Citrus Sinensis ID: 037553

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MAAKPSTTTTAKATYSPIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG
cccccccccccccccccccccccccccEEccccccccccccccccccccEEEEEcccccccEEEEEEEccEEEEEEEEccccccccccccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccc
ccccccccccccccccccccccccccccccEEcccccccccccccccccEEEEEccEEccccEEEEEEcccEEEEEEEccccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccc
maakpsttttakatyspidptrktrppifsgsdvdwlrpdsrgfhqcrpaffrtgavnsasgsayaefgnTKVIVSVfgpreskkammysnigrlncnvsyttfatpirgqgsdhkdFSSMLHKALEGAIiletfpktTVDVFALVLESGG
maakpsttttakatyspidptrktrppifsgsdvdWLRPDSRGFHQCRPAFFRTGAVNSASgsayaefgntKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIiletfpktTVDVFALVLESGG
MaakpsttttakatyspIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG
********************************DVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQG**HKDFSSMLHKALEGAIILETFPKTTVDVFALVL****
*****************************************RGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPR***********GRLNCNVSY*******************MLHKALEGAIILETFPKTTVDVFALVLESGG
*************TYSPIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG
*************************PPIFS***VDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLES**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKPSTTTTAKATYSPIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q6P0I8 271 Exosome complex component yes no 0.887 0.494 0.373 2e-19
O26779 240 Probable exosome complex yes no 0.761 0.479 0.352 8e-16
A0RXU1 243 Probable exosome complex yes no 0.788 0.489 0.349 2e-15
O59223 249 Probable exosome complex yes no 0.827 0.502 0.341 4e-14
Q8U0L9 250 Probable exosome complex yes no 0.827 0.5 0.341 5e-14
Q9V119 249 Probable exosome complex yes no 0.827 0.502 0.341 1e-13
B6YSI2 249 Probable exosome complex yes no 0.827 0.502 0.325 2e-13
C5A2B9 249 Probable exosome complex yes no 0.827 0.502 0.341 2e-13
A9A5C9 244 Probable exosome complex yes no 0.788 0.487 0.349 2e-13
Q4JB27 243 Probable exosome complex yes no 0.748 0.465 0.341 3e-13
>sp|Q6P0I8|EXOS6_DANRE Exosome complex component MTR3 OS=Danio rerio GN=exosc6 PE=2 SV=2 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 82/150 (54%), Gaps = 16/150 (10%)

Query: 17  PIDPTRKTRPPIFSGSDVDWLRPDS-----------RGFHQCRPAFFRTGAVNSASGSAY 65
           P+D T++ R P  S S + +L PD            RG    RP F R G V+ A GSAY
Sbjct: 2   PVD-TKRIRGPEESQSPLLFLSPDKAPKAPSSRQGVRGNGDVRPVFARCGLVSQAKGSAY 60

Query: 66  AEFGNTKVIVSVFGPRES-KKAMMYSNIGRLNCNVSYTTFATPIRG---QGSDHKDFSSM 121
            E GNTK+I SV+GP+E+ ++       GRL C+     F+   RG   QGS+ +D S+ 
Sbjct: 61  IEAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQGSEERDLSAT 120

Query: 122 LHKALEGAIILETFPKTTVDVFALVLESGG 151
           L ++L   + L  +P++ +DV  +VLE+ G
Sbjct: 121 LMESLRPGVCLHRYPRSQIDVNVMVLENDG 150
Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events.
Danio rerio (taxid: 7955)
>sp|O26779|ECX1_METTH Probable exosome complex exonuclease 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_683 PE=1 SV=1 Back     alignment and function description
>sp|A0RXU1|ECX1_CENSY Probable exosome complex exonuclease 1 OS=Cenarchaeum symbiosum (strain A) GN=CENSYa_1536 PE=3 SV=1 Back     alignment and function description
>sp|O59223|ECX1_PYRHO Probable exosome complex exonuclease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1549 PE=3 SV=1 Back     alignment and function description
>sp|Q8U0L9|ECX1_PYRFU Probable exosome complex exonuclease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1568 PE=3 SV=1 Back     alignment and function description
>sp|Q9V119|ECX1_PYRAB Probable exosome complex exonuclease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06100 PE=1 SV=1 Back     alignment and function description
>sp|B6YSI2|ECX1_THEON Probable exosome complex exonuclease 1 OS=Thermococcus onnurineus (strain NA1) GN=TON_0030 PE=3 SV=1 Back     alignment and function description
>sp|C5A2B9|ECX1_THEGJ Probable exosome complex exonuclease 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=TGAM_2036 PE=3 SV=1 Back     alignment and function description
>sp|A9A5C9|ECX1_NITMS Probable exosome complex exonuclease 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=Nmar_0432 PE=3 SV=1 Back     alignment and function description
>sp|Q4JB27|ECX1_SULAC Probable exosome complex exonuclease 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0610 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
255578123180 Exosome complex exonuclease RRP41, putat 0.973 0.816 0.794 6e-65
356539380 255 PREDICTED: exosome complex component MTR 0.894 0.529 0.851 1e-63
449456022 258 PREDICTED: exosome complex component MTR 0.867 0.507 0.854 2e-63
225435349 254 PREDICTED: exosome complex component MTR 0.960 0.570 0.794 3e-62
357472161 258 Exosome complex exonuclease MTR3 [Medica 0.966 0.565 0.781 4e-62
297803352 256 hypothetical protein ARALYDRAFT_492045 [ 0.973 0.574 0.768 1e-61
224106782 257 predicted protein [Populus trichocarpa] 0.841 0.494 0.881 2e-61
118489169 257 unknown [Populus trichocarpa x Populus d 0.841 0.494 0.874 4e-61
42567185 256 3'-5'-exoribonuclease family protein [Ar 0.973 0.574 0.754 7e-61
356542629 254 PREDICTED: exosome complex component MTR 0.960 0.570 0.788 8e-61
>gi|255578123|ref|XP_002529931.1| Exosome complex exonuclease RRP41, putative [Ricinus communis] gi|223530561|gb|EEF32439.1| Exosome complex exonuclease RRP41, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 4/151 (2%)

Query: 1   MAAKPSTTTTAKATYSPIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSA 60
           MA+KP +  T   TYSP  P+RK+RPPIF   DVDW+RPD R F +CRPA+FRTGAVN+A
Sbjct: 1   MASKPGSAPT---TYSPT-PSRKSRPPIFKHYDVDWVRPDGRSFSECRPAYFRTGAVNAA 56

Query: 61  SGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSS 120
           +GSAYAEFGNTKVIVSVFGPRESKKAMMYS++GRLNCNVSYTTF+TP+RGQGSD K+FSS
Sbjct: 57  AGSAYAEFGNTKVIVSVFGPRESKKAMMYSDVGRLNCNVSYTTFSTPVRGQGSDCKEFSS 116

Query: 121 MLHKALEGAIILETFPKTTVDVFALVLESGG 151
           MLHK+LEGAI+LETFPKTTVDVFALVLESGG
Sbjct: 117 MLHKSLEGAIMLETFPKTTVDVFALVLESGG 147

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356539380|ref|XP_003538176.1| PREDICTED: exosome complex component MTR3-like [Glycine max] Back     alignment and taxonomy information
>gi|449456022|ref|XP_004145749.1| PREDICTED: exosome complex component MTR3-like [Cucumis sativus] gi|449531263|ref|XP_004172607.1| PREDICTED: exosome complex component MTR3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225435349|ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [Vitis vinifera] gi|147834996|emb|CAN61380.1| hypothetical protein VITISV_037546 [Vitis vinifera] gi|297746275|emb|CBI16331.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357472161|ref|XP_003606365.1| Exosome complex exonuclease MTR3 [Medicago truncatula] gi|355507420|gb|AES88562.1| Exosome complex exonuclease MTR3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297803352|ref|XP_002869560.1| hypothetical protein ARALYDRAFT_492045 [Arabidopsis lyrata subsp. lyrata] gi|297315396|gb|EFH45819.1| hypothetical protein ARALYDRAFT_492045 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224106782|ref|XP_002314284.1| predicted protein [Populus trichocarpa] gi|222850692|gb|EEE88239.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118489169|gb|ABK96391.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|42567185|ref|NP_194479.2| 3'-5'-exoribonuclease family protein [Arabidopsis thaliana] gi|124300968|gb|ABN04736.1| At4g27490 [Arabidopsis thaliana] gi|124301080|gb|ABN04792.1| At4g27490 [Arabidopsis thaliana] gi|332659949|gb|AEE85349.1| 3'-5'-exoribonuclease family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356542629|ref|XP_003539769.1| PREDICTED: exosome complex component MTR3-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:2124024 256 RRP41L "AT4G27490" [Arabidopsi 0.854 0.503 0.806 1.6e-54
ZFIN|ZDB-GENE-050522-362 271 exosc6 "exosome component 6" [ 0.874 0.487 0.371 3.2e-17
POMBASE|SPBC211.08c 257 SPBC211.08c "exosomal 3'-5' ex 0.821 0.482 0.317 1.6e-13
TAIR|locus:2076710 241 RRP41 "AT3G61620" [Arabidopsis 0.761 0.477 0.35 5.6e-13
FB|FBgn0032487 246 Ski6 "Ski6" [Drosophila melano 0.741 0.455 0.369 7.1e-13
WB|WBGene00007201 240 exos-4.1 [Caenorhabditis elega 0.754 0.475 0.355 3.1e-12
UNIPROTKB|Q17533 240 exos-4.1 "Putative exosome com 0.754 0.475 0.355 3.1e-12
ZFIN|ZDB-GENE-040426-1702 245 exosc4 "exosome component 4" [ 0.754 0.465 0.325 2.2e-11
MGI|MGI:1919794 273 Exosc6 "exosome component 6" [ 0.860 0.476 0.310 2.3e-11
FB|FBgn0036916 326 Mtr3 "Mtr3" [Drosophila melano 0.688 0.319 0.358 2.7e-11
TAIR|locus:2124024 RRP41L "AT4G27490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 563 (203.2 bits), Expect = 1.6e-54, P = 1.6e-54
 Identities = 104/129 (80%), Positives = 118/129 (91%)

Query:    23 KTRPPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRE 82
             ++R PIF  SD+DW RPD RGFHQCRPA  +TGAV+SASGSAYAEFGNTKVIVSVFGPRE
Sbjct:    19 RSRLPIFKDSDLDWSRPDGRGFHQCRPALLQTGAVSSASGSAYAEFGNTKVIVSVFGPRE 78

Query:    83 SKKAMMYSNIGRLNCNVSYTTFATPIRGQGSDHKDFSSMLHKALEGAIILETFPKTTVDV 142
             SKKAM+YS++GRLNCNVSYT FA+P  GQG+DHK++SSMLHKALEG I++ETFPKTTVDV
Sbjct:    79 SKKAMVYSDVGRLNCNVSYTNFASPTLGQGTDHKEYSSMLHKALEGVIMMETFPKTTVDV 138

Query:   143 FALVLESGG 151
             FALVLESGG
Sbjct:   139 FALVLESGG 147
GO:0000175 "3'-5'-exoribonuclease activity" evidence=ISS
GO:0003723 "RNA binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006396 "RNA processing" evidence=ISS
GO:0009909 "regulation of flower development" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0005634 "nucleus" evidence=IDA
GO:0008408 "3'-5' exonuclease activity" evidence=IMP
GO:0009845 "seed germination" evidence=IMP
GO:0090351 "seedling development" evidence=IMP
ZFIN|ZDB-GENE-050522-362 exosc6 "exosome component 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC211.08c SPBC211.08c "exosomal 3'-5' exoribonuclease, PH-like (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2076710 RRP41 "AT3G61620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0032487 Ski6 "Ski6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00007201 exos-4.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q17533 exos-4.1 "Putative exosome complex component RRP41" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1702 exosc4 "exosome component 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1919794 Exosc6 "exosome component 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0036916 Mtr3 "Mtr3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
cd11371 210 cd11371, RNase_PH_MTR3, MTR3 subunit of eukaryotic 1e-53
pfam01138129 pfam01138, RNase_PH, 3' exoribonuclease family, do 7e-26
cd11370 226 cd11370, RNase_PH_RRP41, RRP41 subunit of eukaryot 2e-25
COG0689 230 COG0689, Rph, RNase PH [Translation, ribosomal str 5e-24
PRK03983 244 PRK03983, PRK03983, exosome complex exonuclease Rr 9e-23
cd11366 214 cd11366, RNase_PH_archRRP41, RRP41 subunit of arch 2e-20
TIGR02065 230 TIGR02065, ECX1, archaeal exosome-like complex exo 4e-20
cd11358 218 cd11358, RNase_PH, RNase PH-like 3'-5' exoribonucl 2e-18
cd11372199 cd11372, RNase_PH_RRP46, RRP46 subunit of eukaryot 2e-11
cd11367 272 cd11367, RNase_PH_RRP42, RRP42 subunit of eukaryot 3e-10
cd11365 256 cd11365, RNase_PH_archRRP42, RRP42 subunit of arch 1e-07
PRK04282 271 PRK04282, PRK04282, exosome complex RNA-binding pr 9e-07
COG2123 272 COG2123, COG2123, RNase PH-related exoribonuclease 4e-06
cd11369 261 cd11369, RNase_PH_RRP43, RRP43 subunit of eukaryot 2e-05
PRK00173 238 PRK00173, rph, ribonuclease PH; Reviewed 7e-05
cd11368 259 cd11368, RNase_PH_RRP45, RRP45 subunit of eukaryot 1e-04
>gnl|CDD|206776 cd11371, RNase_PH_MTR3, MTR3 subunit of eukaryotic exosome Back     alignment and domain information 
 Score =  168 bits (427), Expect = 1e-53
 Identities = 58/108 (53%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 47  CRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKKAMMYSNIGRLNCNVSYTTFAT 106
            RP F +TG V+ A GSAY E GNTKVI SV+GPR       +S+ GRLNC V +  FAT
Sbjct: 1   IRPIFLKTGVVSQAKGSAYVELGNTKVICSVYGPRPIPGRTEFSDRGRLNCEVKFAPFAT 60

Query: 107 PIR---GQGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG 151
           P R   GQ S+ ++ SS+LH+ALE A+ LE +PK+ +DVF  VLES G
Sbjct: 61  PGRRRHGQDSEERELSSLLHQALEPAVRLEKYPKSQIDVFVTVLESDG 108

The MTR3 subunit of eukaryotic exosome is a member of the RNase_PH family, named after the bacterial Ribonuclease PH, a 3'-5' exoribonuclease. Structurally all members of this family form hexameric rings (trimers of Rrp41-Rrp45, Rrp46-Rrp43, and Mtr3-Rrp42 dimers). The eukaryotic exosome core is composed of six individually encoded RNase PH-like subunits and three additional proteins (Rrp4, Csl4 and Rrp40) that form a stable cap and contain RNA-binding domains. The RNase PH-like subunits are no longer phosphorolytic enzymes, the exosome directly associates with Rrp44 and Rrp6, hydrolytic exoribonucleases related to bacterial RNase II/R and RNase D. The exosome plays an important role in RNA turnover. It plays a crucial role in the maturation of stable RNA species such as rRNA, snRNA and snoRNA, quality control of mRNA, and the degradation of RNA processing by-products and non-coding transcripts. Length = 210
>gnl|CDD|216323 pfam01138, RNase_PH, 3' exoribonuclease family, domain 1 Back     alignment and domain information
>gnl|CDD|206775 cd11370, RNase_PH_RRP41, RRP41 subunit of eukaryotic exosome Back     alignment and domain information
>gnl|CDD|223761 COG0689, Rph, RNase PH [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235187 PRK03983, PRK03983, exosome complex exonuclease Rrp41; Provisional Back     alignment and domain information
>gnl|CDD|206771 cd11366, RNase_PH_archRRP41, RRP41 subunit of archaeal exosome Back     alignment and domain information
>gnl|CDD|131120 TIGR02065, ECX1, archaeal exosome-like complex exonuclease 1 Back     alignment and domain information
>gnl|CDD|206766 cd11358, RNase_PH, RNase PH-like 3'-5' exoribonucleases Back     alignment and domain information
>gnl|CDD|206777 cd11372, RNase_PH_RRP46, RRP46 subunit of eukaryotic exosome Back     alignment and domain information
>gnl|CDD|206772 cd11367, RNase_PH_RRP42, RRP42 subunit of eukaryotic exosome Back     alignment and domain information
>gnl|CDD|206770 cd11365, RNase_PH_archRRP42, RRP42 subunit of archaeal exosome Back     alignment and domain information
>gnl|CDD|235268 PRK04282, PRK04282, exosome complex RNA-binding protein Rrp42; Provisional Back     alignment and domain information
>gnl|CDD|225034 COG2123, COG2123, RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206774 cd11369, RNase_PH_RRP43, RRP43 subunit of eukaryotic exosome Back     alignment and domain information
>gnl|CDD|178914 PRK00173, rph, ribonuclease PH; Reviewed Back     alignment and domain information
>gnl|CDD|206773 cd11368, RNase_PH_RRP45, RRP45 subunit of eukaryotic exosome Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG1068 245 consensus Exosomal 3'-5' exoribonuclease complex, 99.97
TIGR02065 230 ECX1 archaeal exosome-like complex exonuclease 1. 99.97
PRK03983 244 exosome complex exonuclease Rrp41; Provisional 99.97
PRK00173 238 rph ribonuclease PH; Reviewed 99.97
COG0689 230 Rph RNase PH [Translation, ribosomal structure and 99.96
TIGR01966 236 RNasePH ribonuclease PH. This bacterial enzyme, ri 99.96
PF01138132 RNase_PH: 3' exoribonuclease family, domain 1 This 99.94
PRK04282 271 exosome complex RNA-binding protein Rrp42; Provisi 99.93
TIGR03591 684 polynuc_phos polyribonucleotide nucleotidyltransfe 99.93
PRK11824 693 polynucleotide phosphorylase/polyadenylase; Provis 99.93
COG2123 272 RNase PH-related exoribonuclease [Translation, rib 99.92
TIGR02696 719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 99.9
PLN00207 891 polyribonucleotide nucleotidyltransferase; Provisi 99.9
KOG1613 298 consensus Exosomal 3'-5' exoribonuclease complex, 99.87
KOG1069 217 consensus Exosomal 3'-5' exoribonuclease complex, 99.87
KOG1612 288 consensus Exosomal 3'-5' exoribonuclease complex, 99.85
KOG1614 291 consensus Exosomal 3'-5' exoribonuclease complex, 99.79
KOG1067 760 consensus Predicted RNA-binding polyribonucleotide 99.68
TIGR03591 684 polynuc_phos polyribonucleotide nucleotidyltransfe 99.62
PRK11824 693 polynucleotide phosphorylase/polyadenylase; Provis 99.59
COG1185 692 Pnp Polyribonucleotide nucleotidyltransferase (pol 99.43
PLN00207 891 polyribonucleotide nucleotidyltransferase; Provisi 98.96
TIGR02696 719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 98.4
COG1185 692 Pnp Polyribonucleotide nucleotidyltransferase (pol 98.2
KOG1067 760 consensus Predicted RNA-binding polyribonucleotide 96.74
>KOG1068 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp41 and related exoribonucleases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=99.97  E-value=3.1e-32  Score=213.03  Aligned_cols=119  Identities=39%  Similarity=0.629  Sum_probs=110.8

Q ss_pred             CCCCCCCCCCCCCCCcceEEEeCCcCCCCeEEEEEECCeEEEEEEEcCccccc-ccccCceeEEEEEEEecCCcccccC-
Q 037553           33 DVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKK-AMMYSNIGRLNCNVSYTTFATPIRG-  110 (151)
Q Consensus        33 ~~~~~R~DGR~~~e~R~i~i~~g~l~~adGSa~v~~G~T~Vl~~V~gp~~~~~-~~~~~~~g~l~v~v~~~p~a~~~r~-  110 (151)
                      +++++|.|||+++|+|+|.+++|++++++||||+++|||||+|.|+||++... +...++++.++|.|.+.+|++.+|. 
T Consensus         9 seeg~r~dgRr~~elR~i~~~~g~~~~a~GSay~E~GnTKVl~aV~GPre~~~~~~~~~~~a~lnc~~~~a~Fst~~r~~   88 (245)
T KOG1068|consen    9 SEEGLRTDGRRPNELRRIYARIGVLTQADGSAYMEQGNTKVLCAVYGPREIRGKSARRPDKAVLNCEVSSAQFSTGDRKK   88 (245)
T ss_pred             CccccccCCCChhHhhhhhhhcCccccCCccchhhcCCeEEEEEEeCCcccccccccccccceEEEEEeeeccccchhcc
Confidence            58999999999999999999999999999999999999999999999999764 2346899999999999999999764 


Q ss_pred             ---CCchHHHHHHHHHHHHHhhhccCCCCCcEEEEEEEEEecCC
Q 037553          111 ---QGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG  151 (151)
Q Consensus       111 ---~~~~~~~l~~~l~~~l~~~I~l~~~p~~~I~I~v~VL~~DG  151 (151)
                         .+.++++++.+|+++|+++|+++.|||++|+|+|+||+|||
T Consensus        89 ~~~~~rr~~e~s~~L~~afe~~I~~~lyPrsqIDI~v~VleddG  132 (245)
T KOG1068|consen   89 RPKGDRREKELSLMLQQAFEPVILLELYPRSQIDIYVQVLEDDG  132 (245)
T ss_pred             CCCccHHHHHHHHHHHHHHHHHHHhhhCccccceEEEEEEECCC
Confidence               34589999999999999999999999999999999999998

>TIGR02065 ECX1 archaeal exosome-like complex exonuclease 1 Back     alignment and domain information
>PRK03983 exosome complex exonuclease Rrp41; Provisional Back     alignment and domain information
>PRK00173 rph ribonuclease PH; Reviewed Back     alignment and domain information
>COG0689 Rph RNase PH [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01966 RNasePH ribonuclease PH Back     alignment and domain information
>PF01138 RNase_PH: 3' exoribonuclease family, domain 1 This Prosite family only includes Ribonuclease PH; InterPro: IPR001247 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function Back     alignment and domain information
>PRK04282 exosome complex RNA-binding protein Rrp42; Provisional Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>COG2123 RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG1613 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp43 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1069 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp46 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1612 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp42 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1614 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp45 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2wnr_B 240 The Structure Of Methanothermobacter Thermautotroph 1e-16
2pnz_A 249 Crystal Structure Of The P. Abyssi Exosome Rnase Ph 1e-14
2nn6_F 272 Structure Of The Human Rna Exosome Composed Of Rrp4 1e-13
3m7n_D 258 Archaeoglobus Fulgidus Exosome With Rna Bound To Th 4e-12
2ba0_F 258 Archaeal Exosome Core Length = 258 4e-12
2br2_B 248 Rnase Ph Core Of The Archaeal Exosome Length = 248 5e-12
2je6_B 250 Structure Of A 9-Subunit Archaeal Exosome Length = 6e-12
3l7z_B 245 Crystal Structure Of The S. Solfataricus Archaeal E 6e-12
2nn6_B 249 Structure Of The Human Rna Exosome Composed Of Rrp4 8e-11
4ifd_B 248 Crystal Structure Of An 11-subunit Eukaryotic Exoso 7e-09
2wp8_B 246 Yeast Rrp44 Nuclease Length = 246 2e-08
3hkm_A 246 Crystal Structure Of Rice(Oryza Sativa) Rrp46 Lengt 3e-05
2pnz_B 277 Crystal Structure Of The P. Abyssi Exosome Rnase Ph 1e-04
3b4t_A 262 Crystal Structure Of Mycobacterium Tuberculosis Rna 7e-04
>pdb|2WNR|B Chain B, The Structure Of Methanothermobacter Thermautotrophicus Exosome Core Assembly Length = 240 Back     alignment and structure 
Iteration: 1

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 4/119 (3%)
Query: 37  LRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESK-KAMMYSNIGRL 95
           +R D R F + RP     G +  A GS+Y EFG  K++V+V+GPRE++ + +   +   +
Sbjct: 16  VREDGRAFDELRPLKIEAGILERADGSSYLEFGGNKILVAVYGPREAQIRKLQRPDRAVI 75
Query: 96  NCNVSYTTFATPIRGQ-GSDHK--DFSSMLHKALEGAIILETFPKTTVDVFALVLESGG 151
            C  +   F+   R + G D +  + S +  +AL  A+ILE FP++ +DVF  VLE+ G
Sbjct: 76  RCRYNMAPFSVEERKRPGPDRRSVEISKITAEALRPALILEKFPRSVIDVFIEVLEAEG 134
>pdb|2PNZ|A Chain A, Crystal Structure Of The P. Abyssi Exosome Rnase Ph Ring Complexed With Udp And Gmp Length = 249 Back     alignment and structure
>pdb|2NN6|F Chain F, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 272 Back     alignment and structure
>pdb|3M7N|D Chain D, Archaeoglobus Fulgidus Exosome With Rna Bound To The Active Site Length = 258 Back     alignment and structure
>pdb|2BA0|F Chain F, Archaeal Exosome Core Length = 258 Back     alignment and structure
>pdb|2BR2|B Chain B, Rnase Ph Core Of The Archaeal Exosome Length = 248 Back     alignment and structure
>pdb|2JE6|B Chain B, Structure Of A 9-Subunit Archaeal Exosome Length = 250 Back     alignment and structure
>pdb|3L7Z|B Chain B, Crystal Structure Of The S. Solfataricus Archaeal Exosome Length = 245 Back     alignment and structure
>pdb|2NN6|B Chain B, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 249 Back     alignment and structure
>pdb|4IFD|B Chain B, Crystal Structure Of An 11-subunit Eukaryotic Exosome Complex Bound To Rna Length = 248 Back     alignment and structure
>pdb|2WP8|B Chain B, Yeast Rrp44 Nuclease Length = 246 Back     alignment and structure
>pdb|3HKM|A Chain A, Crystal Structure Of Rice(Oryza Sativa) Rrp46 Length = 246 Back     alignment and structure
>pdb|2PNZ|B Chain B, Crystal Structure Of The P. Abyssi Exosome Rnase Ph Ring Complexed With Udp And Gmp Length = 277 Back     alignment and structure
>pdb|3B4T|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Rnase Ph, The Mycobacterium Tuberculosis Structural Genomics Consortium Target Rv1340 Length = 262 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2wp8_B 246 Exosome complex component SKI6; nucleus, hydrolase 7e-35
2nn6_F 272 MTR3, exosome component 6; RNA, exosome, PM/SCL, p 1e-34
2nn6_D 237 Exosome complex exonuclease RRP46; RNA, exosome, P 1e-31
3krn_A 222 Protein C14A4.5, confirmed by transcript evidence; 2e-28
2wnr_B 240 Probable exosome complex exonuclease 1; phosphate 7e-23
1r6l_A 239 Ribonuclease PH; beta-alpha-beta-alpha fold, hexam 7e-23
2nn6_B 249 Exosome complex exonuclease RRP41; RNA, exosome, P 1e-22
2po1_A 249 Probable exosome complex exonuclease 1; RNAse PH, 2e-22
3b4t_A 262 Ribonuclease PH; RNAse, tRNA nucleotidyltransferas 4e-22
3hkm_A 246 OS03G0854200 protein; RNAse PH domain, phosphoryla 1e-21
1udn_A 255 Ribonuclease PH, RNAse PH; transferase, riken stru 2e-20
3dd6_A 255 Ribonuclease PH; exoribonuclease, tRNA maturation, 1e-19
2je6_B 250 RRP41, exosome complex exonuclease 1; nuclease, hy 5e-19
3m7n_D 258 Probable exosome complex exonuclease 1; exosome, R 8e-18
2po1_B 277 Probable exosome complex exonuclease 2; RNAse PH, 6e-17
2wnr_A 271 Probable exosome complex exonuclease 2; phosphate 4e-15
2nn6_C 278 Exosome complex exonuclease RRP43; RNA, exosome, P 6e-14
2nn6_E 305 Exosome complex exonuclease RRP42; RNA, exosome, P 1e-13
3m7n_G 259 Probable exosome complex exonuclease 2; exosome, R 2e-13
1oys_A 245 Ribonuclease PH; transferase, tRNA processing; 2.4 2e-13
2je6_A 277 RRP42, exosome complex exonuclease 2; nuclease, hy 9e-13
2nn6_A 358 Polymyositis/scleroderma autoantigen 1; RNA, exoso 4e-12
2wp8_A 305 Exosome complex component RRP45; nucleus, hydrolas 5e-11
>2wp8_B Exosome complex component SKI6; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
 Score =  120 bits (303), Expect = 7e-35
 Identities = 34/124 (27%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 35  DWLRPDSRGFHQCRPAFFRTGAV-NSASGSAYAEFGNTKVIVSVFGPRESK-KAMMYSNI 92
           + LR D R +++ R          ++A GS+Y E GN K+I  V GP+E + K+ M ++ 
Sbjct: 10  EGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSK 69

Query: 93  GRLNCNVSYTTFAT----PIRGQGSDH-KDFSSMLHKALEGAIILETFPKTTVDVFALVL 147
             LN +V+   F+         +      +  + L +  E  ++L  +P+T +D+   VL
Sbjct: 70  ALLNVSVNINKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVL 129

Query: 148 ESGG 151
           E  G
Sbjct: 130 EQDG 133
>2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 272 Back     alignment and structure
>2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 237 Back     alignment and structure
>3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAS hydrolase; 3.92A {Caenorhabditis elegans} Length = 222 Back     alignment and structure
>2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 240 Back     alignment and structure
>1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transf; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A Length = 239 Back     alignment and structure
>2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 249 Back     alignment and structure
>2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* Length = 249 Back     alignment and structure
>3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, STRU genomics, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 262 Back     alignment and structure
>3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase, hydrolase; 1.98A {Oryza sativa japonica group} Length = 246 Back     alignment and structure
>1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A Length = 255 Back     alignment and structure
>3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Length = 255 Back     alignment and structure
>2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B Length = 250 Back     alignment and structure
>3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E Length = 258 Back     alignment and structure
>2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* Length = 277 Back     alignment and structure
>2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 271 Back     alignment and structure
>2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 278 Back     alignment and structure
>2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 305 Back     alignment and structure
>3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G Length = 259 Back     alignment and structure
>1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A Length = 245 Back     alignment and structure
>2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* 3l7z_A Length = 277 Back     alignment and structure
>2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 358 Back     alignment and structure
>2wp8_A Exosome complex component RRP45; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 305 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
2po1_A 249 Probable exosome complex exonuclease 1; RNAse PH, 100.0
2wnr_B 240 Probable exosome complex exonuclease 1; phosphate 100.0
2nn6_F 272 MTR3, exosome component 6; RNA, exosome, PM/SCL, p 100.0
2nn6_B 249 Exosome complex exonuclease RRP41; RNA, exosome, P 99.98
3m7n_D 258 Probable exosome complex exonuclease 1; exosome, R 99.98
2je6_B 250 RRP41, exosome complex exonuclease 1; nuclease, hy 99.98
2wp8_B 246 Exosome complex component SKI6; nucleus, hydrolase 99.97
3dd6_A 255 Ribonuclease PH; exoribonuclease, tRNA maturation, 99.97
1udn_A 255 Ribonuclease PH, RNAse PH; transferase, riken stru 99.97
1oys_A 245 Ribonuclease PH; transferase, tRNA processing; 2.4 99.97
3b4t_A 262 Ribonuclease PH; RNAse, tRNA nucleotidyltransferas 99.97
1r6l_A 239 Ribonuclease PH; beta-alpha-beta-alpha fold, hexam 99.97
2nn6_D 237 Exosome complex exonuclease RRP46; RNA, exosome, P 99.96
3m7n_G 259 Probable exosome complex exonuclease 2; exosome, R 99.96
2je6_A 277 RRP42, exosome complex exonuclease 2; nuclease, hy 99.96
2nn6_C 278 Exosome complex exonuclease RRP43; RNA, exosome, P 99.96
3hkm_A 246 OS03G0854200 protein; RNAse PH domain, phosphoryla 99.96
2po1_B 277 Probable exosome complex exonuclease 2; RNAse PH, 99.95
2wnr_A 271 Probable exosome complex exonuclease 2; phosphate 99.95
3gme_A 549 Polyribonucleotide nucleotidyltransferase; protein 99.94
4aid_A 726 Polyribonucleotide nucleotidyltransferase; transfe 99.94
2nn6_E 305 Exosome complex exonuclease RRP42; RNA, exosome, P 99.94
1e3p_A 757 Guanosine pentaphosphate synthetase; polyribonucle 99.94
3u1k_A 630 Polyribonucleotide nucleotidyltransferase 1, MITO; 99.93
2nn6_A 358 Polymyositis/scleroderma autoantigen 1; RNA, exoso 99.93
2wp8_A 305 Exosome complex component RRP45; nucleus, hydrolas 99.93
3cdi_A 723 Polynucleotide phosphorylase; mRNA turnover, RNAse 99.92
3krn_A 222 Protein C14A4.5, confirmed by transcript evidence; 99.86
3u1k_A 630 Polyribonucleotide nucleotidyltransferase 1, MITO; 99.68
3gme_A 549 Polyribonucleotide nucleotidyltransferase; protein 99.44
4aid_A 726 Polyribonucleotide nucleotidyltransferase; transfe 99.43
1e3p_A 757 Guanosine pentaphosphate synthetase; polyribonucle 99.4
3cdi_A 723 Polynucleotide phosphorylase; mRNA turnover, RNAse 99.39
1whu_A104 Polynucleotide phosphorylase; 3'-5' RNA exonucleas 92.05
>2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-32  Score=216.79  Aligned_cols=126  Identities=33%  Similarity=0.499  Sum_probs=112.9

Q ss_pred             cCcccCCCCCCCCCCCCCCCCCcceEEEeCCcCCCCeEEEEEECCeEEEEEEEcCccccc-ccccCceeEEEEEEEecCC
Q 037553           26 PPIFSGSDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKK-AMMYSNIGRLNCNVSYTTF  104 (151)
Q Consensus        26 ~~~~~~~~~~~~R~DGR~~~e~R~i~i~~g~l~~adGSa~v~~G~T~Vl~~V~gp~~~~~-~~~~~~~g~l~v~v~~~p~  104 (151)
                      |+-++..+++++|+|||.++|+|++.+++|+++++||||+|++|+|+|+|+|+||.+..+ +.+.+++|+|+|+|++.||
T Consensus         5 p~~~~~~l~~~~R~DGR~~~e~R~i~i~~g~l~~a~GSa~v~~G~T~Vl~~V~gp~e~~~~~~~~~~~g~l~v~~~~~p~   84 (249)
T 2po1_A            5 PEGLKLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPF   84 (249)
T ss_dssp             ----CCSBCSSCBTTSCCTTCCCCEEEEECCCSSSSEEEEEEETTEEEEEEEEEEEECSSGGGCCSSSCEEEEEEEECGG
T ss_pred             CcceEEecccCccCCCCCcccccCEEEEeCCcCCCCEEEEEEECCcEEEEEEEcCcccCcccccCCCceEEEEEEEeCCc
Confidence            333344468999999999999999999999999999999999999999999999887543 5677999999999999999


Q ss_pred             cccccC---CCchHHHHHHHHHHHHHhhhccCCCCCcEEEEEEEEEecCC
Q 037553          105 ATPIRG---QGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG  151 (151)
Q Consensus       105 a~~~r~---~~~~~~~l~~~l~~~l~~~I~l~~~p~~~I~I~v~VL~~DG  151 (151)
                      |+++++   +++++.+++++|+++|+++|++++||+|.|+|+++||++||
T Consensus        85 a~~~~~~~~~~~~~~~~s~li~r~l~~~i~l~~~p~~~i~I~~~VL~~dG  134 (249)
T 2po1_A           85 SVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADA  134 (249)
T ss_dssp             GSSSCCCSSCCHHHHHHHHHHHHHHGGGBCGGGSTTEEEEEEEEEEECCS
T ss_pred             ccccccCCCCCHHHHHHHHHHHHHHHhhccHHHCCCCEEEEEEEEEecCC
Confidence            998653   77899999999999999999999999999999999999998
>2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E Back     alignment and structure
>2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B Back     alignment and structure
>2wp8_B Exosome complex component SKI6; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Back     alignment and structure
>1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A Back     alignment and structure
>1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A Back     alignment and structure
>3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, STRU genomics, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transf; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A Back     alignment and structure
>2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G Back     alignment and structure
>2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* 3l7z_A Back     alignment and structure
>2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase, hydrolase; 1.98A {Oryza sativa japonica group} Back     alignment and structure
>2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* Back     alignment and structure
>2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>2wp8_A Exosome complex component RRP45; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAS hydrolase; 3.92A {Caenorhabditis elegans} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1whu_A Polynucleotide phosphorylase; 3'-5' RNA exonuclease; pnpase, alpha-helical domain, structural genomics; NMR {Mus musculus} SCOP: a.4.9.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d2je6b1148 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, 9e-16
d2ba0d1144 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, 4e-14
d2nn6e1187 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP 4e-13
d2nn6f1147 d.14.1.4 (F:29-175) Exosome complex exonuclease MT 5e-13
d1oysa1151 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Baci 9e-13
d2nn6b1145 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP 1e-12
d1r6la1151 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseu 2e-12
d2ba0g1176 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,E 2e-12
d2nn6c1181 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP 6e-12
d2nn6d1122 d.14.1.4 (D:25-146) Exosome complex exonuclease RR 9e-12
d1udsa1149 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aqui 5e-11
d2nn6a1184 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP 8e-11
d1e3ha3137 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/ 1e-10
d2je6a1191 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,E 1e-07
>d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 148 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Ribonuclease PH domain 1-like
domain: Exosome complex exonuclease 1, ECX1
species: Sulfolobus solfataricus [TaxId: 2287]

 Score = 67.5 bits (164), Expect = 9e-16
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 4/121 (3%)

Query: 35  DWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGP-RESKKAMMYSNIG 93
           D  R D R   + R      G + +A GSA  E GNTK I +V+GP     + +   +  
Sbjct: 9   DGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRA 68

Query: 94  RLNCNVSYTTFATPIRGQGSDHKD---FSSMLHKALEGAIILETFPKTTVDVFALVLESG 150
            L      T F+T  R   +  +     S ++ +ALE A+++E FP+T +DVF  +L++ 
Sbjct: 69  VLRVRYHMTPFSTDERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQAD 128

Query: 151 G 151
            
Sbjct: 129 A 129
>d2ba0d1 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 144 Back     information, alignment and structure
>d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} Length = 151 Back     information, alignment and structure
>d2nn6b1 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 151 Back     information, alignment and structure
>d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 176 Back     information, alignment and structure
>d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure
>d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} Length = 149 Back     information, alignment and structure
>d2nn6a1 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 137 Back     information, alignment and structure
>d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d2ba0d1144 Exosome complex exonuclease 1, ECX1 {Archaeoglobus 100.0
d2je6b1148 Exosome complex exonuclease 1, ECX1 {Sulfolobus so 100.0
d2nn6b1145 Exosome complex exonuclease RRP41 {Human (Homo sap 100.0
d1oysa1151 Ribonuclease PH, domain 1 {Bacillus subtilis [TaxI 99.97
d1udsa1149 Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId 99.97
d1r6la1151 Ribonuclease PH, domain 1 {Pseudomonas aeruginosa 99.97
d2ba0g1176 Exosome complex exonuclease 2,ECX2 {Archaeoglobus 99.95
d2nn6e1187 Exosome complex exonuclease RRP42 {Human (Homo sap 99.94
d2nn6d1122 Exosome complex exonuclease RRP46 {Human (Homo sap 99.94
d2je6a1191 Exosome complex exonuclease 2,ECX2 {Sulfolobus sol 99.94
d2nn6c1181 Exosome complex exonuclease RRP43 {Human (Homo sap 99.94
d2nn6f1147 Exosome complex exonuclease MTR3 {Human (Homo sapi 99.93
d1e3ha3137 Polynucleotide phosphorylase/guanosine pentaphosph 99.92
d2nn6a1184 Exosome complex exonuclease RRP45 {Human (Homo sap 99.92
d1e3ha2149 Polynucleotide phosphorylase/guanosine pentaphosph 99.75
>d2ba0d1 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Ribonuclease PH domain 1-like
domain: Exosome complex exonuclease 1, ECX1
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=100.00  E-value=7e-34  Score=205.36  Aligned_cols=120  Identities=31%  Similarity=0.506  Sum_probs=111.1

Q ss_pred             CCCCCCCCCCCCCCCCcceEEEeCCcCCCCeEEEEEECCeEEEEEEEcCccccc-ccccCceeEEEEEEEecCCcccccC
Q 037553           32 SDVDWLRPDSRGFHQCRPAFFRTGAVNSASGSAYAEFGNTKVIVSVFGPRESKK-AMMYSNIGRLNCNVSYTTFATPIRG  110 (151)
Q Consensus        32 ~~~~~~R~DGR~~~e~R~i~i~~g~l~~adGSa~v~~G~T~Vl~~V~gp~~~~~-~~~~~~~g~l~v~v~~~p~a~~~r~  110 (151)
                      .+++|+|+|||.++|+|++++++|+++++||||+|++|+|+|+|+|+||.+.+. ..+.++++.+.+++++.||+...+.
T Consensus         2 ~~~~g~R~DGR~~~e~R~i~i~~g~l~~a~GSa~v~~G~T~Vl~~V~gp~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~   81 (144)
T d2ba0d1           2 LIVDGLRLDGRKFDELRPIKIEASVLKRADGSCYLEMGKNKVIAAVFGPREVHPRHLQDPSKAIIRYRYNMAPFSVEERK   81 (144)
T ss_dssp             CBCSSCBTTSCCTTCCCCEEEEECCCSSSSEEEEEEETTEEEEEEEEEEEECCSGGGCCSSSCEEEEEEEECTTSSSSCC
T ss_pred             cccCCcCCCCCCCCCccCeEEEECCCCCCCceEEEEEcccceEEEEeccchhhhhhcccccceEEEEEEecCCccccccc
Confidence            358999999999999999999999999999999999999999999999988643 4467899999999999999998653


Q ss_pred             ---CCchHHHHHHHHHHHHHhhhccCCCCCcEEEEEEEEEecCC
Q 037553          111 ---QGSDHKDFSSMLHKALEGAIILETFPKTTVDVFALVLESGG  151 (151)
Q Consensus       111 ---~~~~~~~l~~~l~~~l~~~I~l~~~p~~~I~I~v~VL~~DG  151 (151)
                         +..++.+++++|+++|+++|+++.||+|+|+|+|+||++||
T Consensus        82 ~~~~~~~~~~l~~~l~~~l~~~i~~~~~~~~~i~v~v~VL~~DG  125 (144)
T d2ba0d1          82 RPGPDRRSIEISKVSKEAFEAVIMKELFPRSAIDIFVEVLQADA  125 (144)
T ss_dssp             CSSCCHHHHHHHHHHHHHHHTTBCGGGCTTEEEEEEEEEEECCT
T ss_pred             ccCCCchhhhhhhhhhhhhccccchhhcCCeEEEEEEEEEccCC
Confidence               66789999999999999999999999999999999999998
>d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nn6b1 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2nn6a1 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure