZPY8|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE OS=Arabidopsis thaliana GN=AIB PE=2 SV=2 Back     alignment and function description
>sp|O49687|BH004_ARATH Transcription factor MYC4 OS=Arabidopsis thaliana GN=BHLH4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIP9|ATR2_ARATH Transcription factor ATR2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 Back     alignment and function description
>sp|P13526|ARLC_MAIZE Anthocyanin regulatory Lc protein OS=Zea mays GN=LC PE=2 SV=1 Back     alignment and function description
>sp|P13027|ARRS_MAIZE Anthocyanin regulatory R-S protein OS=Zea mays GN=R-S PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
359480528365 PREDICTED: transcription factor bHLH25-l 0.942 0.945 0.510 1e-85
147818973365 hypothetical protein VITISV_026466 [Viti 0.942 0.945 0.507 5e-85
255576031331 DNA binding protein, putative [Ricinus c 0.770 0.851 0.579 4e-81
297736346344 unnamed protein product [Vitis vinifera] 0.898 0.956 0.470 2e-71
359475553331 PREDICTED: transcription factor bHLH25-l 0.803 0.888 0.495 1e-68
224094991367 predicted protein [Populus trichocarpa] 0.928 0.926 0.465 2e-66
356563474371 PREDICTED: transcription factor bHLH18-l 0.939 0.927 0.442 2e-66
297735856186 unnamed protein product [Vitis vinifera] 0.502 0.989 0.659 9e-64
255554513309 DNA binding protein, putative [Ricinus c 0.822 0.974 0.467 2e-63
239051052364 uncharacterized protein LOC100194106 [Ze 0.948 0.953 0.413 2e-62
>gi|359480528|ref|XP_002270448.2| PREDICTED: transcription factor bHLH25-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  322 bits (826), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 245/386 (63%), Gaps = 41/386 (10%)

Query: 1   MDASSAKWLAELGMDEYNIIHQCHMESVADLFSSKQDITAALGGNLKQ-SLSTS-ESYSS 58
           MD SS +W ++LGMD+YN I  CH+ S+ D F++ Q IT AL  +L+  SLS+  ESYSS
Sbjct: 1   MDISSDRWFSDLGMDDYNFIDPCHVNSL-DEFTT-QHITTALREDLRAPSLSSDHESYSS 58

Query: 59  YPNNNNNGKSQ-----------TSFDERPNKLLKTYSWKSTTTTDRASADHSSP------ 101
           YP  N    S            TSF  RP K LKT SW S T        H  P      
Sbjct: 59  YPTLNPETTSTTFSASSIEPHYTSFG-RPAKQLKTNSWSSDT------KQHVIPKPPPSS 111

Query: 102 -TPQPHFLNFDQKPISSNPNKQLYGNLNMYSCSLKPKVEAPPSTGNTTSPPPFPPLGSQN 160
            +    F+N    P  +    Q YG+     C++KPK E   S GN   P        +N
Sbjct: 112 SSSLLSFMNNGSPPAVNT--HQYYGD-----CTMKPKDEVI-SHGNVNFPSQISKGSYEN 163

Query: 161 YETVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASV 220
              V   N GTKR  P+ RT + AQDHIMAERKRREKLSQRFIALSA++PGLKKMDKASV
Sbjct: 164 QNYVPKANQGTKRVTPMRRTSSHAQDHIMAERKRREKLSQRFIALSALVPGLKKMDKASV 223

Query: 221 LGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGTDDESSSCDDNSEISTSD 280
           LGDAI+Y+K+LQERVK LEEQ K+ TVESVV++KKSQL     DDE+SSCD+N +    D
Sbjct: 224 LGDAIKYLKQLQERVKSLEEQMKETTVESVVFIKKSQL---SADDETSSCDENFDGCRED 280

Query: 281 ATLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITII 340
           A + +IEARVSDK+VLIRIHC+KQKG + K++ ++E  HLS+ N+SVLPFG   +DIT++
Sbjct: 281 A-VRDIEARVSDKNVLIRIHCKKQKGFVAKVLGEIEEHHLSVVNSSVLPFGKHAMDITVV 339

Query: 341 ALKNAEFCTTMKDLVKDIRLAFLKLM 366
           A    E   T+KDLV ++RLAFLK M
Sbjct: 340 AQMGDELQVTVKDLVNNLRLAFLKFM 365




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147818973|emb|CAN67117.1| hypothetical protein VITISV_026466 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255576031|ref|XP_002528911.1| DNA binding protein, putative [Ricinus communis] gi|223531665|gb|EEF33491.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297736346|emb|CBI25069.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475553|ref|XP_002268443.2| PREDICTED: transcription factor bHLH25-like [Vitis vinifera] gi|147839680|emb|CAN75020.1| hypothetical protein VITISV_039940 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224094991|ref|XP_002310318.1| predicted protein [Populus trichocarpa] gi|222853221|gb|EEE90768.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356563474|ref|XP_003549987.1| PREDICTED: transcription factor bHLH18-like [Glycine max] Back     alignment and taxonomy information
>gi|297735856|emb|CBI18610.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255554513|ref|XP_002518295.1| DNA binding protein, putative [Ricinus communis] gi|223542515|gb|EEF44055.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|239051052|ref|NP_001132631.2| uncharacterized protein LOC100194106 [Zea mays] gi|238908727|gb|ACF81557.2| unknown [Zea mays] gi|414872549|tpg|DAA51106.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
TAIR|locus:2137574328 AT4G37850 "AT4G37850" [Arabido 0.513 0.573 0.578 1.1e-54
TAIR|locus:2062225305 AT2G22750 "AT2G22750" [Arabido 0.532 0.639 0.566 1.6e-53
UNIPROTKB|Q75GI1359 OSJNBa0013A09.16 "Putative tra 0.948 0.966 0.375 1.5e-51
TAIR|locus:2062235320 NAI1 "AT2G22770" [Arabidopsis 0.5 0.571 0.466 1.4e-44
TAIR|locus:2062230295 AT2G22760 "AT2G22760" [Arabido 0.521 0.647 0.474 9.6e-41
UNIPROTKB|Q2QLR0338 LOC_Os12g43620 "Helix-loop-hel 0.412 0.446 0.496 1.2e-33
UNIPROTKB|Q84R60353 OSJNBb0113I20.8 "Putative ammo 0.428 0.444 0.478 4.1e-33
UNIPROTKB|Q8LSP3451 OJ1203D03.3 "Helix-loop-helix 0.442 0.359 0.432 2.6e-31
UNIPROTKB|Q84R79301 OSJNBb0113I20.1 "Putative ammo 0.390 0.475 0.406 2.2e-25
TAIR|locus:2035609623 MYC2 "AT1G32640" [Arabidopsis 0.590 0.346 0.286 2.8e-16
TAIR|locus:2137574 AT4G37850 "AT4G37850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 523 (189.2 bits), Expect = 1.1e-54, Sum P(2) = 1.1e-54
 Identities = 111/192 (57%), Positives = 143/192 (74%)

Query:   170 GTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIRYVK 229
             GTKR+ P +R  + AQDHI+AERKRREKL+QRF+ALSA++PGLKKMDKASVLGDA++++K
Sbjct:   136 GTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDALKHIK 195

Query:   230 ELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGXXXXXXXXXXXXXXXXXDATLPEIEAR 289
              LQERV  LEEQ K+R +ES+V VKKS+L++                   D  LPEIE R
Sbjct:   196 YLQERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCEDGFS---DLDLPEIEVR 252

Query:   290 VSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIALKNAEFCT 349
              SD+DVLI+I CEKQKG L K+++++E LH+ ITN+SVL FG  TLDITIIA K ++F  
Sbjct:   253 FSDEDVLIKILCEKQKGHLAKIMAEIEKLHILITNSSVLNFG-PTLDITIIAKKESDFDM 311

Query:   350 TMKDLVKDIRLA 361
             T+ D+VK +R A
Sbjct:   312 TLMDVVKSLRSA 323


GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2062225 AT2G22750 "AT2G22750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q75GI1 OSJNBa0013A09.16 "Putative transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2062235 NAI1 "AT2G22770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062230 AT2G22760 "AT2G22760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QLR0 LOC_Os12g43620 "Helix-loop-helix DNA-binding domain containing protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84R60 OSJNBb0113I20.8 "Putative ammonium transporter" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8LSP3 OJ1203D03.3 "Helix-loop-helix DNA-binding domain containing protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84R79 OSJNBb0113I20.1 "Putative ammonium transporter" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2035609 MYC2 "AT1G32640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9T072BH025_ARATHNo assigned EC number0.41590.88250.9847yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00004795001
SubName- Full=Chromosome undetermined scaffold_813, whole genome shotgun sequence; (247 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 6e-12
smart0035353 smart00353, HLH, helix loop helix domain 2e-11
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 8e-10
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
 Score = 59.9 bits (146), Expect = 6e-12
 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 3/53 (5%)

Query: 187 HIMAERKRREKLSQRFIALSAILPGL---KKMDKASVLGDAIRYVKELQERVK 236
           H + ER+RRE+++  F  L ++LP L   KK+ KA +L  A+ Y+K LQE ++
Sbjct: 8   HNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELLQ 60


A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins. Length = 60

>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.37
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.33
smart0035353 HLH helix loop helix domain. 99.3
KOG1318411 consensus Helix loop helix transcription factor EB 98.79
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.55
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.25
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.22
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.22
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.2
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.13
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.13
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.07
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.06
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.04
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.96
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.9
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.69
KOG0561 373 consensus bHLH transcription factor [Transcription 97.48
KOG4029228 consensus Transcription factor HAND2/Transcription 97.42
PLN0321793 transcription factor ATBS1; Provisional 97.38
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.25
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.23
PRK05007884 PII uridylyl-transferase; Provisional 97.16
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.15
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 96.87
PRK00275895 glnD PII uridylyl-transferase; Provisional 96.82
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.75
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 96.66
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.64
PRK04374869 PII uridylyl-transferase; Provisional 96.63
PRK05092931 PII uridylyl-transferase; Provisional 96.51
PRK03381774 PII uridylyl-transferase; Provisional 96.45
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.34
PRK03059856 PII uridylyl-transferase; Provisional 96.26
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.16
PRK0019490 hypothetical protein; Validated 96.12
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.11
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.07
PRK05007 884 PII uridylyl-transferase; Provisional 96.02
PRK03381 774 PII uridylyl-transferase; Provisional 96.02
PRK01759 854 glnD PII uridylyl-transferase; Provisional 95.97
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 95.89
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 95.81
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 95.75
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 95.67
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.34
PRK03059 856 PII uridylyl-transferase; Provisional 95.19
PRK00275 895 glnD PII uridylyl-transferase; Provisional 94.85
PRK04435147 hypothetical protein; Provisional 94.83
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 94.79
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 94.77
PRK05092 931 PII uridylyl-transferase; Provisional 94.68
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 94.41
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 94.3
cd0211660 ACT ACT domains are commonly involved in specifica 94.25
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.22
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 94.02
KOG4447173 consensus Transcription factor TWIST [Transcriptio 93.58
PRK04374 869 PII uridylyl-transferase; Provisional 93.57
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 93.29
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 93.26
PRK08577136 hypothetical protein; Provisional 92.97
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 92.93
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 92.53
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 92.48
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 92.42
KOG3910632 consensus Helix loop helix transcription factor [T 92.14
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 91.27
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 90.68
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 90.21
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 89.71
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 89.63
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 89.35
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 89.3
PRK07334403 threonine dehydratase; Provisional 89.21
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 89.2
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 89.1
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 89.05
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 88.92
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 88.13
KOG3898254 consensus Transcription factor NeuroD and related 86.89
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 86.77
PRK11589 190 gcvR glycine cleavage system transcriptional repre 86.49
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 86.02
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 86.01
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 85.79
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 85.04
COG4492150 PheB ACT domain-containing protein [General functi 84.5
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 84.22
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 83.1
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 82.99
KOG4395285 consensus Transcription factor Atonal, contains HT 81.36
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 81.32
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
Probab=99.37  E-value=1.2e-12  Score=97.55  Aligned_cols=53  Identities=42%  Similarity=0.702  Sum_probs=50.1

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHhhcCCCC---CCCCcchHHHHHHHHHHHHHHHH
Q 037441          183 LAQDHIMAERKRREKLSQRFIALSAILPGL---KKMDKASVLGDAIRYVKELQERV  235 (366)
Q Consensus       183 ~~~~h~~~ER~RR~kln~~~~~LrslvP~~---~K~dKasiL~~AI~YIk~Lq~~v  235 (366)
                      .+..|+..||+||++||..|..|+++||..   .|+||++||..||+||+.|+.++
T Consensus         4 ~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~   59 (60)
T cd00083           4 RREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL   59 (60)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            467899999999999999999999999987   89999999999999999999876



A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and

>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 8e-16
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 9e-14
1hlo_A80 Protein (transcription factor MAX); transcriptiona 6e-13
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 2e-12
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 2e-09
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 3e-08
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 4e-04
1a0a_A63 BHLH, protein (phosphate system positive regulator 4e-04
4f3l_A 361 Mclock, circadian locomoter output cycles protein 4e-04
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
 Score = 70.9 bits (174), Expect = 8e-16
 Identities = 16/56 (28%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 187 HIMAERKRREKLSQRFIALSAILPGLK-KMDKASVLGDAIRYVKELQERVKVLEEQ 241
           H   E++ R  ++ + I L  ++ G + K++K++VL  AI Y++ LQ   + L+++
Sbjct: 10  HNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQE 65


>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.63
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.52
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.51
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.49
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.48
4ati_A118 MITF, microphthalmia-associated transcription fact 99.48
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.48
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.45
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.42
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.42
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.32
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.1
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.1
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.85
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.73
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.51
4ath_A83 MITF, microphthalmia-associated transcription fact 98.32
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.98
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 96.83
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.13
2nyi_A 195 Unknown protein; protein structure initiative, PSI 95.76
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 95.7
2nyi_A195 Unknown protein; protein structure initiative, PSI 94.55
1u8s_A192 Glycine cleavage system transcriptional repressor, 94.41
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 91.15
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 90.45
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 89.34
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 89.31
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 88.8
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 87.58
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 87.1
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 86.22
2pc6_A165 Probable acetolactate synthase isozyme III (small; 84.11
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 83.68
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 82.02
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.63  E-value=4.1e-16  Score=124.17  Aligned_cols=64  Identities=25%  Similarity=0.420  Sum_probs=59.7

Q ss_pred             chhhhhhHHHHHHHHHHHHHHHHHhhcCCCC-CCCCcchHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 037441          182 ALAQDHIMAERKRREKLSQRFIALSAILPGL-KKMDKASVLGDAIRYVKELQERVKVLEEQTKKR  245 (366)
Q Consensus       182 ~~~~~h~~~ER~RR~kln~~~~~LrslvP~~-~K~dKasiL~~AI~YIk~Lq~~v~~L~~~~~~~  245 (366)
                      ..+..|+++||+||++||+.|.+|+++||++ .|+||++||.+||+||++|+.+++.|+++...+
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L   69 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL   69 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4578899999999999999999999999987 899999999999999999999999999877654



>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 2e-14
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-13
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 3e-13
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 3e-13
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 7e-13
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 3e-12
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 8e-12
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 9e-12
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Max protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.7 bits (160), Expect = 2e-14
 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 187 HIMAERKRREKLSQRFIALSAILPGL--KKMDKASVLGDAIRYVKELQERVKVLEEQTKK 244
           H   ERKRR+ +   F +L   +P L  +K  +A +L  A  Y++ ++ +    ++    
Sbjct: 6   HNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDD 65


>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.48
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.46
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.45
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.33
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.07
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.71
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 95.98
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.12
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 88.83
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 87.76
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 86.68
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 86.44
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 85.26
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 85.1
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.54  E-value=5.5e-15  Score=115.04  Aligned_cols=64  Identities=25%  Similarity=0.420  Sum_probs=58.8

Q ss_pred             chhhhhhHHHHHHHHHHHHHHHHHhhcCCCC-CCCCcchHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 037441          182 ALAQDHIMAERKRREKLSQRFIALSAILPGL-KKMDKASVLGDAIRYVKELQERVKVLEEQTKKR  245 (366)
Q Consensus       182 ~~~~~h~~~ER~RR~kln~~~~~LrslvP~~-~K~dKasiL~~AI~YIk~Lq~~v~~L~~~~~~~  245 (366)
                      ..+..|+.+||+||.+||+.|..|++|||+. .|++|++||..||+||+.|+++++.|..+....
T Consensus         5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~l   69 (80)
T d1am9a_           5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL   69 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4577899999999999999999999999975 699999999999999999999999999876643



>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure