Citrus Sinensis ID: 037446

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160-----
MAANKIPIEINGDDDDEFDWEAAVREIDTACQSSKPSTSNSTNFNLCSKANKKPSTCKQSTLDKFFGNLGPKPQGTEEFNEGSSFDESLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSRDDRTFVEDEVSSDKHLGLQTVEPCETDERDNFHGTKKVTDSELSTRTLGTQENHSMPQSCCKSPAAHAYLFGSDFISVDALGKVLIISVPALPFKELSHSKKKRAPDTLLLNHWKQDSSPLKTSDKNYDELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALPEKPLDGFEEILDSPVLRRNQLREEDTTDETLDVNEIKEPLSPDDEYHNDLRDSELSPRLTNLIKSGVVPESPINENGASNNKGRNPDLASPVKLCSIQPSKFASLGKTEKCSKYVRASQGNVSISPVNKKIQTPLLKMNHTASAGGYSPTSPIAEETKTPLANLANSSCSRDWRLSSGDKSENVEPARKFKRLRKVRDCEQNKNSENMKENAVAPVVNLARRFLGMSPIQNKHGRGRKKPMDNMREYIEEEAEVSSEAEVSDDEEDDEDNNSYDDSFIDDRMNPTATSTQAESSGVDMMAIYRFLLLSLSFSHAHMHPRVGEECI
cccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHccccEEEEcHHHHHHHHHccccccccEEEEEEHHHHHHccccHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHccccEEEEcccHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEcccccccccc
cccccccEEEEccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccEccccccHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccHHHHEEEcccccHHHHHHHHHcccEEEEcHHHHHHHHHcccccHHHEEEEEEcHHHHHHcHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHccccEEEEEcccccccHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEEcccccHHHHHHHccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccccccccccccccccccHccccccccccccEEEEcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHcccccccccccEccccccccccccccccccccccccHHEEEcccEEEEEccccEEEEEccccccHHHHccccccccccccccccccccccccccccccccccHHHccHHcccccHHHHccccccccHHHHccccccccccccccccccccEEccccccccccEEEEEccccccccccccHHHccccccccccHHHHHHHHccccccccccHccccccccccccccccccccccccccccHHccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccHHHHHHHHcccccHccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHEEcccccEcccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEEEcEEccccc
maankipieingddddefDWEAAVREIDtacqsskpstsnstnfnlcskankkpstckqstldkffgnlgpkpqgteefnegssfdeslchVQIDAEAaktwiypvnvpvrdyQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFfrwfpdgkivfaapsrplVMQQIEACHNivgipqewtidmtgqisptkrasfwktkrvffvtpqvlekdIQSGTCLMKYLVCLVIDEahratgnyAYCTAIRELMSVPVQLRILALtatpgskqQTIQHIIDNLYISTleyrnesdqdvSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGllqnrdyqtlspvdllnsrdkfrqapppnlpqikfgeVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQsishgaqspkLSKMLEVLVDhfktkdpkhsrvIIFSNFRGSVRDIMNALATIGDLVKatefigqssgkaskgqSQKVQQAVLEKFRAGGYNVIVATSigeegldiMEVDLVIcfdanvspLRMIQRMgrtgrkhdgriphifkpevQFVELSIEQYVSRGkkvkddhaittpIFKEKLTAAETDLIAkyfhptsdstwrpsliafphfqalpsrvHKVMHSFRTGMLIDMMQHLqgltfsrddrtfvedevssdkhlglqtvepcetderdnfhgtkkvtdselstrtlgtqenhsmpqscckspaahaylfgsdfisvdALGKVLIisvpalpfkelshskkkrapdtlllnhwkqdssplktsdknydelTVQSKAVEELTTSQAacikdgalpisrfcrsdalpekpldgfeeildspvlrrnqlreedttdetldvneikeplspddeyhndlrdselsprltnliksgvvpespinengasnnkgrnpdlaspvklcsiqpskfaslgktekcSKYVrasqgnvsispvnkkiqtpllkmnhtasaggysptspiaeetktplanlansscsrdwrlssgdksenveparKFKRLRKVRdceqnknsenmkenavAPVVNLARRFlgmspiqnkhgrgrkkpmDNMREYIEEEAevsseaevsddeeddednnsyddsfiddrmnptatstqaessgVDMMAIYRFLLLSLSFshahmhprvgeeci
maankipieingddddefDWEAAVREIDtacqsskpstsnstnfnlcskankkpstckQSTLDKFFGNLGPKPQGTEEFNEGSSFDESLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPtkrasfwktKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTatpgskqqtiQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFrqapppnlpqikFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSIshgaqspkLSKMLEVLVDHfktkdpkhsrvIIFSNFRGSVRDIMNALATIGDLVKATEFIGqssgkaskgqsqKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGrtgrkhdgriphifkpevqfVELSIEQYVSrgkkvkddhaittpifkekLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSRDDRTFVEDEvssdkhlglqtvepcetderdnfhgtkkvtdselsTRTLGTQENHSMPQSCCKSPAAHAYLFGSDFISVDALGKVLIISVPAlpfkelshskkkrapdtlllnhwkqdssplktsdknyDELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALpekpldgfeeildspvlrrnqlreedttdetldvneikeplspddeyhndlRDSELSPRLTNLIksgvvpespinengasnnkgrnPDLASPVKLCSIQpskfaslgkteKCSKYVRasqgnvsispvnkKIQTPLLKMNHTASAGGYSPTSPIAEETKTPLANLANSSCSrdwrlssgdksenveparkfkrlrkvrdceqnknsenmkenavapVVNLARRFLgmspiqnkhgrgrkkpmdNMREYIEEeaevsseaevsddeeddedNNSYddsfiddrmnptatstqaessgVDMMAIYRFLLLSLSFSHAHMHPRVGEECI
MAANKIPIEINGDDDDEFDWEAAVREIDTACQSSKPSTSNSTNFNLCSKANKKPSTCKQSTLDKFFGNLGPKPQGTEEFNEGSSFDESLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIgqssgkaskgqsqkvqqavLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSRDDRTFVEDEVSSDKHLGLQTVEPCETDERDNFHGTKKVTDSELSTRTLGTQENHSMPQSCCKSPAAHAYLFGSDFISVDALGKVLIISVPALPFKELSHSKKKRAPDTLLLNHWKQDSSPLKTSDKNYDELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALPEKPLDGFEEILDSPVLRRNQLREEDTTDETLDVNEIKEPLSPDDEYHNDLRDSELSPRLTNLIKSGVVPESPINENGASNNKGRNPDLASPVKLCSIQPSKFASLGKTEKCSKYVRASQGNVSISPVNKKIQTPLLKMNHTASAGGYSPTSPIAEETKTPLANLANSSCSRDWRLSSGDKSENVEPARKFKRLRKVRDCEQNKNSENMKENAVAPVVNLARRFLGMSPIQNKHGRGRKKPMDNMReyieeeaevsseaevsddeeddednnsyddsFIDDRMNPTATSTQAESSGVDMMAIYRflllslsfsHAHMHPRVGEECI
*******************WE******************************************************************SLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLL*************LPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLK**SFARF***********L*****************MLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFI*****************AVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSRDDRTF*******************************************************CKSPAAHAYLFGSDFISVDALGKVLIISVPALPFK************************************************SQAACIKDGALPISRFCRSD**************************************************************************************************************************************************************************************************************************VVNLARRFL***********************************************************************VDMMAIYRFLLLSLSFSHA***********
******P***********************************************************************************************IYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEF******************AVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPL****************IPHIFKPEVQFVELSIEQY************************************************************K*MHSFRTGMLIDMMQHLQG*****************************************************************CKSPAAHAYLFGSDF**V***GKV*I********************************************************************************************************************************************NLIKSGVVP*******************************************************************************************************************************************************************************REYIEE****************************DDRM******************IYRFLLLSLSFSHAHMHPRVGEECI
MAANKIPIEINGDDDDEFDWEAAVREIDT*************NFNLCSKANKKPSTCKQSTLDKFFGNLGPKPQGTEEFNEGSSFDESLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQ**************QAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSRDDRTFVEDEVSSDKHLGLQTVEPCETDERDNFHGTKKVTDSELSTRTLG***********CKSPAAHAYLFGSDFISVDALGKVLIISVPALPFKELSHSKKKRAPDTLLLNHWKQDSSPLKTSDKNYDELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALPEKPLDGFEEILDSPVLRRNQLREEDTTDETLDVNEIKEPLSPDDEYHNDLRDSELSPRLTNLIKSGVVPESPINENGASNNKGRNPDLASPVKLCSIQPSKFASLGKTEKCSKYVRASQGNVSISPVNKKIQTPLLKMNHTASAGGYSPTSPIAEETKTPLANLANSSCSRDWRLSSGDKSENVEPARKFKRLRKVRDCEQNKNSENMKENAVAPVVNLARRFLGMSPIQNKHGRGRKKPMDNMREYIE**********************SYDDSFIDDRMNP********SSGVDMMAIYRFLLLSLSFSHAHMHPRVGEECI
****KIPIEINGDDDDEFDWEAAVREIDT*************************************************************HVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFS***************HLGLQTVEP**************************************KSPAAHAYLFGSDFISVDALGKVLIISVPALPFKELSHSKK*RAPDTLLLNHWK**SSPLK*******ELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALPEKPLDGFEEILDSPVLRRNQLREEDTTDETLDVNEIKEPLSPDDEYHNDLRDSELSPRLTNLIKSGVVPESPINEN*A********DLASP*********K*********CSKYVRASQGNVSISPVNKKIQTP**************P**P*AEETKTPLANLANSSCSRDWRLS***KSENVEPARKFKRLRKVRDCEQN*********AV**V*NLARRFLGMSPIQNKHG**RKKPMDNMREYIEEEAEVS*****************YDDSFIDDRMNPTATSTQAESSGVDMMAIYRFLLLSLSFSHAHMHPRVGEECI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAANKIPIEINGDDDDEFDWEAAVREIDTACQSSKPSTSNSTNFNLCSKANKKPSTCKQSTLDKFFGNLGPKPQGTEEFNEGSSFDESLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAAETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSRDDRTFVEDEVSSDKHLGLQTVEPCETDERDNFHGTKKVTDSELSTRTLGTQENHSMPQSCCKSPAAHAYLFGSDFISVDALGKVLIISVPALPFKELSHSKKKRAPDTLLLNHWKQDSSPLKTSDKNYDELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALPEKPLDGFEEILDSPVLRRNQLREEDTTDETLDVNEIKEPLSPDDEYHNDLRDSELSPRLTNLIKSGVVPESPINENGASNNKGRNPDLASPVKLCSIQPSKFASLGKTEKCSKYVRASQGNVSISPVNKKIQTPLLKMNHTASAGGYSPTSPIAEETKTPLANLANSSCSRDWRLSSGDKSENVEPARKFKRLRKVRDCEQNKNSENMKENAVAPVVNLARRFLGMSPIQNKHGRGRKKPMDNMREYIEEEAEVSSEAEVSDDEEDDEDNNSYDDSFIDDRMNPTATSTQAESSGVDMMAIYRFLLLSLSFSHAHMHPRVGEECI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1165 2.2.26 [Sep-21-2011]
Q8BGE5 2021 Fanconi anemia group M pr yes no 0.408 0.235 0.448 1e-127
Q8IYD8 2048 Fanconi anemia group M pr yes no 0.406 0.230 0.444 1e-126
Q7SDF31168 ATP-dependent DNA helicas N/A no 0.460 0.458 0.420 1e-115
A4RN081102 ATP-dependent DNA helicas N/A no 0.447 0.472 0.419 1e-115
Q2HG761134 ATP-dependent DNA helicas N/A no 0.444 0.456 0.415 1e-113
Q9UT23834 ATP-dependent DNA helicas yes no 0.420 0.587 0.401 1e-111
A1CS001119 ATP-dependent DNA helicas N/A no 0.471 0.490 0.386 1e-109
A1D4V51111 ATP-dependent DNA helicas N/A no 0.479 0.503 0.382 1e-109
A7EFH41235 ATP-dependent DNA helicas N/A no 0.434 0.409 0.395 1e-109
A6RIS11229 ATP-dependent DNA helicas N/A no 0.416 0.394 0.411 1e-108
>sp|Q8BGE5|FANCM_MOUSE Fanconi anemia group M protein homolog OS=Mus musculus GN=Fancm PE=1 SV=3 Back     alignment and function desciption
 Score =  457 bits (1175), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/506 (44%), Positives = 312/506 (61%), Gaps = 30/506 (5%)

Query: 96  AEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGK 155
           A A   WIYP N PVRDYQ  I+++ALF NTLV LPTGLGKT IAAVV+YNF+RWFP GK
Sbjct: 65  AAAGALWIYPTNCPVRDYQLDISRSALFCNTLVCLPTGLGKTFIAAVVMYNFYRWFPSGK 124

Query: 156 IVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEK 215
           +VF AP++PLV QQ+EAC +++GIPQ    +MTG      R   W ++RV F+TPQV+  
Sbjct: 125 VVFMAPTKPLVTQQMEACFHVMGIPQSHMAEMTGSTQAVNRKEIWSSRRVLFLTPQVMVN 184

Query: 216 DIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQ 275
           D+  G     ++ CLV+DEAH+A GNYAYC  +REL+      RILAL+ATPGS  + +Q
Sbjct: 185 DLTRGAVPATHVKCLVVDEAHKALGNYAYCQVVRELVKYTTHFRILALSATPGSDIKAVQ 244

Query: 276 HIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLS 335
            +I NL I  +E R+E   D+  Y H R++E + V +G+E   I     +++  + S L 
Sbjct: 245 QVITNLLIGKIELRSEESPDILPYSHERRVEKLVVPLGEELGAIQKTYIQILETFASSLI 304

Query: 336 AIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSS 395
              +L  RD   L+   ++ +RD+FR+ P PN+  I+ G +E  F   I+LYH   LL  
Sbjct: 305 HRNVLMKRDIPNLTKYQIILARDQFRKNPSPNIVGIQQGIIEGEFALCISLYHGYELLQQ 364

Query: 396 HGIRPAYEMLE---EKLKQGSFARF-MSKNEDIRKVKLLMQQSISHGAQS---------- 441
            G+R  Y  L    +  K  + AR  +S+NED  K+   +Q + +  + S          
Sbjct: 365 MGMRSLYFFLSGIMDGTKGMTRARNELSRNEDFMKLYTHLQSAFAPASTSDASAFQRGNK 424

Query: 442 --------PKLSKMLEVLVDHFKTKDPK--------HSRVIIFSNFRGSVRDIMNALATI 485
                   PKL K+ EV+++HFK+ + K         SRV+IFS+FR SV +I   L   
Sbjct: 425 EKKFVYSHPKLKKLEEVILEHFKSWNAKATTEKKCHESRVMIFSSFRDSVEEIAEMLLQH 484

Query: 486 GDLVKATEFIGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVI 545
             +++   F+G +SGK +KG +QK Q  V+ +FR GGYN +V+T +GEEGLDI EVDL+I
Sbjct: 485 RPVIRVMTFVGHASGKNTKGFTQKEQLQVVRQFRDGGYNTLVSTCVGEEGLDIGEVDLII 544

Query: 546 CFDANVSPLRMIQRMGRTGRKHDGRI 571
           CFDA  SP+R+IQRMGRTGRK  GRI
Sbjct: 545 CFDAQKSPIRLIQRMGRTGRKRQGRI 570
ATPase required for FANCD2 ubiquitination, a key reaction in DNA repair. Binds to ssDNA but not to dsDNA. Recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2 Back     alignment and function description
>sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph-1 PE=3 SV=1 Back     alignment and function description
>sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 Back     alignment and function description
>sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 Back     alignment and function description
>sp|Q9UT23|MFH1_SCHPO ATP-dependent DNA helicase mfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfh1 PE=3 SV=2 Back     alignment and function description
>sp|A1CS00|MPH1_ASPCL ATP-dependent DNA helicase mph1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mph1 PE=3 SV=1 Back     alignment and function description
>sp|A1D4V5|MPH1_NEOFI ATP-dependent DNA helicase MPH1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mph1 PE=3 SV=1 Back     alignment and function description
>sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 Back     alignment and function description
>sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase mph1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1165
255571736 1351 protein with unknown function [Ricinus c 0.931 0.803 0.648 0.0
296081072 1448 unnamed protein product [Vitis vinifera] 0.950 0.764 0.564 0.0
15219634 1324 fanconi anemia group M protein [Arabidop 0.937 0.824 0.553 0.0
297846616 1321 hypothetical protein ARALYDRAFT_473682 [ 0.916 0.808 0.546 0.0
390132011 1344 Fanconia anemia complementation group M- 0.931 0.807 0.539 0.0
334183045 1390 fanconi anemia group M protein [Arabidop 0.941 0.789 0.525 0.0
3565235641262 PREDICTED: ATP-dependent DNA helicase MP 0.884 0.816 0.535 0.0
8778360 1587 F15O4.40 [Arabidopsis thaliana] 0.936 0.687 0.474 0.0
449442122 1384 PREDICTED: uncharacterized protein LOC10 0.474 0.399 0.726 0.0
357152779 1395 PREDICTED: uncharacterized protein LOC10 0.859 0.717 0.420 0.0
>gi|255571736|ref|XP_002526811.1| protein with unknown function [Ricinus communis] gi|223533815|gb|EEF35546.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
 Score = 1397 bits (3617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1142 (64%), Positives = 871/1142 (76%), Gaps = 57/1142 (4%)

Query: 22   AAVREIDTACQS----SKPSTSNSTNFNLCSKANKKPSTCKQSTLDKFFGNL---GPKPQ 74
            AAVREID AC++    ++PS+S S N NL +   KKP  CKQSTL++F G      P P 
Sbjct: 22   AAVREIDVACENANLQTEPSSSRSEN-NLSNVILKKPGACKQSTLERFIGKTVRPDPPPG 80

Query: 75   GTEEFNEGSSFDESLCHVQIDAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGL 134
                 ++    +  +  ++IDAEAAKTWIYPVNVPVRDYQ AITKTALFSNTLVALPTGL
Sbjct: 81   NPTVIDD----ENGVSCIEIDAEAAKTWIYPVNVPVRDYQLAITKTALFSNTLVALPTGL 136

Query: 135  GKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPT 194
            GKTLIAAVV+YN+FRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQ+SP 
Sbjct: 137  GKTLIAAVVMYNYFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQLSPA 196

Query: 195  KRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSV 254
            KRA FWKTKR+FFVTPQVLEKDIQ+GTCL+K+LVCLVIDEAHRA GNY+YC A+ ELM+V
Sbjct: 197  KRACFWKTKRMFFVTPQVLEKDIQAGTCLVKHLVCLVIDEAHRALGNYSYCVAVCELMAV 256

Query: 255  PVQLRILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQ 314
            P+QLRILALTATPGSKQQ IQHIIDNL+ISTLEYRNE D DV  YVHNRKIELIEV +G+
Sbjct: 257  PIQLRILALTATPGSKQQAIQHIIDNLHISTLEYRNEGDADVVPYVHNRKIELIEVALGK 316

Query: 315  EAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFG 374
            +AV+IN ++  VI PY +RLSA+GLLQNRDY+T+ P DLLNSRDKFR+APP  LPQ K+G
Sbjct: 317  DAVDINKQLLAVIHPYVARLSAVGLLQNRDYKTVCPPDLLNSRDKFRRAPPSELPQNKYG 376

Query: 375  EVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQS 434
            E+EAYF  LITLYHIR+LLSSHGIRPAYEMLEEKLKQGSFAR MSKNEDIRKVKL MQQS
Sbjct: 377  EIEAYFAGLITLYHIRKLLSSHGIRPAYEMLEEKLKQGSFARLMSKNEDIRKVKLSMQQS 436

Query: 435  ISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEF 494
            +SHGA SPKLSKMLE+L DHFK KDP++SRVIIFSNFRGSVRDIM+AL  I ++VKATEF
Sbjct: 437  LSHGAPSPKLSKMLEILTDHFKAKDPQNSRVIIFSNFRGSVRDIMDALTNIENVVKATEF 496

Query: 495  IGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPL 554
            IGQSSGKA KGQSQKVQQAVLEKFRAG YNVIVATSIGEEGLDIMEVDLVICFDANVSPL
Sbjct: 497  IGQSSGKALKGQSQKVQQAVLEKFRAGKYNVIVATSIGEEGLDIMEVDLVICFDANVSPL 556

Query: 555  RMIQRMGRTGRKHDGRIPHIFKPEVQFVELSIEQYVSRGKKVKDDHAITTPIFKEKLTAA 614
            RMIQRMGRTGRKHDGRIPH+ KPEVQFV+LSIEQY+ RGKK+KDD+AI TP+F+ KL  A
Sbjct: 557  RMIQRMGRTGRKHDGRIPHVLKPEVQFVKLSIEQYIPRGKKLKDDNAIRTPVFESKLNVA 616

Query: 615  ETDLIAKYFHPTSDSTWRPSLIAFPHFQALPSRVHKVMHSFRTGMLIDMMQHLQGLTFSR 674
            E  LIAKYFHPTS+ +WRPSLIAFPHFQA PSRVHKVMHS RT MLID MQ LQ L FSR
Sbjct: 617  EASLIAKYFHPTSEKSWRPSLIAFPHFQAFPSRVHKVMHSCRTDMLIDTMQCLQNLLFSR 676

Query: 675  D-DRTFVEDEVSSDKHLGLQTVEPCETDERDNFH------GTK---KVTDSELSTRTLGT 724
            +     +EDE++S K LG    +  E + +++ H       TK   KV DSE+S      
Sbjct: 677  ERGDLIIEDEIASGKCLG----DNKENNNKEDPHLWVDSPSTKPQEKVEDSEVSPLKTPR 732

Query: 725  QENHSMPQSCCKSPAAHAYLFGSDFISVDALGKVLIISVPALPFKELSHSKKKRAPDTLL 784
             E H++     +S  AHAYLF SDF+SVDALGKV+I+SVP +P KE  H K   +P T  
Sbjct: 733  SEKHNVLDLHGQSSPAHAYLFSSDFVSVDALGKVIILSVPVVPLKEAIHCKFT-SPST-- 789

Query: 785  LNHWKQDSSPLKTSDKNYDELTVQSKAVEELTTSQAACIKDGALPISRFCRSDALPEKPL 844
                 Q+   LK  D+N  ELTVQ+K+  +L TS A    + AL I    +S+A  +K  
Sbjct: 790  -----QNPCHLKAPDENDKELTVQNKSRPDLITSLAQHEINVALTIP---KSNAQEDKIS 841

Query: 845  DGFEEILDSPVLRRNQLREEDTTDETLDVNEIKEPLSPDDEYHNDLRDSELSPRLTNLIK 904
            +  E I ++P+++   L   D  DETLD  EIK P    DEY+N     E SPRLTN+I+
Sbjct: 842  NRVEVIPETPLVKNTLLSGGDFVDETLDCLEIKAPPLQADEYNN----IEWSPRLTNMIQ 897

Query: 905  SGVVPESPINENGASNNKGRN----PDLASPVKLCSIQPSKFASLGKTEKCSKYVRASQG 960
            SGVVPESPIN+ G SN+KGR+     D+ SP+K C+    +  S  K E+      A Q 
Sbjct: 898  SGVVPESPINDIGWSNSKGRSKFLTTDVISPMKSCNDLQPRSPSQWKNERAINN-SACQR 956

Query: 961  NVSISPVNKKIQTPLLKMNHTASAGGYSPTSPIAEETKTPLANLANSSCSRDWRLSSGDK 1020
            N+ +S +N  +QTPL+K N+ A  GG +  SP A+ET T        +CS+DW LSSGDK
Sbjct: 957  NLLVSSINNAMQTPLVKENNVARTGGCTSISPAADETYT--------NCSKDWVLSSGDK 1008

Query: 1021 SENVEPARKFKRLRKVRDCEQNKNSENMKENAVAPVVNLARRFLGMSPIQNKHGRGRKKP 1080
            SENV+   KF+RLRK+ D E+N+N+++ KE     +VNL R F G+SP Q + G+G+ K 
Sbjct: 1009 SENVKQVHKFRRLRKIGDIERNRNAQDKKEKT---LVNLDRSFSGISPNQIRRGKGKMKQ 1065

Query: 1081 MDNMREYIEEEAEVSSEAEVSDDEEDDEDNNSYDDSFIDDRMNPTATSTQAESSGVDMMA 1140
               +  +IEEEAEVSSEAE+SDDEED++ N+SYDDSFIDDR NPTA STQAE+S VDMMA
Sbjct: 1066 NGKIMAFIEEEAEVSSEAEISDDEEDEQGNSSYDDSFIDDRTNPTAASTQAENSRVDMMA 1125

Query: 1141 IY 1142
            IY
Sbjct: 1126 IY 1127

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296081072|emb|CBI18266.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15219634|ref|NP_174785.1| fanconi anemia group M protein [Arabidopsis thaliana] gi|332193685|gb|AEE31806.1| fanconi anemia group M protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297846616|ref|XP_002891189.1| hypothetical protein ARALYDRAFT_473682 [Arabidopsis lyrata subsp. lyrata] gi|297337031|gb|EFH67448.1| hypothetical protein ARALYDRAFT_473682 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|390132011|gb|AFL55357.1| Fanconia anemia complementation group M-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334183045|ref|NP_001185141.1| fanconi anemia group M protein [Arabidopsis thaliana] gi|332193686|gb|AEE31807.1| fanconi anemia group M protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356523564|ref|XP_003530407.1| PREDICTED: ATP-dependent DNA helicase MPH1-like [Glycine max] Back     alignment and taxonomy information
>gi|8778360|gb|AAF79368.1|AC007887_27 F15O4.40 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449442122|ref|XP_004138831.1| PREDICTED: uncharacterized protein LOC101221910 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357152779|ref|XP_003576233.1| PREDICTED: uncharacterized protein LOC100835661 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1165
UNIPROTKB|F1SI11 2054 FANCM "Uncharacterized protein 0.291 0.165 0.447 5e-104
UNIPROTKB|E2RNF7 2047 FANCM "Uncharacterized protein 0.341 0.194 0.420 5.1e-104
MGI|MGI:2442306 2021 Fancm "Fanconi anemia, complem 0.296 0.171 0.44 7.2e-104
UNIPROTKB|Q8IYD8 2048 FANCM "Fanconi anemia group M 0.278 0.158 0.467 8.2e-104
UNIPROTKB|J9P777 2048 FANCM "Uncharacterized protein 0.341 0.194 0.420 1.3e-103
UNIPROTKB|A4RN081102 MPH1 "ATP-dependent DNA helica 0.446 0.471 0.405 1.8e-101
ZFIN|ZDB-GENE-090929-1 1761 fancm "Fanconi anemia, complem 0.393 0.260 0.415 1.3e-97
POMBASE|SPAC9.05834 fml1 "ATP-dependent 3' to 5' D 0.420 0.587 0.393 1.8e-94
UNIPROTKB|B2RTQ9 2022 FANCM "FANCM protein" [Homo sa 0.133 0.077 0.583 1e-90
POMBASE|SPAC20H4.04783 fml2 "ATP-dependent 3' to 5' D 0.405 0.602 0.401 4.4e-90
UNIPROTKB|F1SI11 FANCM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 771 (276.5 bits), Expect = 5.0e-104, Sum P(6) = 5.0e-104
 Identities = 154/344 (44%), Positives = 209/344 (60%)

Query:    98 AAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIV 157
             A   WIYP N PVRDYQ  I +TALF NTLV LPTGLGKT IAAVV+YNF+RWFP GK+V
Sbjct:    88 AGALWIYPTNCPVRDYQLNIARTALFCNTLVCLPTGLGKTFIAAVVMYNFYRWFPSGKVV 147

Query:   158 FAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDI 217
             F AP++PLV QQIEAC+ ++GIPQ    +MTG      R   W +KRV F+TPQV+  D+
Sbjct:   148 FMAPTKPLVTQQIEACYRVMGIPQSHMAEMTGSTQVFTRKEIWDSKRVLFLTPQVMVNDL 207

Query:   218 QSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHI 277
               G C    + CLVIDEAHRA GNYAYC  +REL+      RILAL+ATPGS  + +Q +
Sbjct:   208 SRGACPAAEIKCLVIDEAHRALGNYAYCQVVRELVKYTNHFRILALSATPGSDIKAVQQV 267

Query:   278 IDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAI 337
             I NL I  +E R+E   D+  Y H R++E + V + +E   I     +++  +   L   
Sbjct:   268 ITNLLIEQIELRSEDAPDILPYSHERRVEKLVVPLSEELAAIQKAYIQILEAFAHSLIQR 327

Query:   338 GLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHG 397
              +L  RD   L+   ++ +RD+FR+ P PN+  ++ G +E  F   I+LYH   LL   G
Sbjct:   328 NVLMRRDIPNLTKYQIILARDQFRKNPSPNIVGMQQGIIEGEFAICISLYHGYELLQQMG 387

Query:   398 IRPAYEML---EEKLKQGSFARF-MSKNEDIRKVKLLMQQSISH 437
             +R  Y  L    +  K  + A+  +S+NED  K+   ++   +H
Sbjct:   388 MRSLYFFLCGIMDGTKGMTRAKNELSRNEDFMKLYNHLEYMFAH 431
GO:0071821 "FANCM-MHF complex" evidence=IEA
GO:0043240 "Fanconi anaemia nuclear complex" evidence=IEA
GO:0031297 "replication fork processing" evidence=IEA
GO:0003682 "chromatin binding" evidence=IEA
GO:0000712 "resolution of meiotic recombination intermediates" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0004518 "nuclease activity" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
UNIPROTKB|E2RNF7 FANCM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2442306 Fancm "Fanconi anemia, complementation group M" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IYD8 FANCM "Fanconi anemia group M protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P777 FANCM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A4RN08 MPH1 "ATP-dependent DNA helicase MPH1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090929-1 fancm "Fanconi anemia, complementation group M" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPAC9.05 fml1 "ATP-dependent 3' to 5' DNA helicase, FANCM ortholog Fml1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|B2RTQ9 FANCM "FANCM protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC20H4.04 fml2 "ATP-dependent 3' to 5' DNA helicase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.737
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT1G35530
DEAD/DEAH box helicase, putative; DEAD/DEAH box helicase, putative; FUNCTIONS IN- in 6 functions; LOCATED IN- cellular_component unknown; EXPRESSED IN- 17 plant structures; EXPRESSED DURING- 10 growth stages; CONTAINS InterPro DOMAIN/s- Restriction endonuclease, type I, R subunit/Type III, Res subunit (InterPro-IPR006935), DEAD-like helicase, N-terminal (InterPro-IPR014001), DNA/RNA helicase, C-terminal (InterPro-IPR001650), Helicase, superfamily 1 and 2, ATP-binding (InterPro-IPR014021); BEST Arabidopsis thaliana protein match is- unknown protein (TAIR-AT1G36020.1); Has 13052 Blast hi [...] (1324 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT4G10680
transcription factor IIB (TFIIB) family protein; transcription factor IIB (TFIIB) family protei [...] (182 aa)
  •     0.424
PAG1
PAG1; endopeptidase/ peptidase/ threonine-type endopeptidase; Encodes 20S proteasome subunit PA [...] (249 aa)
  •     0.403

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1165
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-149
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 1e-106
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-22
cd12091122 cd12091, FANCM_ID, insert domain of FANCM helicase 5e-20
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-18
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 3e-18
smart0049082 smart00490, HELICc, helicase superfamily c-termina 7e-18
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 9e-15
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-13
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 4e-10
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 3e-09
COG1201814 COG1201, Lhr, Lhr-like helicases [General function 2e-08
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-06
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 5e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-05
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 7e-05
COG1204766 COG1204, COG1204, Superfamily II helicase [General 8e-05
COG1205851 COG1205, COG1205, Distinct helicase family with a 8e-05
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 1e-04
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-04
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 2e-04
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-04
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 3e-04
PRK01172674 PRK01172, PRK01172, ski2-like helicase; Provisiona 5e-04
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase C 0.001
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 0.001
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 0.002
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 0.002
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  459 bits (1183), Expect = e-149
 Identities = 199/483 (41%), Positives = 281/483 (58%), Gaps = 15/483 (3%)

Query: 95  DAEAAKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDG 154
           D  AA   I P  +  R YQ  I   ALF NTLV LPTGLGKT IAA+VI N  RWF  G
Sbjct: 1   DEYAAHPLIKPNTIEPRLYQLNIAAKALFKNTLVVLPTGLGKTFIAAMVIANRLRWFG-G 59

Query: 155 KIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLE 214
           K++F AP++PLV+Q  E C  + GIP++    +TG++ P +R   W  K+VF  TPQV+E
Sbjct: 60  KVLFLAPTKPLVLQHAEFCRKVTGIPEDEIAALTGEVRPEEREELWAKKKVFVATPQVVE 119

Query: 215 KDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTI 274
            D+++G   +  +  L+ DEAHRA GNYAY    +E +       IL LTA+PGS  + I
Sbjct: 120 NDLKAGRIDLDDVSLLIFDEAHRAVGNYAYVFVAKEYLRSAKNPLILGLTASPGSDLEKI 179

Query: 275 QHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRL 334
           Q +++NL I  +E R E D DV  YV   K+E I+V++ +E  EI + + + ++P    L
Sbjct: 180 QEVVENLGIEKVEVRTEEDPDVRPYVKKIKVEWIKVDLPEEIKEIRDLLRDALKPRLKPL 239

Query: 335 SAIGLLQNRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLS 394
             +G++++     +S  DLL  R         N    KF  + +     I L H   LL 
Sbjct: 240 KELGVIESSS--PVSKKDLLELRQIRLIM-AKNEDSDKF-RLLSVLAEAIKLAHALELLE 295

Query: 395 SHGIRPAY----EMLEEKLKQGSFA--RFMSKNEDIRKVKLLMQQSISHGAQSPKLSKML 448
           + GIRP Y    ++ EE  K GS A    ++     R ++LL++   S G + PKL K+ 
Sbjct: 296 TQGIRPFYQYLEKLEEEATKGGSKAAKSLLADPYFKRALRLLIRADES-GVEHPKLEKLR 354

Query: 449 EVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQSSGKASKGQSQ 508
           E+L +  +      SRVI+F+ +R +  +I+N L  IG   +   FIGQ+S +  KG SQ
Sbjct: 355 EILKEQLEKNG--DSRVIVFTEYRDTAEEIVNFLKKIGIKARV-RFIGQASREGDKGMSQ 411

Query: 509 KVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHD 568
           K Q+ ++++FR G YNV+VATS+GEEGLDI EVDLVI ++   S +R IQR GRTGRK  
Sbjct: 412 KEQKEIIDQFRKGEYNVLVATSVGEEGLDIPEVDLVIFYEPVPSEIRSIQRKGRTGRKRK 471

Query: 569 GRI 571
           GR+
Sbjct: 472 GRV 474

Length = 542
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|213060 cd12091, FANCM_ID, insert domain of FANCM helicase and similar proteins Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1165
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0354746 consensus DEAD-box like helicase [General function 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110545 helicase; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK13766773 Hef nuclease; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG4284980 consensus DEAD box protein [Transcription] 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
PLN031421033 Probable chromatin-remodeling complex ATPase chain 100.0
PRK13767876 ATP-dependent helicase; Provisional 100.0
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
PRK04914956 ATP-dependent helicase HepA; Validated 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0387923 consensus Transcription-coupled repair protein CSB 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
KOG03841373 consensus Chromodomain-helicase DNA-binding protei 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.98
COG1201814 Lhr Lhr-like helicases [General function predictio 99.98
COG1205851 Distinct helicase family with a unique C-terminal 99.98
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.97
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.97
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.97
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.96
COG1204766 Superfamily II helicase [General function predicti 99.96
PHA02653675 RNA helicase NPH-II; Provisional 99.96
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.96
COG1202830 Superfamily II helicase, archaea-specific [General 99.96
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.96
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 99.96
PRK09401 1176 reverse gyrase; Reviewed 99.96
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.96
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.96
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.96
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.95
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.95
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.95
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.95
KOG4439901 consensus RNA polymerase II transcription terminat 99.95
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.95
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.95
PRK14701 1638 reverse gyrase; Provisional 99.95
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.94
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.94
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.94
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.93
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.93
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.93
PRK05580679 primosome assembly protein PriA; Validated 99.93
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.93
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.91
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.91
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.91
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.91
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.9
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.9
KOG09481041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.9
COG4096875 HsdR Type I site-specific restriction-modification 99.89
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.89
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.89
PRK09694878 helicase Cas3; Provisional 99.89
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.89
KOG09471248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.88
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.87
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.87
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.87
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.87
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.87
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.86
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.86
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.85
KOG1123776 consensus RNA polymerase II transcription initiati 99.83
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.82
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.8
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.8
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 99.78
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 99.77
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.76
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.75
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 99.74
PRK05298652 excinuclease ABC subunit B; Provisional 99.74
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 99.73
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.72
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.71
smart00487201 DEXDc DEAD-like helicases superfamily. 99.7
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.69
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.69
KOG1001674 consensus Helicase-like transcription factor HLTF/ 99.68
COG4889 1518 Predicted helicase [General function prediction on 99.68
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.67
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 99.64
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 99.64
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.63
COG11101187 Reverse gyrase [DNA replication, recombination, an 99.63
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.63
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.62
KOG10161387 consensus Predicted DNA helicase, DEAD-box superfa 99.59
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.58
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.57
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 99.57
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.53
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.52
KOG09261172 consensus DEAH-box RNA helicase [RNA processing an 99.5
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 99.49
COG0610962 Type I site-specific restriction-modification syst 99.48
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.45
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 99.37
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.36
smart0049082 HELICc helicase superfamily c-terminal domain. 99.36
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 99.36
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.35
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.31
PRK14873665 primosome assembly protein PriA; Provisional 99.28
KOG0383696 consensus Predicted helicase [General function pre 99.21
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.18
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.12
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.1
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.07
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 98.99
PF02399824 Herpes_ori_bp: Origin of replication binding prote 98.92
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.88
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.83
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.83
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.81
KOG09211282 consensus Dosage compensation complex, subunit MLE 98.54
PRK15483986 type III restriction-modification system StyLTI en 98.51
COG3587985 Restriction endonuclease [Defense mechanisms] 98.43
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.3
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.19
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.15
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.11
KOG02981394 consensus DEAD box-containing helicase-like transc 98.02
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.91
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.87
KOG2340698 consensus Uncharacterized conserved protein [Funct 97.82
KOG15131300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 97.56
KOG0442892 consensus Structure-specific endonuclease ERCC1-XP 97.53
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.48
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.44
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.44
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.36
KOG1803649 consensus DNA helicase [Replication, recombination 97.32
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.24
TIGR00376637 DNA helicase, putative. The gene product may repre 97.2
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 97.04
COG3421812 Uncharacterized protein conserved in bacteria [Fun 97.0
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.95
PRK10536262 hypothetical protein; Provisional 96.91
PF1324576 AAA_19: Part of AAA domain 96.81
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.7
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.54
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.49
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.4
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 96.4
PF13871278 Helicase_C_4: Helicase_C-like 96.37
PTZ001121164 origin recognition complex 1 protein; Provisional 96.35
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.27
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.12
KOG1131755 consensus RNA polymerase II transcription initiati 96.1
PRK04296190 thymidine kinase; Provisional 95.99
PRK06526254 transposase; Provisional 95.94
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.94
KOG02981394 consensus DEAD box-containing helicase-like transc 95.92
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.89
PHA02533534 17 large terminase protein; Provisional 95.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.67
smart00382148 AAA ATPases associated with a variety of cellular 95.64
PRK00149450 dnaA chromosomal replication initiation protein; R 95.5
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.5
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.49
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.46
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.42
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.36
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.3
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.29
PRK14086617 dnaA chromosomal replication initiation protein; P 95.29
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.11
PLN03025319 replication factor C subunit; Provisional 95.03
KOG18051100 consensus DNA replication helicase [Replication, r 95.01
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.0
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.98
PRK08181269 transposase; Validated 94.84
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 94.8
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.74
PRK14974336 cell division protein FtsY; Provisional 94.69
PRK08727233 hypothetical protein; Validated 94.68
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 94.65
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 94.58
PRK14087450 dnaA chromosomal replication initiation protein; P 94.5
PRK07952244 DNA replication protein DnaC; Validated 94.5
PRK13889988 conjugal transfer relaxase TraA; Provisional 94.49
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 94.45
PRK08084235 DNA replication initiation factor; Provisional 94.41
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.32
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 94.2
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.16
PRK12377248 putative replication protein; Provisional 94.16
PRK06893229 DNA replication initiation factor; Validated 94.14
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.08
PRK06835329 DNA replication protein DnaC; Validated 94.07
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.04
PRK05707328 DNA polymerase III subunit delta'; Validated 94.02
PRK05642234 DNA replication initiation factor; Validated 94.0
PRK14088440 dnaA chromosomal replication initiation protein; P 93.91
COG4626546 Phage terminase-like protein, large subunit [Gener 93.86
PRK138261102 Dtr system oriT relaxase; Provisional 93.83
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.82
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.6
PRK11773721 uvrD DNA-dependent helicase II; Provisional 93.59
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 93.53
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.53
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 93.53
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 93.49
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.48
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 93.46
PRK12402337 replication factor C small subunit 2; Reviewed 93.42
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.41
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 93.38
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.31
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 93.28
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 93.14
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.13
PRK08116268 hypothetical protein; Validated 93.09
PRK08769319 DNA polymerase III subunit delta'; Validated 92.93
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.84
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.75
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.74
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 92.73
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 92.72
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 92.65
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 92.61
PRK06964342 DNA polymerase III subunit delta'; Validated 92.59
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.53
PRK11054684 helD DNA helicase IV; Provisional 92.52
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 92.46
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 92.32
COG2256436 MGS1 ATPase related to the helicase subunit of the 92.32
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.3
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 92.16
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.14
PRK106891147 transcription-repair coupling factor; Provisional 91.92
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.89
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.89
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 91.88
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 91.87
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 91.79
PRK09112351 DNA polymerase III subunit delta'; Validated 91.71
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 91.63
PF00004132 AAA: ATPase family associated with various cellula 91.61
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 91.58
PRK00771437 signal recognition particle protein Srp54; Provisi 91.53
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 91.38
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 91.32
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 91.27
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 91.17
PRK12422445 chromosomal replication initiation protein; Provis 91.14
PHA03368738 DNA packaging terminase subunit 1; Provisional 91.12
PF13173128 AAA_14: AAA domain 91.0
PRK06871325 DNA polymerase III subunit delta'; Validated 90.93
PRK00440319 rfc replication factor C small subunit; Reviewed 90.87
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 90.83
PRK06090319 DNA polymerase III subunit delta'; Validated 90.73
PRK07940394 DNA polymerase III subunit delta'; Validated 90.63
PHA03333752 putative ATPase subunit of terminase; Provisional 90.6
COG0470325 HolB ATPase involved in DNA replication [DNA repli 90.38
PRK13342413 recombination factor protein RarA; Reviewed 90.38
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 90.37
PRK07471365 DNA polymerase III subunit delta'; Validated 90.28
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 90.23
PRK06921266 hypothetical protein; Provisional 90.21
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 90.11
PHA02544316 44 clamp loader, small subunit; Provisional 90.07
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 90.06
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 89.99
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 89.95
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 89.8
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 89.79
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 89.78
PRK08903227 DnaA regulatory inactivator Hda; Validated 89.71
PRK08939306 primosomal protein DnaI; Reviewed 89.67
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 89.67
PTZ00293211 thymidine kinase; Provisional 89.61
COG3973747 Superfamily I DNA and RNA helicases [General funct 89.42
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.19
COG0593408 DnaA ATPase involved in DNA replication initiation 88.94
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 88.89
CHL00181287 cbbX CbbX; Provisional 88.71
PRK05580679 primosome assembly protein PriA; Validated 88.67
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 88.6
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 88.54
COG11971139 Mfd Transcription-repair coupling factor (superfam 88.34
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 87.99
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.95
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 87.89
PRK09183259 transposase/IS protein; Provisional 87.85
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 87.75
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 87.66
TIGR00595505 priA primosomal protein N'. All proteins in this f 87.65
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 87.35
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 87.25
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 87.22
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 87.09
PRK13341725 recombination factor protein RarA/unknown domain f 87.05
PRK07993334 DNA polymerase III subunit delta'; Validated 87.0
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 86.77
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 86.65
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 86.6
PRK07399314 DNA polymerase III subunit delta'; Validated 86.59
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 86.37
PRK10416318 signal recognition particle-docking protein FtsY; 86.36
PRK04195482 replication factor C large subunit; Provisional 86.34
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 86.31
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 86.31
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 86.26
PRK13894319 conjugal transfer ATPase TrbB; Provisional 85.9
TIGR00064272 ftsY signal recognition particle-docking protein F 85.81
PRK06904472 replicative DNA helicase; Validated 85.76
PRK08699325 DNA polymerase III subunit delta'; Validated 85.72
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 85.63
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 85.33
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 85.27
PRK13833323 conjugal transfer protein TrbB; Provisional 85.23
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 85.22
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 84.67
PRK08506472 replicative DNA helicase; Provisional 84.46
PRK102631355 DNA translocase FtsK; Provisional 84.4
TIGR00643630 recG ATP-dependent DNA helicase RecG. 84.34
PRK11331459 5-methylcytosine-specific restriction enzyme subun 84.22
PRK11823446 DNA repair protein RadA; Provisional 84.15
PRK08058329 DNA polymerase III subunit delta'; Validated 84.08
PRK06067234 flagellar accessory protein FlaH; Validated 84.07
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 83.96
TIGR02012321 tigrfam_recA protein RecA. This model describes or 83.95
PRK08533230 flagellar accessory protein FlaH; Reviewed 83.67
TIGR02688449 conserved hypothetical protein TIGR02688. Members 83.54
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 83.37
PHA00012361 I assembly protein 82.74
PRK03992389 proteasome-activating nucleotidase; Provisional 82.72
cd03115173 SRP The signal recognition particle (SRP) mediates 82.68
COG3972660 Superfamily I DNA and RNA helicases [General funct 82.53
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 82.53
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 82.4
COG2255332 RuvB Holliday junction resolvasome, helicase subun 82.39
CHL00095821 clpC Clp protease ATP binding subunit 82.24
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 82.08
PF05729166 NACHT: NACHT domain 82.03
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 81.92
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 81.6
PRK14873665 primosome assembly protein PriA; Provisional 81.09
cd00983325 recA RecA is a bacterial enzyme which has roles in 81.02
PRK09354349 recA recombinase A; Provisional 80.71
KOG2028554 consensus ATPase related to the helicase subunit o 80.52
TIGR00959428 ffh signal recognition particle protein. This mode 80.24
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=7.7e-60  Score=534.29  Aligned_cols=470  Identities=40%  Similarity=0.661  Sum_probs=410.2

Q ss_pred             HCCCCCCCCCCChHHHHHHHHHhhcCCeEEEcCCCchHHHHHHHHHHHHHHhCCCCeEEEEecChhHHHHHHHHHHHHhC
Q 037446           99 AKTWIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVG  178 (1165)
Q Consensus        99 ~~g~~~Pt~IQlr~yQ~eal~~ll~rnvIl~a~TGsGKTL~a~lpil~~L~~~~~~rvLILvPtr~La~Q~~~e~~kl~g  178 (1165)
                      ...|.+|..+++|.||..+...++.+|+|++.|||+|||+++++.|..++.+.++ ++||++||+.|+.|+++.|++.+|
T Consensus         5 ~~~~i~p~~ie~R~YQ~~i~a~al~~NtLvvlPTGLGKT~IA~~V~~~~l~~~~~-kvlfLAPTKPLV~Qh~~~~~~v~~   83 (542)
T COG1111           5 AHPLIKPNTIEPRLYQLNIAAKALFKNTLVVLPTGLGKTFIAAMVIANRLRWFGG-KVLFLAPTKPLVLQHAEFCRKVTG   83 (542)
T ss_pred             hccccccccccHHHHHHHHHHHHhhcCeEEEecCCccHHHHHHHHHHHHHHhcCC-eEEEecCCchHHHHHHHHHHHHhC
Confidence            4568899999999999999999999999999999999999999999999999877 999999999999999999999999


Q ss_pred             CCCceEEEEeCCCChHHHHhhcCCccEEEEcHHHHHHHHHcCccCCCCccEEEEcccccccCccchHHHHHHHHcCCCCC
Q 037446          179 IPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQL  258 (1165)
Q Consensus       179 ~~~~~v~~l~G~~~~~~~~~l~~~~dIlVaTpq~L~~~l~~~~~~l~~~~lVVIDEAHrl~~~~~~~~~l~~L~~~~~~~  258 (1165)
                      .+...++.++|.....+|...|...+|+|+|||++.+++..+.+.+.++.+||||||||..+++.|..+++.+++..+++
T Consensus        84 ip~~~i~~ltGev~p~~R~~~w~~~kVfvaTPQvveNDl~~Grid~~dv~~lifDEAHRAvGnyAYv~Va~~y~~~~k~~  163 (542)
T COG1111          84 IPEDEIAALTGEVRPEEREELWAKKKVFVATPQVVENDLKAGRIDLDDVSLLIFDEAHRAVGNYAYVFVAKEYLRSAKNP  163 (542)
T ss_pred             CChhheeeecCCCChHHHHHHHhhCCEEEeccHHHHhHHhcCccChHHceEEEechhhhccCcchHHHHHHHHHHhccCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999988999


Q ss_pred             eEEEEccCCCCChHHHHHHHHhhccccccccCCchhhhhhhhccCceEEEEeccchhHHHHHHHHHHHHhhHHHHHhhhc
Q 037446          259 RILALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIG  338 (1165)
Q Consensus       259 riL~LSATP~~~~~~l~~Li~~L~is~i~~~~~~~~~i~~y~~~~~~~~i~v~~~~~~~~i~~~l~~~i~~~~~rl~~~~  338 (1165)
                      ++|||||||+...+.++.++++|+|+.+..+++.++++..|+....++.+.+.+..+..++...+...+++.+..|...|
T Consensus       164 ~ilgLTASPGs~~ekI~eV~~nLgIe~vevrTE~d~DV~~Yv~~~kve~ikV~lp~e~~~ir~~l~~~l~~~Lk~L~~~g  243 (542)
T COG1111         164 LILGLTASPGSDLEKIQEVVENLGIEKVEVRTEEDPDVRPYVKKIKVEWIKVDLPEEIKEIRDLLRDALKPRLKPLKELG  243 (542)
T ss_pred             eEEEEecCCCCCHHHHHHHHHhCCcceEEEecCCCccHHHhhccceeEEEeccCcHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCchhhhhhhh-hhhhcCCCCCCCcccchhhHHHHHHHHHHHHHHHHHhhCCchHHHHHHHHHHhhccc---
Q 037446          339 LLQNRDYQTLSPVDLLNSR-DKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSF---  414 (1165)
Q Consensus       339 vl~~~~~~~l~p~~l~~~~-~~~~~~~~~~i~~~~~~~l~~~~~~L~~l~~i~~ll~~~g~~~~~~~L~~~~~~~~~---  414 (1165)
                      +......  +....+..+. .+....  ... ......+-..++.+..+.++.+++..+|+.+++..+.+.......   
T Consensus       244 ~~~~~~~--~~~kdl~~~~~~~~~~a--~~~-~~~~~~~l~~~a~~~kl~~a~elletqGi~~~~~Yl~~l~e~~~~~~s  318 (542)
T COG1111         244 VIESSSP--VSKKDLLELRQIRLIMA--KNE-DSDKFRLLSVLAEAIKLAHALELLETQGIRPFYQYLEKLEEEATKGGS  318 (542)
T ss_pred             ceeccCc--ccHhHHHHHHHHHHHhc--cCc-cHHHHHHHHHHHHHHHHHHHHHHHHhhChHHHHHHHHHHHHHhcccch
Confidence            8765443  3344444433 222222  111 333444555677888999999999999999999888765443221   


Q ss_pred             ---hhcccchhhHHHHHHHHHhhhccCCCChHHHHHHHHHHHhhcccCCCCCeEEEEeCchHHHHHHHHHHHhcCCCccc
Q 037446          415 ---ARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKA  491 (1165)
Q Consensus       415 ---~~ll~~~~~~~~v~~~l~~~~~~~~~s~Kl~~LlelL~~~~~~~~~~~~kvIVF~~sr~~ae~L~~~L~~~g~~i~~  491 (1165)
                         ..++.. ..+......+.........++|+..+.+++.+.++  ...+.|+|||+++|++++.+...|...|.... 
T Consensus       319 k~a~~l~~d-~~~~~al~~~~~~~~~~v~HPKl~~l~eilke~~~--k~~~~RvIVFT~yRdTae~i~~~L~~~~~~~~-  394 (542)
T COG1111         319 KAAKSLLAD-PYFKRALRLLIRADESGVEHPKLEKLREILKEQLE--KNGDSRVIVFTEYRDTAEEIVNFLKKIGIKAR-  394 (542)
T ss_pred             HHHHHHhcC-hhhHHHHHHHHHhccccCCCccHHHHHHHHHHHHh--cCCCceEEEEehhHhHHHHHHHHHHhcCCcce-
Confidence               222222 23333333333446677889999999999999985  34569999999999999999999999995444 


Q ss_pred             eeeecccccccCCCCCHHHHHHHHHHHhcCCceEEEEcccccccccccCCCEEEEeccCCCHHHHHHHHhhcCCCCCCcc
Q 037446          492 TEFIGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRI  571 (1165)
Q Consensus       492 ~~l~G~~~g~~~ggms~~eR~~il~~Fr~g~~~VLVATda~~eGLDIp~vd~VI~~D~p~S~~~yiQriGRagR~GqGki  571 (1165)
                      ..|.|+.......||+|+++.++++.|+.|+++|||||+++++|||||++|.||+|++..|++.++||+||+||...|++
T Consensus       395 ~rFiGQa~r~~~~GMsQkeQ~eiI~~Fr~Ge~nVLVaTSVgEEGLDIp~vDlVifYEpvpSeIR~IQR~GRTGR~r~Grv  474 (542)
T COG1111         395 VRFIGQASREGDKGMSQKEQKEIIDQFRKGEYNVLVATSVGEEGLDIPEVDLVIFYEPVPSEIRSIQRKGRTGRKRKGRV  474 (542)
T ss_pred             eEEeeccccccccccCHHHHHHHHHHHhcCCceEEEEcccccccCCCCcccEEEEecCCcHHHHHHHhhCccccCCCCeE
Confidence            59999988777789999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ceecChh
Q 037446          572 PHIFKPE  578 (1165)
Q Consensus       572 v~v~~~d  578 (1165)
                      ++++..+
T Consensus       475 ~vLvt~g  481 (542)
T COG1111         475 VVLVTEG  481 (542)
T ss_pred             EEEEecC
Confidence            8777654

>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG0442 consensus Structure-specific endonuclease ERCC1-XPF, catalytic component XPF/ERCC4 [Replication, recombination and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1165
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 1e-63
4a2w_A936 Structure Of Full-Length Duck Rig-I Length = 936 2e-15
4a2q_A797 Structure Of Duck Rig-I Tandem Cards And Helicase D 4e-15
4a2p_A556 Structure Of Duck Rig-I Helicase Domain Length = 55 9e-15
3tmi_A695 Structural Basis For Rna Recognition And Activation 4e-11
2ykg_A696 Structural Insights Into Rna Recognition By Rig-I L 8e-11
4ay2_A687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 2e-10
4gl2_A699 Structural Basis For Dsrna Duplex Backbone Recognit 4e-07
4i1s_A243 Melanoma Differentiation Associated Protein-5 Helic 1e-06
3tbk_A555 Mouse Rig-I Atpase Domain Length = 555 1e-05
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 9e-05
3v4r_A667 Crystal Structure Of A Uvrb Dimer-Dna Complex Lengt 2e-04
2d7d_A661 Structural Insights Into The Cryptic Dna Dependent 2e-04
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-04
2jgn_A185 Ddx3 Helicase Domain Length = 185 4e-04
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 7e-04
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure 
Iteration: 1

 Score =  241 bits (616), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 154/471 (32%), Positives = 251/471 (53%), Gaps = 23/471 (4%)
Query: 111 RDYQFAITKTALFSNTLVALPTGLGKTLIAAVVI-YNFFRWFPDGKIVFAAPSRPLVMQQ 169
           R YQ  I      +N L+ LPTGLGKTLIA ++  Y   ++   GK++  AP++PLV+Q 
Sbjct: 11  RIYQEVIYAKCKETNCLIVLPTGLGKTLIAMMIAEYRLTKY--GGKVLMLAPTKPLVLQH 68
Query: 170 IEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVC 229
            E+   +  +P E  + +TG+ SP +R+  W   +V   TPQ +E D+ +G   ++ +  
Sbjct: 69  AESFRRLFNLPPEKIVALTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRISLEDVSL 128
Query: 230 LVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLYISTLEYR 289
           +V DEAHRA GNYAY    RE         ++ LTA+PGS  + I  +I+NL I  +EYR
Sbjct: 129 IVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASPGSTPEKIMEVINNLGIEHIEYR 188
Query: 290 NESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLS 349
           +E+  DV  YV   + E + V++ +   E+   + E++R     L+  GLL++      S
Sbjct: 189 SENSPDVRPYVKGIRFEWVRVDLPEIYKEVRKLLREMLRDALKPLAETGLLES------S 242
Query: 350 PVDLLNSRDKFRQAPPPNLPQIK----FGEVEAYFGALITLYHIRRLLSSHG---IRPAY 402
             D +  ++  R     N    K       +  Y    + L+H   LL + G   +R   
Sbjct: 243 SPD-IPKKEVLRAGQIINEEMAKGNHDLRGLLLYHAMALKLHHAIELLETQGLSALRAYI 301
Query: 403 EMLEEKLKQGS--FARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDP 460
           + L E+ K GS   ++ +  ++ ++K   L+ Q+   G   PK+ K+ E++ +  + K  
Sbjct: 302 KKLYEEAKAGSTKASKEIFSDKRMKKAISLLVQAKEIGLDHPKMDKLKEIIREQLQRK-- 359
Query: 461 KHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIXXXXXXXXXXXXXXXXXXXLEKFRA 520
           ++S++I+F+N+R + + I+N L  + D +KA  F+                   L++F  
Sbjct: 360 QNSKIIVFTNYRETAKKIVNEL--VKDGIKAKRFVGQASKENDRGLSQREQKLILDEFAR 417
Query: 521 GGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRI 571
           G +NV+VATS+GEEGLD+ EVDLV+ ++   S +R IQR GRTGR   GR+
Sbjct: 418 GEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGRHMPGRV 468
>pdb|4A2W|A Chain A, Structure Of Full-Length Duck Rig-I Length = 936 Back     alignment and structure
>pdb|4A2Q|A Chain A, Structure Of Duck Rig-I Tandem Cards And Helicase Domain Length = 797 Back     alignment and structure
>pdb|4A2P|A Chain A, Structure Of Duck Rig-I Helicase Domain Length = 556 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure
>pdb|4I1S|A Chain A, Melanoma Differentiation Associated Protein-5 Helicase Domain Complex With Inhibitor Non-structural Protein V Length = 243 Back     alignment and structure
>pdb|3TBK|A Chain A, Mouse Rig-I Atpase Domain Length = 555 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3V4R|A Chain A, Crystal Structure Of A Uvrb Dimer-Dna Complex Length = 667 Back     alignment and structure
>pdb|2D7D|A Chain A, Structural Insights Into The Cryptic Dna Dependent Atp-Ase Activity Of Uvrb Length = 661 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1165
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-124
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-99
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-95
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-94
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 2e-88
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-84
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-54
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-14
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 6e-13
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 9e-10
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 1e-10
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-10
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 1e-09
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-09
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-09
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 5e-09
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 5e-09
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 1e-08
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-08
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-08
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-08
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-07
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-07
3h1t_A590 Type I site-specific restriction-modification syst 1e-07
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-07
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-07
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-07
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-07
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-07
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-07
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-07
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 4e-07
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 7e-07
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 9e-07
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-06
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-06
1yks_A440 Genome polyprotein [contains: flavivirin protease 6e-05
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-06
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 5e-06
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 5e-06
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 9e-06
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 9e-06
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-05
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 4e-05
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 5e-05
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-04
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 4e-04
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 5e-04
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
 Score =  390 bits (1003), Expect = e-124
 Identities = 149/474 (31%), Positives = 258/474 (54%), Gaps = 13/474 (2%)

Query: 103 IYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPS 162
           +    +  R YQ  I      +N L+ LPTGLGKTLIA ++          GK++  AP+
Sbjct: 3   LRRDLIQPRIYQEVIYAKCKETNCLIVLPTGLGKTLIAMMIAEYRLTK-YGGKVLMLAPT 61

Query: 163 RPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTC 222
           +PLV+Q  E+   +  +P E  + +TG+ SP +R+  W   +V   TPQ +E D+ +G  
Sbjct: 62  KPLVLQHAESFRRLFNLPPEKIVALTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRI 121

Query: 223 LMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLY 282
            ++ +  +V DEAHRA GNYAY    RE         ++ LTA+PGS  + I  +I+NL 
Sbjct: 122 SLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASPGSTPEKIMEVINNLG 181

Query: 283 ISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQN 342
           I  +EYR+E+  DV  YV   + E + V++ +   E+   + E++R     L+  GLL++
Sbjct: 182 IEHIEYRSENSPDVRPYVKGIRFEWVRVDLPEIYKEVRKLLREMLRDALKPLAETGLLES 241

Query: 343 RDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAY 402
                +   ++L +     +        ++   +  Y    + L+H   LL + G+    
Sbjct: 242 SSPD-IPKKEVLRAGQIINEEMAKGNHDLR--GLLLYHAMALKLHHAIELLETQGLSALR 298

Query: 403 EMLEEKLKQG-----SFARFMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKT 457
             +++  ++        ++ +  ++ ++K   L+ Q+   G   PK+ K+ E++ +    
Sbjct: 299 AYIKKLYEEAKAGSTKASKEIFSDKRMKKAISLLVQAKEIGLDHPKMDKLKEIIREQL-- 356

Query: 458 KDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQSSGKASKGQSQKVQQAVLEK 517
           +  ++S++I+F+N+R + + I+N L   G  +KA  F+GQ+S +  +G SQ+ Q+ +L++
Sbjct: 357 QRKQNSKIIVFTNYRETAKKIVNELVKDG--IKAKRFVGQASKENDRGLSQREQKLILDE 414

Query: 518 FRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRI 571
           F  G +NV+VATS+GEEGLD+ EVDLV+ ++   S +R IQR GRTGR   GR+
Sbjct: 415 FARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGRHMPGRV 468
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Length = 282 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Length = 590 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1165
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.98
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.98
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.97
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.97
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.97
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.96
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.96
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.96
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.96
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.96
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.94
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.92
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.92
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.92
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.92
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.91
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.91
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.91
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.91
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.91
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.91
3bor_A237 Human initiation factor 4A-II; translation initiat 99.91
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.91
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.91
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.9
3jux_A822 Protein translocase subunit SECA; protein transloc 99.9
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.89
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.88
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.87
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.85
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.84
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.84
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.83
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.83
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.83
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.82
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.82
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.82
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.81
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.79
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.78
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.65
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.74
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.7
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.64
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.48
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.31
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.47
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.85
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.68
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.61
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.49
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.36
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.16
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.16
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.0
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.96
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.93
4drb_C141 Fanconi anemia group M protein; DNA repair, DNA bi 96.86
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.87
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.6
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.29
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.25
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.93
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.87
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.66
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.4
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.22
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.1
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 93.96
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.85
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.82
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.77
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 93.74
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.55
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.49
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.94
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.63
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 92.19
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 92.05
3bos_A242 Putative DNA replication factor; P-loop containing 91.61
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.37
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 91.08
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 91.0
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 90.87
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 90.61
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 90.16
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 89.97
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.81
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 89.63
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 89.28
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.16
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 88.95
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 88.77
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 88.64
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 88.59
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 87.96
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 87.88
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 87.52
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 87.52
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 87.36
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 87.16
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 86.99
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 86.61
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 86.56
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 86.52
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 86.18
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 85.48
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 85.37
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 85.34
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 85.0
2kjq_A149 DNAA-related protein; solution structure, NESG, st 84.92
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 84.86
2chq_A319 Replication factor C small subunit; DNA-binding pr 84.64
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 84.61
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 84.48
3pvs_A447 Replication-associated recombination protein A; ma 84.47
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 83.8
3io5_A333 Recombination and repair protein; storage dimer, i 83.75
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 83.1
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 83.06
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 82.75
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 82.56
2r6a_A454 DNAB helicase, replicative helicase; replication, 82.44
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 82.36
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 82.36
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 81.94
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 80.35
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 80.13
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
Probab=100.00  E-value=6e-47  Score=451.02  Aligned_cols=469  Identities=32%  Similarity=0.534  Sum_probs=342.6

Q ss_pred             CCCCCCCCChHHHHHHHHHhhcCCeEEEcCCCchHHHHHHHHHHHHHHhCCCCeEEEEecChhHHHHHHHHHHHHhCCCC
Q 037446          102 WIYPVNVPVRDYQFAITKTALFSNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQ  181 (1165)
Q Consensus       102 ~~~Pt~IQlr~yQ~eal~~ll~rnvIl~a~TGsGKTL~a~lpil~~L~~~~~~rvLILvPtr~La~Q~~~e~~kl~g~~~  181 (1165)
                      |.+|..++||+||.+++.++..+++|++++||+|||+++++++...+. .+.+++|||+|+++|+.||.+++.++++.+.
T Consensus         2 ~~~~~~~~l~~~Q~~~i~~~~~~~~ll~~~tG~GKT~~~~~~~~~~~~-~~~~~~liv~P~~~L~~q~~~~~~~~~~~~~   80 (494)
T 1wp9_A            2 VLRRDLIQPRIYQEVIYAKCKETNCLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNLPP   80 (494)
T ss_dssp             CBCHHHHCCCHHHHHHHHHGGGSCEEEECCTTSCHHHHHHHHHHHHHH-HSCSCEEEECSSHHHHHHHHHHHHHHBCSCG
T ss_pred             ccccCCCCccHHHHHHHHHHhhCCEEEEcCCCCCHHHHHHHHHHHHHh-cCCCeEEEEECCHHHHHHHHHHHHHHhCcch
Confidence            667888999999999999999889999999999999999999988776 4567999999999999999999999988777


Q ss_pred             ceEEEEeCCCChHHHHhhcCCccEEEEcHHHHHHHHHcCccCCCCccEEEEcccccccCccchHHHHHHHHcCCCCCeEE
Q 037446          182 EWTIDMTGQISPTKRASFWKTKRVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNYAYCTAIRELMSVPVQLRIL  261 (1165)
Q Consensus       182 ~~v~~l~G~~~~~~~~~l~~~~dIlVaTpq~L~~~l~~~~~~l~~~~lVVIDEAHrl~~~~~~~~~l~~L~~~~~~~riL  261 (1165)
                      ..+..++|+.....+...+..++|+|+||++|.+.+..+.+.+.+|++|||||||++.+...+...++.+.......+++
T Consensus        81 ~~v~~~~g~~~~~~~~~~~~~~~ivv~T~~~l~~~~~~~~~~~~~~~~vIiDEaH~~~~~~~~~~~~~~~~~~~~~~~~l  160 (494)
T 1wp9_A           81 EKIVALTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRISLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVI  160 (494)
T ss_dssp             GGEEEECSCSCHHHHHHHHHHCSEEEECHHHHHHHHHTTSCCTTSCSEEEEETGGGCSTTCHHHHHHHHHHHHCSSCCEE
T ss_pred             hheEEeeCCcchhhhhhhccCCCEEEecHHHHHHHHhcCCcchhhceEEEEECCcccCCCCcHHHHHHHHHhcCCCCeEE
Confidence            78999999998877777777899999999999999888778889999999999999997667777777776666677899


Q ss_pred             EEccCCCCChHHHHHHHHhhccccccccCCchhhhhhhhccCceEEEEeccchhHHHHHHHHHHHHhhHHHHHhhhcccc
Q 037446          262 ALTATPGSKQQTIQHIIDNLYISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQ  341 (1165)
Q Consensus       262 ~LSATP~~~~~~l~~Li~~L~is~i~~~~~~~~~i~~y~~~~~~~~i~v~~~~~~~~i~~~l~~~i~~~~~rl~~~~vl~  341 (1165)
                      +|||||.++...+..++..+.+..+.........+..|+.........+........+...+...+......+...++..
T Consensus       161 ~lTaTp~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (494)
T 1wp9_A          161 GLTASPGSTPEKIMEVINNLGIEHIEYRSENSPDVRPYVKGIRFEWVRVDLPEIYKEVRKLLREMLRDALKPLAETGLLE  240 (494)
T ss_dssp             EEESCSCSSHHHHHHHHHHTTCCEEEECCTTSTTTGGGCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHTSSS
T ss_pred             EEecCCCCCcHHHHHHHHhcChheeeccCCCcHHHHHhcCCCceeEEecCCcHHHHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            99999998888899999999888888777778888899988888888888887777766666666555555555555432


Q ss_pred             cccccCCchhhhhhhhhhhhcCCCCCCCcccchhhHHHHHHHHHHHHHHHHHhhCCchHHHHHHHHHHhhc---c--chh
Q 037446          342 NRDYQTLSPVDLLNSRDKFRQAPPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQG---S--FAR  416 (1165)
Q Consensus       342 ~~~~~~l~p~~l~~~~~~~~~~~~~~i~~~~~~~l~~~~~~L~~l~~i~~ll~~~g~~~~~~~L~~~~~~~---~--~~~  416 (1165)
                      .... .+....+......+....... ..... ........+..+......+...+.......+.......   .  ...
T Consensus       241 ~~~~-~~~~~~~~~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  317 (494)
T 1wp9_A          241 SSSP-DIPKKEVLRAGQIINEEMAKG-NHDLR-GLLLYHAMALKLHHAIELLETQGLSALRAYIKKLYEEAKAGSTKASK  317 (494)
T ss_dssp             CCCT-TSCHHHHHHHHHHHHHHHTTT-CCSTT-THHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHTTCCHHHH
T ss_pred             ccCC-CcchhHHHHHHHHHHHHhhcc-ccchh-hHHHHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHHhhccccchhhh
Confidence            2211 122222222211111110000 00000 11111111222222222333333332222222111100   0  000


Q ss_pred             cccchhhHHHHHHHHHhhhccCCCChHHHHHHHHHHHhhcccCCCCCeEEEEeCchHHHHHHHHHHHhcCCCccceeeec
Q 037446          417 FMSKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIG  496 (1165)
Q Consensus       417 ll~~~~~~~~v~~~l~~~~~~~~~s~Kl~~LlelL~~~~~~~~~~~~kvIVF~~sr~~ae~L~~~L~~~g~~i~~~~l~G  496 (1165)
                      -+.....+......+.........++|+..|.++|.+++.  ...+.++||||+++..++.+++.|...|  +.+..++|
T Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~l~~~l~~~~~--~~~~~k~lVF~~~~~~~~~l~~~L~~~~--~~~~~~~g  393 (494)
T 1wp9_A          318 EIFSDKRMKKAISLLVQAKEIGLDHPKMDKLKEIIREQLQ--RKQNSKIIVFTNYRETAKKIVNELVKDG--IKAKRFVG  393 (494)
T ss_dssp             HHHTSHHHHHHHHHHHHHHHHTCSCHHHHHHHHHHHHHHH--HCTTCCEEEECSCHHHHHHHHHHHHHTT--CCEEEECC
T ss_pred             hhhhhHHHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHhc--cCCCCeEEEEEccHHHHHHHHHHHHHcC--CCcEEEec
Confidence            0011122222333332333445678999999999988762  1257899999999999999999999998  88999999


Q ss_pred             ccccccCCCCCHHHHHHHHHHHhcCCceEEEEcccccccccccCCCEEEEeccCCCHHHHHHHHhhcCCCCCCccceecC
Q 037446          497 QSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDIMEVDLVICFDANVSPLRMIQRMGRTGRKHDGRIPHIFK  576 (1165)
Q Consensus       497 ~~~g~~~ggms~~eR~~il~~Fr~g~~~VLVATda~~eGLDIp~vd~VI~~D~p~S~~~yiQriGRagR~GqGkiv~v~~  576 (1165)
                      ......+++|+..+|.+++++|++|+.+|||||+++++|||+|++++||+||+|||+..|+||+||+||.|+|+++.++.
T Consensus       394 ~~~~~~~~~~~~~~r~~~~~~F~~~~~~vLv~T~~~~~Gldl~~~~~Vi~~d~~~~~~~~~Qr~GR~~R~g~g~~~~l~~  473 (494)
T 1wp9_A          394 QASKENDRGLSQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGRHMPGRVIILMA  473 (494)
T ss_dssp             SSCC-------CCHHHHHHHHHHHTSCSEEEECGGGGGGGGSTTCCEEEESSCCHHHHHHHHHHTTSCSCCCSEEEEEEE
T ss_pred             cccccccccCCHHHHHHHHHHHhcCCceEEEECCccccCCCchhCCEEEEeCCCCCHHHHHHHHhhccCCCCceEEEEEe
Confidence            77666667899999999999999999999999999999999999999999999999999999999999999999888876


Q ss_pred             hh
Q 037446          577 PE  578 (1165)
Q Consensus       577 ~d  578 (1165)
                      ++
T Consensus       474 ~~  475 (494)
T 1wp9_A          474 KG  475 (494)
T ss_dssp             TT
T ss_pred             cC
Confidence            64
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4drb_C Fanconi anemia group M protein; DNA repair, DNA binding complex, histone fold, DNA damage RE binding, DNA binding-protein binding complex; 2.63A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1165
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-42
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 5e-29
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-13
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 5e-11
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 1e-10
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 3e-09
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-08
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-08
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-08
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 4e-08
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-07
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-07
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 1e-07
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 3e-07
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-05
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-05
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-04
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-04
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 0.001
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 0.001
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 0.004
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

 Score =  155 bits (391), Expect = 2e-42
 Identities = 75/273 (27%), Positives = 144/273 (52%), Gaps = 12/273 (4%)

Query: 304 KIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQA 363
           + E + V++ +   E+   + E++R     L+  GLL++     +   ++L +     + 
Sbjct: 3   RFEWVRVDLPEIYKEVRKLLREMLRDALKPLAETGLLESSSPD-IPKKEVLRAGQIINEE 61

Query: 364 PPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQ-----GSFARFM 418
                       +  Y    + L+H   LL + G+      +++  ++        ++ +
Sbjct: 62  MAKG--NHDLRGLLLYHAMALKLHHAIELLETQGLSALRAYIKKLYEEAKAGSTKASKEI 119

Query: 419 SKNEDIRKVKLLMQQSISHGAQSPKLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDI 478
             ++ ++K   L+ Q+   G   PK+ K+ E++ +  + K     ++I+F+N+R + + I
Sbjct: 120 FSDKRMKKAISLLVQAKEIGLDHPKMDKLKEIIREQLQRKQNS--KIIVFTNYRETAKKI 177

Query: 479 MNALATIGDLVKATEFIGQSSGKASKGQSQKVQQAVLEKFRAGGYNVIVATSIGEEGLDI 538
           +N L   G  +KA  F+GQ+S +  +G SQ+ Q+ +L++F  G +NV+VATS+GEEGLD+
Sbjct: 178 VNELVKDG--IKAKRFVGQASKENDRGLSQREQKLILDEFARGEFNVLVATSVGEEGLDV 235

Query: 539 MEVDLVICFDANVSPLRMIQRMGRTGRKHDGRI 571
            EVDLV+ ++   S +R IQR GRTGR   GR+
Sbjct: 236 PEVDLVVFYEPVPSAIRSIQRRGRTGRHMPGRV 268
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1165
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.94
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.94
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.93
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.93
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.91
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.91
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.9
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.88
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.88
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.87
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.87
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.87
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.87
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.86
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.85
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.85
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.84
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.83
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.78
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.78
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.77
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.77
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.71
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.7
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.67
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.66
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.64
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.61
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.61
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.6
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.6
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.59
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.59
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.49
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.48
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.47
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.36
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.89
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.84
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.36
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.23
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.06
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.95
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.51
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.11
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.66
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.03
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.86
d1okkd2207 GTPase domain of the signal recognition particle r 94.8
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 94.7
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.56
d2qy9a2211 GTPase domain of the signal recognition particle r 94.54
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.08
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.03
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.95
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.44
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.26
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.24
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.91
d1vmaa2213 GTPase domain of the signal recognition particle r 92.19
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.7
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.17
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.85
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.72
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 90.69
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.62
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 90.37
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 89.11
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 88.26
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.95
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.13
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 84.36
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.08
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.94  E-value=1.7e-27  Score=266.03  Aligned_cols=267  Identities=22%  Similarity=0.168  Sum_probs=174.2

Q ss_pred             CCeEEEcCCCchHHHHHHHHHHHHHHhCCCCeEEEEecChhHHHHHHHHHHHHhCCCCceEEEEeCCCChHHHHhhcCCc
Q 037446          124 SNTLVALPTGLGKTLIAAVVIYNFFRWFPDGKIVFAAPSRPLVMQQIEACHNIVGIPQEWTIDMTGQISPTKRASFWKTK  203 (1165)
Q Consensus       124 rnvIl~a~TGsGKTL~a~lpil~~L~~~~~~rvLILvPtr~La~Q~~~e~~kl~g~~~~~v~~l~G~~~~~~~~~l~~~~  203 (1165)
                      +++||.++||+|||++|+.+++..... .+.++|||+||++|+.|+.++++.+.....  .....        .......
T Consensus        10 ~~~lv~~~TGsGKT~~~l~~~~~~~~~-~~~~~lvi~Ptr~La~q~~~~l~~~~~~~~--~~~~~--------~~~~~~~   78 (305)
T d2bmfa2          10 RLTIMDLHPGAGKTKRYLPAIVREAIK-RGLRTLILAPTRVVAAEMEEALRGLPIRYQ--TPAIR--------AEHTGRE   78 (305)
T ss_dssp             CEEEECCCTTSSTTTTHHHHHHHHHHH-HTCCEEEEESSHHHHHHHHHHTTTSCCBCC--C----------------CCC
T ss_pred             CcEEEEECCCCCHHHHHHHHHHHHHHh-cCCEEEEEccHHHHHHHHHHHHhcCCccee--eeEEe--------ecccCcc
Confidence            778999999999999988777654432 356899999999999999998876422111  11111        1122457


Q ss_pred             cEEEEcHHHHHHHHHcCccCCCCccEEEEcccccccCcc-chHHHHHHHHcCCCCCeEEEEccCCCCChHHHHHHHHhhc
Q 037446          204 RVFFVTPQVLEKDIQSGTCLMKYLVCLVIDEAHRATGNY-AYCTAIRELMSVPVQLRILALTATPGSKQQTIQHIIDNLY  282 (1165)
Q Consensus       204 dIlVaTpq~L~~~l~~~~~~l~~~~lVVIDEAHrl~~~~-~~~~~l~~L~~~~~~~riL~LSATP~~~~~~l~~Li~~L~  282 (1165)
                      .++++|++.|...... ...+.++++|||||||++..+. .+...++.+. ...+.+++++|||++....          
T Consensus        79 ~i~~~t~~~l~~~~~~-~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~~----------  146 (305)
T d2bmfa2          79 IVDLMCHATFTMRLLS-PIRVPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSRD----------  146 (305)
T ss_dssp             SEEEEEHHHHHHHHTS-SSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCCC----------
T ss_pred             ccccCCcHHHHHHHhc-CccccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCccee----------
Confidence            8999999999876654 3456789999999999997531 1222222222 2356789999999864311          


Q ss_pred             cccccccCCchhhhhhhhccCceEEEEeccchhHHHHHHHHHHHHhhHHHHHhhhcccccccccCCchhhhhhhhhhhhc
Q 037446          283 ISTLEYRNESDQDVSSYVHNRKIELIEVEMGQEAVEINNRIWEVIRPYTSRLSAIGLLQNRDYQTLSPVDLLNSRDKFRQ  362 (1165)
Q Consensus       283 is~i~~~~~~~~~i~~y~~~~~~~~i~v~~~~~~~~i~~~l~~~i~~~~~rl~~~~vl~~~~~~~l~p~~l~~~~~~~~~  362 (1165)
                          .+.          .....+.......                                     +..          
T Consensus       147 ----~~~----------~~~~~~~~~~~~~-------------------------------------~~~----------  165 (305)
T d2bmfa2         147 ----PFP----------QSNAPIMDEEREI-------------------------------------PER----------  165 (305)
T ss_dssp             ----SSC----------CCSSCEEEEECCC-------------------------------------CCS----------
T ss_pred             ----eec----------ccCCcceEEEEec-------------------------------------cHH----------
Confidence                000          0000000000000                                     000          


Q ss_pred             CCCCCCCcccchhhHHHHHHHHHHHHHHHHHhhCCchHHHHHHHHHHhhccchhcccchhhHHHHHHHHHhhhccCCCCh
Q 037446          363 APPPNLPQIKFGEVEAYFGALITLYHIRRLLSSHGIRPAYEMLEEKLKQGSFARFMSKNEDIRKVKLLMQQSISHGAQSP  442 (1165)
Q Consensus       363 ~~~~~i~~~~~~~l~~~~~~L~~l~~i~~ll~~~g~~~~~~~L~~~~~~~~~~~ll~~~~~~~~v~~~l~~~~~~~~~s~  442 (1165)
                                                        ..                                          ..
T Consensus       166 ----------------------------------~~------------------------------------------~~  169 (305)
T d2bmfa2         166 ----------------------------------SW------------------------------------------NS  169 (305)
T ss_dssp             ----------------------------------CC------------------------------------------SS
T ss_pred             ----------------------------------HH------------------------------------------HH
Confidence                                              00                                          00


Q ss_pred             HHHHHHHHHHHhhcccCCCCCeEEEEeCchHHHHHHHHHHHhcCCCccceeeecccccccCCCCCHHHHHHHHHHHhcCC
Q 037446          443 KLSKMLEVLVDHFKTKDPKHSRVIIFSNFRGSVRDIMNALATIGDLVKATEFIGQSSGKASKGQSQKVQQAVLEKFRAGG  522 (1165)
Q Consensus       443 Kl~~LlelL~~~~~~~~~~~~kvIVF~~sr~~ae~L~~~L~~~g~~i~~~~l~G~~~g~~~ggms~~eR~~il~~Fr~g~  522 (1165)
                          ....+.+       .+.++||||++++.++.++..|++.+  +++..+||        ++.+.    ....|++|.
T Consensus       170 ----~~~~~~~-------~~~~~lvf~~~~~~~~~l~~~L~~~~--~~~~~l~~--------~~~~~----~~~~~~~~~  224 (305)
T d2bmfa2         170 ----GHEWVTD-------FKGKTVWFVPSIKAGNDIAACLRKNG--KKVIQLSR--------KTFDS----EYIKTRTND  224 (305)
T ss_dssp             ----CCHHHHS-------SCSCEEEECSCHHHHHHHHHHHHHHT--CCCEECCT--------TCHHH----HGGGGGTSC
T ss_pred             ----HHHHHHh-------hCCCEEEEeccHHHHHHHHHHHHhCC--CCEEEeCC--------cChHH----HHhhhhccc
Confidence                0000111       36789999999999999999999988  77777776        45443    344678999


Q ss_pred             ceEEEEcccccccccccCCCEEEE----------ec----------cCCCHHHHHHHHhhcCCCCCCc-cceecC
Q 037446          523 YNVIVATSIGEEGLDIMEVDLVIC----------FD----------ANVSPLRMIQRMGRTGRKHDGR-IPHIFK  576 (1165)
Q Consensus       523 ~~VLVATda~~eGLDIp~vd~VI~----------~D----------~p~S~~~yiQriGRagR~GqGk-iv~v~~  576 (1165)
                      .+++|||+++++|+|++ +++||.          +|          .|.|...|+||+||+||.|+|. ..++|.
T Consensus       225 ~~~lvaT~~~~~G~~~~-~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~  298 (305)
T d2bmfa2         225 WDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYM  298 (305)
T ss_dssp             CSEEEECGGGGTTCCCC-CSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEEC
T ss_pred             hhhhhhhHHHHhcCCCC-ccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEEC
Confidence            99999999999999994 555542          33          4578999999999999999765 334443
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure