Citrus Sinensis ID: 037601

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MQGGLQGLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRHFVDETSIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLISLFRRPPSRKVETA
cccEEcccccccccccccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccccccEEEEccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccccc
cccccccccccccHccccEEEEEEEEcccccccHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHHHccccccccHcccccHHHHHHHHHHHHHHHHcccccccEEEcc
mqgglqglkadgdanqlptIAIVASydtfgaapalsvgsdsngsGVVALLEIVFAELLipcrhfvdetsiirsVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLsqtprvapfiskndPFIMALKKGLDDLIslfrrppsrkveta
mqgglqglkadgdanqLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRhfvdetsiirsVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDdlislfrrppsrkveta
MQGGLQGLKADGDANQLPTIAIVASYDTFGAAPALsvgsdsngsgvvALLEIVFAELLIPCRHFVDETSIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLISLFRRPPSRKVETA
****************LPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRHFVDETSIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLISLF***********
*QGG**********NQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRH*****SIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDD****************
********KADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRHFVDETSIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLISLFRRP********
****LQGLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRHFVDETSIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLISLFRRPPSRK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGGLQGLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIVFAELLIPCRHFVDETSIIRSVKDIFMVTKERIFKFLQTTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLISLFRRPPSRKVETA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q969V3 563 Nicalin OS=Homo sapiens G yes no 0.317 0.085 0.576 2e-08
Q8VCM8 563 Nicalin OS=Mus musculus G yes no 0.317 0.085 0.557 3e-08
Q5XIA1 563 Nicalin OS=Rattus norvegi yes no 0.317 0.085 0.557 3e-08
Q6NZ07 572 Nicalin-1 OS=Danio rerio yes no 0.317 0.083 0.562 6e-08
Q5ZJH2 562 Nicalin OS=Gallus gallus yes no 0.317 0.085 0.557 6e-08
>sp|Q969V3|NCLN_HUMAN Nicalin OS=Homo sapiens GN=NCLN PE=1 SV=2 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 36/52 (69%), Gaps = 4/52 (7%)

Query: 1   MQGGLQGLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEI 52
           ++G L GL  +     LPTI IVA YD FG AP LS+G+DSNGSGV  LLE+
Sbjct: 204 VEGRLTGLGGE----DLPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLEL 251
May antagonize Nodal signaling and subsequent organization of axial structures during mesodermal patterning.
Homo sapiens (taxid: 9606)
>sp|Q8VCM8|NCLN_MOUSE Nicalin OS=Mus musculus GN=Ncln PE=2 SV=2 Back     alignment and function description
>sp|Q5XIA1|NCLN_RAT Nicalin OS=Rattus norvegicus GN=Ncln PE=2 SV=1 Back     alignment and function description
>sp|Q6NZ07|NCLN_DANRE Nicalin-1 OS=Danio rerio GN=ncl1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJH2|NCLN_CHICK Nicalin OS=Gallus gallus GN=NCLN PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
225464882 563 PREDICTED: nicalin-1 [Vitis vinifera] gi 0.298 0.079 0.923 4e-18
224132302 540 predicted protein [Populus trichocarpa] 0.298 0.083 0.884 2e-17
224102873 548 predicted protein [Populus trichocarpa] 0.284 0.078 0.884 2e-17
297815552 565 hypothetical protein ARALYDRAFT_905545 [ 0.298 0.079 0.846 4e-17
171451996 567 hypothetical protein [Bruguiera gymnorhi 0.298 0.079 0.865 4e-17
449443466 563 PREDICTED: nicalin-like [Cucumis sativus 0.298 0.079 0.865 1e-16
255565711 559 Nicalin precursor, putative [Ricinus com 0.509 0.137 0.535 1e-16
356539234 562 PREDICTED: nicalin-1-like [Glycine max] 0.298 0.080 0.846 1e-16
356544744 552 PREDICTED: nicalin-like [Glycine max] 0.298 0.081 0.846 2e-16
15229938 565 uncharacterized protein [Arabidopsis tha 0.298 0.079 0.826 2e-16
>gi|225464882|ref|XP_002273260.1| PREDICTED: nicalin-1 [Vitis vinifera] gi|296084876|emb|CBI28285.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%)

Query: 1   MQGGLQGLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEI 52
           +QG L GLK DGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEI
Sbjct: 205 IQGWLPGLKVDGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEI 256

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132302|ref|XP_002328235.1| predicted protein [Populus trichocarpa] gi|222837750|gb|EEE76115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102873|ref|XP_002312837.1| predicted protein [Populus trichocarpa] gi|222849245|gb|EEE86792.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297815552|ref|XP_002875659.1| hypothetical protein ARALYDRAFT_905545 [Arabidopsis lyrata subsp. lyrata] gi|297321497|gb|EFH51918.1| hypothetical protein ARALYDRAFT_905545 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|171451996|dbj|BAG15862.1| hypothetical protein [Bruguiera gymnorhiza] Back     alignment and taxonomy information
>gi|449443466|ref|XP_004139498.1| PREDICTED: nicalin-like [Cucumis sativus] gi|449525770|ref|XP_004169889.1| PREDICTED: nicalin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255565711|ref|XP_002523845.1| Nicalin precursor, putative [Ricinus communis] gi|223536933|gb|EEF38571.1| Nicalin precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356539234|ref|XP_003538104.1| PREDICTED: nicalin-1-like [Glycine max] Back     alignment and taxonomy information
>gi|356544744|ref|XP_003540807.1| PREDICTED: nicalin-like [Glycine max] Back     alignment and taxonomy information
>gi|15229938|ref|NP_190019.1| uncharacterized protein [Arabidopsis thaliana] gi|7529767|emb|CAB86911.1| putative protein [Arabidopsis thaliana] gi|110740653|dbj|BAE98429.1| hypothetical protein [Arabidopsis thaliana] gi|332644371|gb|AEE77892.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:2100192565 AT3G44330 [Arabidopsis thalian 0.490 0.130 0.493 2.3e-26
TAIR|locus:2100192 AT3G44330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 2.3e-26, Sum P(2) = 2.3e-26
 Identities = 40/81 (49%), Positives = 51/81 (62%)

Query:    62 RHFVDETSIIRSVKDIFMVTKERIF-------KFLQTTVAWLSNPSYIRSWLDLLSQTPR 114
             R  V+E +II+ VK +     + I+       K      +   NP Y+RSWLDLLSQTPR
Sbjct:   405 RQLVNEDAIIKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPR 464

Query:   115 VAPFISKNDPFIMALKKGLDD 135
             VAPF+SKN+P IMALKK L+D
Sbjct:   465 VAPFLSKNEPLIMALKKELED 485
GO:0009966 "regulation of signal transduction" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016485 "protein processing" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037308001
SubName- Full=Chromosome undetermined scaffold_87, whole genome shotgun sequence; (563 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
cd03882290 cd03882, M28_nicalin_like, M28 Zn-Peptidase Nicali 1e-15
cd05640279 cd05640, M28_like_1, M28 Zn-Peptidases 6e-06
cd02690252 cd02690, M28, M28 Zn-peptidases include aminopepti 0.003
>gnl|CDD|193503 cd03882, M28_nicalin_like, M28 Zn-Peptidase Nicalin, Nicastrin-like protein Back     alignment and domain information 
 Score = 71.6 bits (176), Expect = 1e-15
 Identities = 30/49 (61%), Positives = 35/49 (71%)

Query: 5   LQGLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIV 53
           ++G      A  LPTI IVA YD+FG APALS G+DSNGSGV ALLE+ 
Sbjct: 73  IEGRLTGLGAEDLPTIVIVAHYDSFGVAPALSSGADSNGSGVAALLELA 121

Peptidase M28 family, Nicalin (nicastrin-like protein) subfamily. Nicalin is distantly related to Nicastrin, a component of the Alzheimer's disease-associated gamma-secretase, and forms a complex with Nomo (nodal modulator) pM5. Similar to Nicastrin, Nicalin lacks the amino-acid conservation required for catalytically active aminopeptidases. Functional studies in zebrafish embryos and cultured human cells reveal that nicalin and Nomo collaborate to antagonize the Nodal/TGFbeta signaling pathway. Thus, nicastrin and nicalin are both associated with protein complexes involved in cell fate decisions during early embryonic development. Length = 290
>gnl|CDD|193519 cd05640, M28_like_1, M28 Zn-Peptidases Back     alignment and domain information
>gnl|CDD|193493 cd02690, M28, M28 Zn-peptidases include aminopeptidases and carboxypeptidases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG2526555 consensus Predicted aminopeptidases - M20/M25/M40 100.0
PF04389179 Peptidase_M28: Peptidase family M28; InterPro: IPR 99.25
PRK10199346 alkaline phosphatase isozyme conversion aminopepti 98.81
COG2234435 Iap Predicted aminopeptidases [General function pr 98.33
KOG2194 834 consensus Aminopeptidases of the M20 family [Postt 97.75
KOG2195 702 consensus Transferrin receptor and related protein 97.67
PF05450234 Nicastrin: Nicastrin; InterPro: IPR008710 Nicastri 97.63
TIGR03176 406 AllC allantoate amidohydrolase. This enzyme cataly 97.14
PRK12890 414 allantoate amidohydrolase; Reviewed 96.9
TIGR01879 401 hydantase amidase, hydantoinase/carbamoylase famil 96.77
PRK13590 591 putative bifunctional OHCU decarboxylase/allantoat 96.42
PRK12891 414 allantoate amidohydrolase; Reviewed 96.07
PRK06133 410 glutamate carboxypeptidase; Reviewed 95.85
PRK13381 404 peptidase T; Provisional 95.82
PRK13799 591 unknown domain/N-carbamoyl-L-amino acid hydrolase 95.79
PRK07906 426 hypothetical protein; Provisional 95.64
PRK09290 413 allantoate amidohydrolase; Reviewed 95.61
PRK12893 412 allantoate amidohydrolase; Reviewed 95.53
PRK06915 422 acetylornithine deacetylase; Validated 95.48
TIGR01883 361 PepT-like peptidase T-like protein. This model rep 95.47
TIGR01882 410 peptidase-T peptidase T. This model represents a t 95.47
PRK05469 408 peptidase T; Provisional 95.46
PRK09133 472 hypothetical protein; Provisional 95.43
TIGR01910 375 DapE-ArgE acetylornithine deacetylase or succinyl- 95.18
PRK06837 427 acetylornithine deacetylase; Provisional 94.88
PRK13983 400 diaminopimelate aminotransferase; Provisional 94.86
PRK08596 421 acetylornithine deacetylase; Validated 94.72
PRK13007 352 succinyl-diaminopimelate desuccinylase; Reviewed 94.57
PRK09104 464 hypothetical protein; Validated 94.55
PRK12892 412 allantoate amidohydrolase; Reviewed 94.29
TIGR01893 477 aa-his-dipept aminoacyl-histidine dipeptidase. 94.17
PRK13013 427 succinyl-diaminopimelate desuccinylase; Reviewed 94.06
PRK08262 486 hypothetical protein; Provisional 94.02
TIGR01892 364 AcOrn-deacetyl acetylornithine deacetylase (ArgE). 93.86
PRK07907 449 hypothetical protein; Provisional 93.82
TIGR01880 400 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase 93.74
PF01546189 Peptidase_M20: Peptidase family M20/M25/M40 This f 92.66
PRK04443 348 acetyl-lysine deacetylase; Provisional 92.27
PRK08652 347 acetylornithine deacetylase; Provisional 92.2
PF09940 386 DUF2172: Domain of unknown function (DUF2172); Int 92.18
PRK13009 375 succinyl-diaminopimelate desuccinylase; Reviewed 91.97
PRK13004 399 peptidase; Reviewed 91.81
PRK07473 376 carboxypeptidase; Provisional 91.73
PRK08201 456 hypothetical protein; Provisional 91.64
PRK07338 402 hypothetical protein; Provisional 91.48
PRK07522 385 acetylornithine deacetylase; Provisional 91.37
PRK00466 346 acetyl-lysine deacetylase; Validated 91.19
PRK08588 377 succinyl-diaminopimelate desuccinylase; Reviewed 90.88
PRK06446 436 hypothetical protein; Provisional 90.12
TIGR01900 373 dapE-gram_pos succinyl-diaminopimelate desuccinyla 90.09
TIGR01902 336 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine d 89.6
PRK05111 383 acetylornithine deacetylase; Provisional 89.18
COG4882 486 Predicted aminopeptidase, Iap family [General func 88.78
PRK15026 485 aminoacyl-histidine dipeptidase; Provisional 88.15
PRK08651 394 succinyl-diaminopimelate desuccinylase; Reviewed 87.86
PRK07079 469 hypothetical protein; Provisional 87.5
TIGR01891 363 amidohydrolases amidohydrolase. This model represe 87.19
TIGR03320 395 ygeY M20/DapE family protein YgeY. Members of this 86.78
TIGR03526 395 selenium_YgeY putative selenium metabolism hydrola 86.44
PRK08554 438 peptidase; Reviewed 86.21
COG0624 409 ArgE Acetylornithine deacetylase/Succinyl-diaminop 85.69
PLN02280 478 IAA-amino acid hydrolase 84.27
TIGR01886 466 dipeptidase dipeptidase PepV. This model represent 84.14
PLN02693 437 IAA-amino acid hydrolase 82.33
PRK07205 444 hypothetical protein; Provisional 81.33
TIGR01246 370 dapE_proteo succinyl-diaminopimelate desuccinylase 80.93
>KOG2526 consensus Predicted aminopeptidases - M20/M25/M40 family [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-37  Score=274.47  Aligned_cols=145  Identities=40%  Similarity=0.591  Sum_probs=134.5

Q ss_pred             CeEEec-CCCCCCCCCCCCeEEEEeecccccCCCCCCCCCCCchhHHHHHHHHH--HHhh--------------------
Q 037601            1 MQGGLQ-GLKADGDANQLPTIAIVASYDTFGAAPALSVGSDSNGSGVVALLEIV--FAEL--------------------   57 (151)
Q Consensus         1 i~g~l~-G~~~~~~~~~~~~iv~~ahyD~~g~~~~~~~gaddn~sg~~~lle~a--f~~~--------------------   57 (151)
                      |+|||+ |.+.++|++++|+|+|+||||+||+.|+++.|||.|||||++|||+|  ||++                    
T Consensus       196 I~G~L~~glra~~dg~~lPtIaivA~ydtfgaap~lsvgADSNGSGvvaLLelarlfSkly~ypsTrakYnLlF~lt~aG  275 (555)
T KOG2526|consen  196 IVGRLSSGLRAEGDGSALPTIAIVAHYDTFGAAPGLSVGADSNGSGVVALLELARLFSKLYDYPSTRAKYNLLFILTAAG  275 (555)
T ss_pred             EEeecccccccccccccCCeEEEEEeccccccCCCCCCCCCCCCccHHHHHHHHHHHHHHhcCcccccceeEEEEEccCc
Confidence            789999 98877789999999999999999999999999999999999999999  9988                    


Q ss_pred             --------------------------------------------------------------------------------
Q 037601           58 --------------------------------------------------------------------------------   57 (151)
Q Consensus        58 --------------------------------------------------------------------------------   57 (151)
                                                                                                      
T Consensus       276 ~lNyqGTkkWLe~dd~~lq~nVdfaiCLdtig~~~s~l~mHvsKpP~dnt~i~qffr~l~svAek~~~~v~~khkkInla  355 (555)
T KOG2526|consen  276 KLNYQGTKKWLEFDDADLQKNVDFAICLDTIGRKTSGLFMHVSKPPSDNTVIAQFFRRLNSVAEKKNIEVVTKHKKINLA  355 (555)
T ss_pred             cccccchhhhhhcchHHHHhcccEEEEhhhhccccCceEEEccCCCCcchHHHHHHHHhhhhchhcceEEEEEeeeEeec
Confidence                                                                                            


Q ss_pred             ----------------------------------hc-CCCcccchhhhccchhhHHhhhhhhcee--eccc-----cccc
Q 037601           58 ----------------------------------LI-PCRHFVDETSIIRSVKDIFMVTKERIFK--FLQT-----TVAW   95 (151)
Q Consensus        58 ----------------------------------I~-d~r~~v~~~~L~rNvkIIAESLa~~iY~--it~~-----~gsl   95 (151)
                                                        || |+|+.+++.+|++|+|||||+|+++||.  ..+.     .+++
T Consensus       356 ~s~lAWEHErFsikR~pAfTLS~l~Sprdp~rnsi~~d~rsrldedtLi~ntRlIaEAla~~iy~ekG~dp~s~vf~eql  435 (555)
T KOG2526|consen  356 SSRLAWEHERFSIKRMPAFTLSTLPSPRDPARNSILLDLRSRLDEDTLIDNTRLIAEALAGYIYDEKGPDPDSRVFSEQL  435 (555)
T ss_pred             cchhhhhhhhhhhhcccceeeccCCCCcchhhccccccchhhhhhhhhhhhhhHHHHHHHHHHhccCCCCCCcccchhhh
Confidence                                              66 9999999999999999999999999994  2111     2999


Q ss_pred             ccChhHHHHHHHhhhcCCCCccccCCCchHHHHHHHhh----hhhhhhhcCCCC
Q 037601           96 LSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGL----DDLISLFRRPPS  145 (151)
Q Consensus        96 ~I~~~~L~s~l~~LS~~PRaaqll~kd~~~~~~L~~~l----~~v~~~~~k~d~  145 (151)
                      +|+++++++||+||+++||.+|+++||++|+++||+.|    ++||++|.|+|+
T Consensus       436 ai~~e~vds~ld~f~~~Pr~a~l~~kde~~~s~lk~~le~Yln~vk~~h~k~Da  489 (555)
T KOG2526|consen  436 AISKEAVDSFLDQFASRPRPAGLQRKDESITSNLKSVLEGYLNVVKSAHTKTDA  489 (555)
T ss_pred             hcCHHHHHHHHHHhccCCcccccccCcchHHHHHHHHHHHHHhhhhheeeccCc
Confidence            99999999999999999999999999999999988855    999999999997

>PF04389 Peptidase_M28: Peptidase family M28; InterPro: IPR007484 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10199 alkaline phosphatase isozyme conversion aminopeptidase; Provisional Back     alignment and domain information
>COG2234 Iap Predicted aminopeptidases [General function prediction only] Back     alignment and domain information
>KOG2194 consensus Aminopeptidases of the M20 family [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2195 consensus Transferrin receptor and related proteins containing the protease-associated (PA) domain [Posttranslational modification, protein turnover, chaperones; Inorganic ion transport and metabolism; General function prediction only] Back     alignment and domain information
>PF05450 Nicastrin: Nicastrin; InterPro: IPR008710 Nicastrin and presenilin are two major components of the gamma-secretase complex, which executes the intramembrane proteolysis of type I integral membrane proteins such as the amyloid precursor protein (APP) and Notch Back     alignment and domain information
>TIGR03176 AllC allantoate amidohydrolase Back     alignment and domain information
>PRK12890 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>TIGR01879 hydantase amidase, hydantoinase/carbamoylase family Back     alignment and domain information
>PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional Back     alignment and domain information
>PRK12891 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK06133 glutamate carboxypeptidase; Reviewed Back     alignment and domain information
>PRK13381 peptidase T; Provisional Back     alignment and domain information
>PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional Back     alignment and domain information
>PRK07906 hypothetical protein; Provisional Back     alignment and domain information
>PRK09290 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK12893 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK06915 acetylornithine deacetylase; Validated Back     alignment and domain information
>TIGR01883 PepT-like peptidase T-like protein Back     alignment and domain information
>TIGR01882 peptidase-T peptidase T Back     alignment and domain information
>PRK05469 peptidase T; Provisional Back     alignment and domain information
>PRK09133 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>PRK06837 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK13983 diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK08596 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK13007 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK09104 hypothetical protein; Validated Back     alignment and domain information
>PRK12892 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase Back     alignment and domain information
>PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK08262 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE) Back     alignment and domain information
>PRK07907 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase Back     alignment and domain information
>PF01546 Peptidase_M20: Peptidase family M20/M25/M40 This family only corresponds to M20 family; InterPro: IPR002933 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK04443 acetyl-lysine deacetylase; Provisional Back     alignment and domain information
>PRK08652 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PF09940 DUF2172: Domain of unknown function (DUF2172); InterPro: IPR012353 The proteins in this entry are encoded by genes located in polysaccharide biosynthesis gene clusters, and are therefore believed to be involved in polysaccharide biosynthesis Back     alignment and domain information
>PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK13004 peptidase; Reviewed Back     alignment and domain information
>PRK07473 carboxypeptidase; Provisional Back     alignment and domain information
>PRK08201 hypothetical protein; Provisional Back     alignment and domain information
>PRK07338 hypothetical protein; Provisional Back     alignment and domain information
>PRK07522 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK00466 acetyl-lysine deacetylase; Validated Back     alignment and domain information
>PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK06446 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase Back     alignment and domain information
>PRK05111 acetylornithine deacetylase; Provisional Back     alignment and domain information
>COG4882 Predicted aminopeptidase, Iap family [General function prediction only] Back     alignment and domain information
>PRK15026 aminoacyl-histidine dipeptidase; Provisional Back     alignment and domain information
>PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK07079 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01891 amidohydrolases amidohydrolase Back     alignment and domain information
>TIGR03320 ygeY M20/DapE family protein YgeY Back     alignment and domain information
>TIGR03526 selenium_YgeY putative selenium metabolism hydrolase Back     alignment and domain information
>PRK08554 peptidase; Reviewed Back     alignment and domain information
>COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02280 IAA-amino acid hydrolase Back     alignment and domain information
>TIGR01886 dipeptidase dipeptidase PepV Back     alignment and domain information
>PLN02693 IAA-amino acid hydrolase Back     alignment and domain information
>PRK07205 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase, proteobacterial clade Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.5 bits (91), Expect = 2e-04
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 14/76 (18%)

Query: 86  FKFLQ-----TTVAWLSNPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDDLI--- 137
           F+FL+      + AW ++ S     L+ L Q     P+I  NDP    L   + D +   
Sbjct: 500 FRFLEQKIRHDSTAWNASGSI----LNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKI 555

Query: 138 --SLFRRPPSRKVETA 151
             +L     +  +  A
Sbjct: 556 EENLICSKYTDLLRIA 571

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
4f9u_A 312 CG32412; alpha/beta hydrolase, PGlu formation, PE, 99.38
4fai_A330 CG5976, isoform B; alpha/beta hydrolase, PGlu form 99.33
4fuu_A309 Leucine aminopeptidase; phosphorylase/hydrolase li 99.26
3pb6_X330 Glutaminyl-peptide cyclotransferase-like protein; 99.05
3tc8_A309 Leucine aminopeptidase; phosphorylase/hydrolase-li 98.93
2afw_A329 Glutaminyl-peptide cyclotransferase; alpha-beta pr 98.91
3gux_A314 Putative Zn-dependent exopeptidase; aminopeptidase 98.87
3iib_A444 Peptidase M28; YP_926796.1, structural genomics, J 98.79
3kas_A 640 Transferrin receptor protein 1; transferrin recept 98.75
2ek8_A421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 98.73
3fed_A 707 Glutamate carboxypeptidase III; metallopeptidase, 98.6
1rtq_A299 Bacterial leucyl aminopeptidase; bimetallic, zinc, 98.58
1tkj_A284 Aminopeptidase, SGAP; double-zinc metalloproteinas 98.48
3k9t_A 435 Putative peptidase; structural genomics, joint cen 98.44
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, si 97.77
3t68_A268 Succinyl-diaminopimelate desuccinylase; DAPE, csgi 97.5
3n5f_A 408 L-carbamoylase, N-carbamoyl-L-amino acid hydrolase 97.46
4h2k_A269 Succinyl-diaminopimelate desuccinylase; DAPE, MCSG 97.43
3ct9_A 356 Acetylornithine deacetylase; NP_812461.1, A putati 97.19
3pfo_A 433 Putative acetylornithine deacetylase; metal bindin 97.03
2pok_A 481 Peptidase, M20/M25/M40 family; M20 family peptidas 97.0
2zog_A 479 Cytosolic non-specific dipeptidase; metallopeptida 96.93
3gb0_A 373 Peptidase T; NP_980509.1, aminopeptidase PEPT, pep 96.63
1cg2_A 393 Carboxypeptidase G2; metallocarboxypeptidase, hydr 96.48
3tx8_A 369 Succinyl-diaminopimelate desuccinylase; peptidase, 96.46
3dlj_A 485 Beta-Ala-His dipeptidase; CNDP1, carnosine dipepti 96.45
2rb7_A 364 Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat 96.43
3ife_A 434 Peptidase T; metallopeptidase, aminopeptidase, hyd 96.33
1z2l_A 423 Allantoate amidohydrolase; ALLC, purine cataboli a 96.31
1vhe_A373 Aminopeptidase/glucanase homolog; structural genom 95.97
1vgy_A 393 Succinyl-diaminopimelate desuccinylase; structural 95.93
2v8h_A 474 Beta-alanine synthase; amidohydrolase, alpha and b 95.86
3rza_A 396 Tripeptidase; phosphorylase/hydrolase-like, struct 95.69
3isz_A 377 Succinyl-diaminopimelate desuccinylase; DAPE, Zn-b 95.61
2qyv_A 487 XAA-His dipeptidase; YP_718209.1, structural genom 95.41
3mru_A 490 Aminoacyl-histidine dipeptidase; metalloprotease, 95.3
1ysj_A 404 Protein YXEP; M20 family peptidase, dinuclear meta 95.29
2wyr_A332 Cobalt-activated peptidase TET1; hydrolase, large 95.28
2fvg_A340 Endoglucanase; TM1049, structural genomics, joint 95.21
1y0y_A353 FRV operon protein FRVX; aminopeptidase, PDZ, hydr 95.13
1fno_A 417 Peptidase T; metallo peptidase, protease, hydrolas 94.99
1lfw_A 470 PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac 94.97
2f7v_A 369 Aectylcitrulline deacetylase; alpha/beta, hydrolas 94.86
3khx_A 492 Putative dipeptidase sacol1801; DAPE, metallopepti 94.79
3pfe_A 472 Succinyl-diaminopimelate desuccinylase; metal bind 94.46
1xmb_A 418 IAA-amino acid hydrolase homolog 2; structural gen 94.43
2gre_A349 Deblocking aminopeptidase; structural genomi prote 94.32
3io1_A 445 Aminobenzoyl-glutamate utilization protein; peptid 91.07
1ylo_A348 Hypothetical protein SF2450; structural genomics, 88.97
3ram_A 394 HMRA protein; two-domain, catalytic (alpha-beta-al 87.13
3cpx_A321 Aminopeptidase, M42 family; YP_676701.1, putative 85.63
2wzn_A 354 TET3, 354AA long hypothetical operon protein FRV; 81.4
>4f9u_A CG32412; alpha/beta hydrolase, PGlu formation, PE, alzheimer'S diseas pyroglutamate, PGlu-amyloid, glycosylation, transferase, HY; HET: PBD NAG BMA MAN; 1.80A {Drosophila melanogaster} PDB: 4f9v_A* Back     alignment and structure
Probab=99.38  E-value=1.6e-13  Score=113.43  Aligned_cols=73  Identities=16%  Similarity=0.115  Sum_probs=51.5

Q ss_pred             CeEEecCCCCCCCCCCCCeEEEEeecccccCCC-CCCCCCCCchhHHHHHHHHH--HHhhhcCCCcccchhhhccchhhH
Q 037601            1 MQGGLQGLKADGDANQLPTIAIVASYDTFGAAP-ALSVGSDSNGSGVVALLEIV--FAELLIPCRHFVDETSIIRSVKDI   77 (151)
Q Consensus         1 i~g~l~G~~~~~~~~~~~~iv~~ahyD~~g~~~-~~~~gaddn~sg~~~lle~a--f~~~I~d~r~~v~~~~L~rNvkII   77 (151)
                      |||+++|..       .++|+++|||||.+... ...+||+|||||||+|||+|  |++++....    .....++++++
T Consensus        69 ii~~~~~~~-------~~~vvl~aHyDs~~~~~~~~~~GA~DnaSGvA~lLElAR~l~~~~~~~~----~~~p~~tI~fv  137 (312)
T 4f9u_A           69 VVGTINPQA-------QNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEF----RNRSDVGLMLI  137 (312)
T ss_dssp             EEEEESTTS-------SEEEEEEEECCCCCCTTCTTCCCTTTTHHHHHHHHHHHHHTHHHHTTGG----GSCSSEEEEEE
T ss_pred             EEEEECCCC-------CceEEEEEEEecCCCCCCCCCCCccCCcccHHHHHHHHHHHHHHHHhhc----cCCCCceEEEE
Confidence            689999842       37899999999987643 36799999999999999999  665431100    11345566666


Q ss_pred             Hhhhhhh
Q 037601           78 FMVTKER   84 (151)
Q Consensus        78 AESLa~~   84 (151)
                      +..-+|.
T Consensus       138 ~fdaEE~  144 (312)
T 4f9u_A          138 FFDGEEA  144 (312)
T ss_dssp             EESCCSC
T ss_pred             EecCccc
Confidence            6554443
>4fai_A CG5976, isoform B; alpha/beta hydrolase, PGlu formation, PE, alzheimer'S diseas pyroglutamate, PGlu-amyloid, transferase, hydrolase; HET: PBD; 1.65A {Drosophila melanogaster} PDB: 4fbe_A* Back     alignment and structure
>4fuu_A Leucine aminopeptidase; phosphorylase/hydrolase like fold, peptidase family M28, STR genomics, joint center for structural genomics; 1.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pb6_X Glutaminyl-peptide cyclotransferase-like protein; alpha/beta protein, alpha/beta-mixed fold, glutaminyl cyclas membrane; 1.05A {Homo sapiens} PDB: 3pb4_X 3pb7_X* 3pb8_X* 3pb9_X* Back     alignment and structure
>3tc8_A Leucine aminopeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG; 1.06A {Parabacteroides distasonis} Back     alignment and structure
>2afw_A Glutaminyl-peptide cyclotransferase; alpha-beta protein, metalloprotein; HET: AHN; 1.56A {Homo sapiens} SCOP: c.56.5.8 PDB: 2afo_A 2afm_A* 2afx_A* 2afz_A 3pbb_A* 2zed_A 2zeh_A 2afu_A 2zee_A 2zeo_A 2zef_A 2zem_A 2zel_A 2zen_A 3pbe_A 2zeg_A 2zep_A 2afs_A 3si0_A* 3si2_A* ... Back     alignment and structure
>3gux_A Putative Zn-dependent exopeptidase; aminopeptidase, phosphorylase/hydrolase-like fold, structura genomics; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} Back     alignment and structure
>3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Back     alignment and structure
>3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... Back     alignment and structure
>1rtq_A Bacterial leucyl aminopeptidase; bimetallic, zinc, high resolution, hydrolase; 0.95A {Vibrio proteolyticus} SCOP: c.56.5.4 PDB: 1txr_A* 1xry_A* 2dea_A 2nyq_A 3fh4_A 3vh9_A* 1lok_A 1cp6_A 1ft7_A* 1igb_A* 1amp_A 2iq6_A 2prq_A 3b3v_A 3b3w_A 3b7i_A* 3b3t_A 3b35_A 3b3c_A* 3b3s_A ... Back     alignment and structure
>1tkj_A Aminopeptidase, SGAP; double-zinc metalloproteinase, calcium activation, protein- inhibitor complex, hydrolase; HET: MED; 1.15A {Streptomyces griseus} SCOP: c.56.5.4 PDB: 1f2o_A 1f2p_A* 1cp7_A 1qq9_A* 1tf9_A* 1tf8_A* 1tkh_A* 1tkf_A* 1xbu_A* 1xjo_A Back     alignment and structure
>3k9t_A Putative peptidase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, aminop hydrolase; 2.37A {Clostridium acetobutylicum} Back     alignment and structure
>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Back     alignment and structure
>3t68_A Succinyl-diaminopimelate desuccinylase; DAPE, csgid, metalloenzyme, structural genomics; 1.65A {Vibrio cholerae o1 biovar el tor} PDB: 3t6m_A Back     alignment and structure
>3n5f_A L-carbamoylase, N-carbamoyl-L-amino acid hydrolase; hinge domain, M20 peptidase family, evolution, residue, dimerization domain; 2.75A {Bacillus stearothermophilus} Back     alignment and structure
>4h2k_A Succinyl-diaminopimelate desuccinylase; DAPE, MCSG, PSI-biology, structural genomics, midwest center structural genomics, hydrolase; 1.84A {Haemophilus influenzae} Back     alignment and structure
>3ct9_A Acetylornithine deacetylase; NP_812461.1, A putative zinc peptidase, peptidase family M20 structural genomics; 2.31A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} Back     alignment and structure
>2pok_A Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural GENO PSI-2, protein structure initiative; HET: BGC; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>2zog_A Cytosolic non-specific dipeptidase; metallopeptidase, protein-inhibitor complex, CNDP2, CNDP DIP 2, bestatin, L-carnosine, carnosinase, Zn; HET: BES; 1.70A {Mus musculus} PDB: 2zof_A* Back     alignment and structure
>3gb0_A Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidase family M20/M25/M structural genomics, joint center for structural genomics; 2.04A {Bacillus cereus atcc 10987} Back     alignment and structure
>1cg2_A Carboxypeptidase G2; metallocarboxypeptidase, hydrolase; 2.50A {Pseudomonas SP} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>3tx8_A Succinyl-diaminopimelate desuccinylase; peptidase, structural genomics, joint center for structural JCSG; 2.97A {Corynebacterium glutamicum} Back     alignment and structure
>3dlj_A Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 1, structural genomics, structu genomics consortium, SGC, metallopeptidase M20 family; 2.26A {Homo sapiens} Back     alignment and structure
>2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3ife_A Peptidase T; metallopeptidase, aminopeptidase, hydro metal-binding, metalloprotease, protease; HET: SUC; 1.55A {Bacillus anthracis} Back     alignment and structure
>1z2l_A Allantoate amidohydrolase; ALLC, purine cataboli allantoin utilization, structural genomics, PSI, Pro structure initiative; HET: 1AL; 2.25A {Escherichia coli} SCOP: c.56.5.4 d.58.19.1 PDB: 2imo_A Back     alignment and structure
>1vhe_A Aminopeptidase/glucanase homolog; structural genomics, unknown function; HET: MSE; 1.90A {Bacillus subtilis} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics, unknown function; HET: MSE; 1.90A {Neisseria meningitidis} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>2v8h_A Beta-alanine synthase; amidohydrolase, alpha and beta protein, DI-zinc center, COMP N-carbamyl-beta-alanine, hydrolase; HET: BCN; 2.0A {Saccharomyces kluyveri} PDB: 2v8d_A* 2vl1_A 2v8g_A 2v8v_A 1r43_A 1r3n_A Back     alignment and structure
>3rza_A Tripeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: CIT PG4 PGE; 2.10A {Staphylococcus aureus subsp} Back     alignment and structure
>3isz_A Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2, protein struc initiative; 2.00A {Haemophilus influenzae} PDB: 3ic1_A Back     alignment and structure
>2qyv_A XAA-His dipeptidase; YP_718209.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; 2.11A {Haemophilus somnus 129PT} Back     alignment and structure
>3mru_A Aminoacyl-histidine dipeptidase; metalloprotease, homodimer, hydrolase; 3.00A {Vibrio alginolyticus} Back     alignment and structure
>1ysj_A Protein YXEP; M20 family peptidase, dinuclear metal binding, structural GE PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>2wyr_A Cobalt-activated peptidase TET1; hydrolase, large SELF-assembled dodecamer, hyperthermophilic; 2.24A {Pyrococcus horikoshii} PDB: 2cf4_A Back     alignment and structure
>2fvg_A Endoglucanase; TM1049, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.01A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>1y0y_A FRV operon protein FRVX; aminopeptidase, PDZ, hydrolase; HET: ATI; 1.60A {Pyrococcus horikoshii} SCOP: b.49.3.1 c.56.5.4 PDB: 1y0r_A* 1xfo_A Back     alignment and structure
>1fno_A Peptidase T; metallo peptidase, protease, hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.56.5.4 d.58.19.1 PDB: 1vix_A Back     alignment and structure
>1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>2f7v_A Aectylcitrulline deacetylase; alpha/beta, hydrolase; 1.75A {Xanthomonas campestris} PDB: 2f8h_A Back     alignment and structure
>3khx_A Putative dipeptidase sacol1801; DAPE, metallopeptidase, hydrolase, metal-bindin metalloprotease, protease; 2.30A {Staphylococcus aureus} PDB: 3ki9_A 3khz_A Back     alignment and structure
>3pfe_A Succinyl-diaminopimelate desuccinylase; metal binding, merops M20 familiy, phosphorylase/hydrolase-L structural genomics; HET: MSE; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>1xmb_A IAA-amino acid hydrolase homolog 2; structural genomics, protein structure initiative, CESG AT5G56660, ILL2, indole-3-acetic acid, auxin; 2.00A {Arabidopsis thaliana} SCOP: c.56.5.4 d.58.19.1 PDB: 2q43_A Back     alignment and structure
>2gre_A Deblocking aminopeptidase; structural genomi protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; 2.65A {Bacillus cereus} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>3io1_A Aminobenzoyl-glutamate utilization protein; peptidase_M20D superfamily, protein structure initiative II, NYSGXRC, structural genomics; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ylo_A Hypothetical protein SF2450; structural genomics, MCSG, PSI, structure initiative; 2.15A {Shigella flexneri 2a str} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>3ram_A HMRA protein; two-domain, catalytic (alpha-beta-alpha) motif, tetramerisat (alpha,beta,BETA,alpha), endoprotease, hydrolase; 2.70A {Staphylococcus aureus} Back     alignment and structure
>3cpx_A Aminopeptidase, M42 family; YP_676701.1, putative M42 glutamyl aminopeptidase, structura genomics; 2.39A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2wzn_A TET3, 354AA long hypothetical operon protein FRV; protease, hydrolase, thermophilic, SELF-compartmentalising; 1.90A {Pyrococcus horikoshii} PDB: 2pe3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d2afwa1329 Glutaminyl-peptide cyclotransferase, QPCT {Human ( 99.35
d1rtqa_291 Aminopeptidase {Aeromonas proteolytica [TaxId: 671 99.3
d1de4c3294 Transferrin receptor ectodomain, protease-like dom 99.28
d3bi1a3304 Glutamate carboxypeptidase II FOLH1 {Human (Homo s 99.19
d1tkja1277 Aminopeptidase {Streptomyces griseus [TaxId: 1911] 99.14
d1vhoa2248 Putative endoglucanase TM1048, catalytic domain {T 98.28
d2fvga2255 Endoglucanase TM1049 {Thermotoga maritima [TaxId: 98.27
d1yloa2264 Aminopeptidase YpdE {Shigella flexneri [TaxId: 623 98.07
d1z2la1293 Allantoate amidohydrolase AllC catalytic domain {E 98.04
d1vhea2275 Hypothetical protein YsdC, catalytic domain {Bacil 98.01
d1cg2a1276 Carboxypeptidase G2, catalytic domain {Pseudomonas 97.39
d1r3na1 322 Peptidase-like beta-alanine synthase, catalytic do 97.36
g1q7l.1280 Aminoacylase-1, catalytic domain {Human (Homo sapi 97.13
d2grea2233 Deblocking aminopeptidase YhfE {Bacillus cereus [T 95.58
d1lfwa1272 Aminopeptidase PepV {Lactobacillus delbrueckii [Ta 95.49
d1fnoa4295 Peptidase T (tripeptidase), catalytic domain {Salm 95.29
d1vgya1262 Succinyl-diaminopimelate desuccinylase, catalytic 93.32
>d2afwa1 c.56.5.8 (A:33-361) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Glutaminyl-peptide cyclotransferase-like
domain: Glutaminyl-peptide cyclotransferase, QPCT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.35  E-value=2.7e-13  Score=110.80  Aligned_cols=50  Identities=14%  Similarity=0.207  Sum_probs=41.7

Q ss_pred             CeEEecCCCCCCCCCCCCeEEEEeecccccCCC---CCCCCCCCchhHHHHHHHHH--HHhh
Q 037601            1 MQGGLQGLKADGDANQLPTIAIVASYDTFGAAP---ALSVGSDSNGSGVVALLEIV--FAEL   57 (151)
Q Consensus         1 i~g~l~G~~~~~~~~~~~~iv~~ahyD~~g~~~---~~~~gaddn~sg~~~lle~a--f~~~   57 (151)
                      |||+|+|..       .++|||+|||||.+..+   ...+||+|||||||+|||+|  |++.
T Consensus        91 via~l~g~~-------~~~ili~aHyDs~~~~~~~~~~~pGA~DnaSGvA~lLElAR~l~~~  145 (329)
T d2afwa1          91 IISTLNPTA-------KRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKK  145 (329)
T ss_dssp             EEEESSTTS-------SEEEEEEEECCCCCCCCBTTBCCCCTTTTHHHHHHHHHHHHHTHHH
T ss_pred             EEEEeCCCC-------CceEEEEeeeccCCcccccccCCCCCCCccHHHHHHHHHHHHHHHh
Confidence            689999842       37899999999987643   36789999999999999999  7754
>d1rtqa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]} Back     information, alignment and structure
>d1de4c3 c.56.5.5 (C:122-189,C:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bi1a3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkja1 c.56.5.4 (A:1-277) Aminopeptidase {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1vhoa2 c.56.5.4 (A:3-69,A:153-333) Putative endoglucanase TM1048, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yloa2 c.56.5.4 (A:1-66,A:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1z2la1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhea2 c.56.5.4 (A:3-72,A:163-367) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cg2a1 c.56.5.4 (A:26-213,A:327-414) Carboxypeptidase G2, catalytic domain {Pseudomonas sp., strain rs-16 [TaxId: 306]} Back     information, alignment and structure
>d1r3na1 c.56.5.4 (A:18-247,A:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2grea2 c.56.5.4 (A:3-73,A:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} Back     information, alignment and structure
>d1fnoa4 c.56.5.4 (A:1-207,A:321-408) Peptidase T (tripeptidase), catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vgya1 c.56.5.4 (A:2-180,A:294-376) Succinyl-diaminopimelate desuccinylase, catalytic domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure