Citrus Sinensis ID: 037651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRIPGADEDKEDENGHDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKMSEKNGAGET
cccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHcccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccEEEcHHHHcccccccccccccccccEEEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccHHcccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEcccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcEEEEEEEEHHHHHHHHcccccccccc
ccccccccEEEEccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHcccHHcccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccEEEEccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEccccEEEEEccHHHcccccccEEEcccccccccccHHHcccEcccccccccccHHHccccccEEEEcccccEEccccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHcccHHEEcccccccccccHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
ifsklpsivelhlpnsnlpilpihfpslnftslqvldlsnngfnstiPHWLFNITNllsldlnsndlqgdipdgfaslnslqlldlsgnsflegqlsrnlgtlcnLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYnqltgnlpislgylKNLRYLELWYNSflgsippsignlTFLEELYLTsnqmngkfpesfgqLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIktsnsslsfnisfdwippfklRYLVIRYYqlgpkfptwlrnQTELTTLVlngasisdtlpSWFWQLNLTldeldvggnhlsgripntlvfrfpgsvdlssnrfegplplwssnltklylrdnlfsgpipndlgqktpfltdldisfnslngsipqsvGNLKQLLTLVISnnnlsggiPQFLKNISSLYILDmtknnfsgeipesiGSLLTIRFLVLSnnhlsgeippslkncslmdsldlgenqlsgnipawigesmpslSILRLRsnhfngtipsELCKLSALHILdlshnnlsgpiphcvgdfsamkvkppdteiyQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLgtlnlsgnqlvgkiptqigklewLESLDLsrnklsgsippsmvSIRFLSFLNLSFnnlsgeiptanqFQTSLIRQFmripgadedkedenghdkLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKmsekngaget
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRIPGADEDKEDENGHDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVrlkrkmsekngaget
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITnllsldlnsndlQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVEltsllhlgtlnlsgnQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRflsflnlsfnnlsGEIPTANQFQTSLIRQFMRIPGADEDKEDENGHDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKMSEKNGAGET
*******IVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRI************HDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRL*************
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRIP***************WLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRL*************
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRIPGADEDKEDENGHDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRK**********
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRIPGADEDKEDENGHDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKMSE*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IFSKLPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRIPGADEDKEDENGHDKLWLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKMSEKNGAGET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query750 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.806 0.714 0.321 8e-72
Q9FL28 1173 LRR receptor-like serine/ no no 0.777 0.497 0.326 1e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.868 0.521 0.310 2e-68
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.786 0.471 0.326 7e-68
Q9LYN8 1192 Leucine-rich repeat recep no no 0.8 0.503 0.317 3e-67
Q9SHI2 1101 Leucine-rich repeat recep no no 0.845 0.575 0.325 3e-66
C0LGS2 1136 Probable LRR receptor-lik no no 0.774 0.511 0.333 2e-65
Q9LP24 1120 Probable leucine-rich rep no no 0.897 0.600 0.302 2e-62
P93194 1109 Receptor-like protein kin N/A no 0.733 0.495 0.316 6e-61
O49318 1124 Probable leucine-rich rep no no 0.777 0.518 0.317 4e-59
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 217/675 (32%), Positives = 327/675 (48%), Gaps = 70/675 (10%)

Query: 51  LFNITNLLSLDLNSNDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLK 110
           LF +  L  LDL + +L G+IP    +L+ L L++L  N F+ G++  ++G L  L+ L 
Sbjct: 106 LFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFV-GEIPASIGNLNQLRHLI 164

Query: 111 LSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSF 170
           L+ N   GE+   +  LS  +N      LEL  N+L G +P S+G LK LR L L  N+ 
Sbjct: 165 LANNVLTGEIPSSLGNLSRLVN------LELFSNRLVGKIPDSIGDLKQLRNLSLASNNL 218

Query: 171 LGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNL 230
           +G IP S+GNL+ L  L LT NQ+ G+ P S G L  +RV+   +N   G I  +     
Sbjct: 219 IGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPIS----F 274

Query: 231 TSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWL------------ 278
            +L +LS+   S+++ +    FD      L Y  + Y      FP  L            
Sbjct: 275 ANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQ 334

Query: 279 RNQ-------------TELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPN 325
            NQ             T+L  L+L    +   +P    +L L L+ELD+  N+ +G IP 
Sbjct: 335 ENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRL-LNLEELDISHNNFTGAIPP 393

Query: 326 TLVFRFP-GSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDIS 384
           T+        +DLS N  EG +P     L  + L  N FS     +  Q+   + +LD++
Sbjct: 394 TISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSS--FENTSQEEALIEELDLN 451

Query: 385 FNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNIS-SLYILDMTKNNFSGEIPES 443
            NS  G IP  +  L  L  L +SNN  SG IP  ++N S S+  L++  NNFSG +P+ 
Sbjct: 452 SNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDI 511

Query: 444 IGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILR 503
                 +  L +S+N L G+ P SL NC  ++ +++  N++    P+W+ ES+PSL +L 
Sbjct: 512 FSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWL-ESLPSLHVLN 570

Query: 504 LRSNHFNGTIPSELCKL--SALHILDLSHNNLSGPI-PHCVGDFSAMKVKPPD------- 553
           LRSN F G +      +   +L I+D+SHNN SG + P+   ++  M     +       
Sbjct: 571 LRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTE 630

Query: 554 ----TEIYQGSLQVAIKGTQYVYQQTLYL--------------MPVELTSLLHLGTLNLS 595
                + Y   +++  KG    +++                  +P  L  L  L  LNLS
Sbjct: 631 FWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLS 690

Query: 596 GNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTAN 655
           GN     IP  +  L  LE+LD+SRNKLSG IP  + ++ FLS++N S N L G +P   
Sbjct: 691 GNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGT 750

Query: 656 QFQTSLIRQFMRIPG 670
           QFQ      F+  PG
Sbjct: 751 QFQRQKCSSFLDNPG 765
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query750
359488583 958 PREDICTED: LRR receptor-like serine/thre 0.981 0.768 0.608 0.0
359484185 990 PREDICTED: LRR receptor-like serine/thre 0.981 0.743 0.601 0.0
147789266 925 hypothetical protein VITISV_040339 [Viti 0.981 0.795 0.600 0.0
359488641 1012 PREDICTED: LRR receptor-like serine/thre 0.964 0.714 0.569 0.0
225451409 1007 PREDICTED: leucine-rich repeat receptor 0.961 0.715 0.562 0.0
359496388 1014 PREDICTED: brassinosteroid LRR receptor 0.96 0.710 0.558 0.0
359496390 1113 PREDICTED: LRR receptor-like serine/thre 0.961 0.647 0.561 0.0
359496717 1014 PREDICTED: brassinosteroid LRR receptor 0.96 0.710 0.556 0.0
359488639 1097 PREDICTED: LRR receptor-like serine/thre 0.949 0.649 0.560 0.0
359488591 981 PREDICTED: probable leucine-rich repeat 0.961 0.734 0.551 0.0
>gi|359488583|ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/777 (60%), Positives = 585/777 (75%), Gaps = 41/777 (5%)

Query: 5   LPSIVELHLPNSNLPILPIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNS 64
           LPS++ELH+PN  L  L +  P LNFTSL +LDLSNNGF+STIPHWLFN+++L+ LDLNS
Sbjct: 183 LPSLLELHMPNCQLSNLSLSLPFLNFTSLSILDLSNNGFDSTIPHWLFNLSSLVYLDLNS 242

Query: 65  NDLQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFI 124
           N+LQG +PD F +  SLQLLDLS NS +EG+L R LG LC L+TL LS+N+  GE+++F+
Sbjct: 243 NNLQGGLPDAFQNFTSLQLLDLSKNSNIEGELPRTLGNLCYLRTLILSVNKLSGEIAEFL 302

Query: 125 DGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFL 184
           DGLS C + S+L  L+LG+N+LTGNLP SLG+LKNLRYL+LW NSF GSIP SIG+L+ L
Sbjct: 303 DGLSAC-SYSTLENLDLGFNKLTGNLPDSLGHLKNLRYLQLWSNSFRGSIPESIGSLSSL 361

Query: 185 EELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTS-N 243
           +ELYL+ NQM G  P+S GQLS++ VLEL++N WEG ITEAH  NL+SL++LS+ K+S N
Sbjct: 362 QELYLSQNQMGGIIPDSLGQLSSLVVLELNENSWEGVITEAHFANLSSLKQLSITKSSPN 421

Query: 244 SSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFW 303
            SL FNIS DW PPFKL Y+ +R  QLGPKFPTWLR Q ELTT+VLN A IS T+P W W
Sbjct: 422 VSLVFNISSDWAPPFKLTYINLRSCQLGPKFPTWLRTQNELTTIVLNNAGISGTIPDWLW 481

Query: 304 QLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLF 363
           +L+L L ELD+  N LSGR+PN+LVF +  +VDLSSN F+GPLPLWSSN++ LYLR NLF
Sbjct: 482 KLDLQLSELDIAYNQLSGRVPNSLVFSYLANVDLSSNLFDGPLPLWSSNVSTLYLRGNLF 541

Query: 364 SGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNI 423
           SGPIP ++GQ  P LTDLDIS+NSLNGSIP S+G+L+ L+TLVISNNNLSG IPQF   +
Sbjct: 542 SGPIPQNIGQVMPILTDLDISWNSLNGSIPLSMGDLQALITLVISNNNLSGEIPQFWNKM 601

Query: 424 SSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQ 483
            SLYI+DM+ N+ SG IP S+GSL  +RFLVLSNN+LSGE+P  L+NCS+++SLDLG+N+
Sbjct: 602 PSLYIVDMSNNSLSGTIPRSLGSLTALRFLVLSNNNLSGELPSQLQNCSVLESLDLGDNK 661

Query: 484 LSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGD 543
            SGNIP+WIGESMPSL IL L+SN F+G IPSE+C LSALHILDLSHN++SG IP C G+
Sbjct: 662 FSGNIPSWIGESMPSLLILALQSNFFSGNIPSEICALSALHILDLSHNHVSGFIPPCFGN 721

Query: 544 FSAMK--VKPPDTEIYQGSLQVAIKGTQYVYQQTLYL--------------MPVELTSLL 587
            S  K  +   D E Y+G L++  KG    Y  TLYL              +P+ELTSLL
Sbjct: 722 LSGFKSELSDDDLERYEGRLKLVAKGRALEYYSTLYLVNSLDLSNNSLSGEIPIELTSLL 781

Query: 588 HLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNL 647
            LGTLNLS N L G IP +IG L+WLE+LDLS+NKLSG IP SM SI FL  LNL+ NNL
Sbjct: 782 KLGTLNLSSNNLGGNIPEKIGNLQWLETLDLSKNKLSGPIPMSMASITFLVHLNLAHNNL 841

Query: 648 SGEIPTANQFQT----SLIRQFMRIPG--ADEDKEDENG-----------------HDKL 684
           SG+IPT NQFQT    S+ +  + + G     +  D NG                  +  
Sbjct: 842 SGKIPTGNQFQTLIDPSIYQGNLALCGFPLTTECHDNNGTIPTGKGEDNDDEDGDDSELP 901

Query: 685 WLFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKM 741
           W FVS+GLGFI+GFWGVCGTLIIK SWRYAYF+F +K+KD+LL  +AL+V RL RK+
Sbjct: 902 WFFVSMGLGFIIGFWGVCGTLIIKTSWRYAYFRFVEKMKDRLLLAVALNVARLTRKV 958

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359484185|ref|XP_002273824.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789266|emb|CAN71149.1| hypothetical protein VITISV_040339 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488641|ref|XP_003633796.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451409|ref|XP_002273126.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496388|ref|XP_003635224.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496390|ref|XP_002268557.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496717|ref|XP_003635312.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488639|ref|XP_003633795.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488591|ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query750
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.870 0.721 0.392 2.5e-120
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.809 0.748 0.313 8.6e-71
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.833 0.613 0.304 1.9e-66
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.862 0.763 0.296 2e-65
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.684 0.470 0.349 7.3e-65
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.808 0.698 0.293 5.5e-64
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.798 0.527 0.316 1e-63
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.657 0.505 0.326 1.3e-63
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.798 0.684 0.291 3.2e-62
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.861 0.566 0.290 5.5e-62
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1184 (421.8 bits), Expect = 2.5e-120, P = 2.5e-120
 Identities = 262/668 (39%), Positives = 381/668 (57%)

Query:     2 FSKLPSIVELHLPNSNLPILPIHFPS-LNFTSLQVLDLSNNGFNSTIPHWLFNITXXXXX 60
             FS++ ++ ELHL NS L  LP    S  +   L+VLDLS N  NS IP+WLF +T     
Sbjct:   217 FSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKL 276

Query:    61 XXXXXXXQGDIPDGFASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEV 120
                    QG IP GF +L  L+ LDLS N  L+G++   LG L  L+ L LS N+  G++
Sbjct:   277 FLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQI 336

Query:   121 SDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGN 180
               F+D  S     +SL  L+L  N+L G LP SLG L+NL+ L+L  NSF GS+P SIGN
Sbjct:   337 HGFLDAFSRN-KGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGN 395

Query:   181 LTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIK 240
             +  L++L L++N MNG   ES GQL+ +  L L  N W G + ++H  NL SL+ + L  
Sbjct:   396 MASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTT 455

Query:   241 TSNSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLP- 299
                 SL F +   WIPPF+L  + I   ++G  FP WL+ QT+L  + L    I DT+P 
Sbjct:   456 EPYRSLVFKLPSTWIPPFRLELIQIENCRIG-LFPMWLQVQTKLNFVTLRNTGIEDTIPD 514

Query:   300 SWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLR 359
             SWF  ++  +  L +  N + GR+P  L F    ++DLSSN FEG  PLWS+N T+L L 
Sbjct:   515 SWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLY 574

Query:   360 DNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQF 419
             +N FSG +P ++    P +  + +  NS  G+IP S+  +  L  L +  N+ SG  P+ 
Sbjct:   575 ENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKC 634

Query:   420 LKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDL 479
                   L+ +D+++NN SGEIPES+G L ++  L+L+ N L G+IP SL+NCS + ++DL
Sbjct:   635 WHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDL 694

Query:   480 GENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGPIPH 539
             G N+L+G +P+W+G+ + SL +LRL+SN F G IP +LC +  L ILDLS N +SGPIP 
Sbjct:   695 GGNKLTGKLPSWVGK-LSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPK 753

Query:   540 CVGDFSAMKVKPPDTEIYQGSLQVAIKGTQY-VYQQTLYL--------MPVEXXXXXXXX 590
             C+ + +A+  +  + E++Q  + +  +  +Y     ++ L        +P E        
Sbjct:   754 CISNLTAI-ARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLR 812

Query:   591 XXXXXXXQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRXXXXXXXXXXXXXGE 650
                     + G IP +I +L  LE+LDLS+NK SG+IP S  +I              G 
Sbjct:   813 ILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGS 872

Query:   651 IPTANQFQ 658
             IP   +FQ
Sbjct:   873 IPKLLKFQ 880
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037833001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (735 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query750
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-68
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-63
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-54
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-50
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN032101153 PLN03210, PLN03210, Resistant to P 0.003
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  240 bits (615), Expect = 9e-68
 Identities = 198/630 (31%), Positives = 298/630 (47%), Gaps = 104/630 (16%)

Query: 29  NFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDG-FASLNSLQLLDLS 87
           N + +  +DLS    +  I   +F +  + +++L++N L G IPD  F + +SL+ L+LS
Sbjct: 67  NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLS 126

Query: 88  GNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLT 147
            N+F  G + R  G++ NL+TL LS N   GE+ + I   S      SL  L+LG N L 
Sbjct: 127 NNNF-TGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFS------SLKVLDLGGNVLV 177

Query: 148 GNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSA 207
           G +P SL  L +L +L L  N  +G IP  +G +  L+ +YL  N ++G+ P   G L++
Sbjct: 178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS 237

Query: 208 IRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRY 267
           +  L+L  N   G I  + L NL +L+                           YL +  
Sbjct: 238 LNHLDLVYNNLTGPIPSS-LGNLKNLQ---------------------------YLFLYQ 269

Query: 268 YQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTL 327
            +L    P  + +  +L +L L+  S+S  +P    QL   L+ L +  N+ +G+IP   
Sbjct: 270 NKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ-NLEILHLFSNNFTGKIP--- 325

Query: 328 VFRFPGSVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNS 387
                  V L+S      L LWS          N FSG IP +LG+    LT LD+S N+
Sbjct: 326 -------VALTSLPRLQVLQLWS----------NKFSGEIPKNLGKHNN-LTVLDLSTNN 367

Query: 388 LNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSL 447
           L G IP+ + +   L  L++ +N+L G IP+ L    SL  + +  N+FSGE+P     L
Sbjct: 368 LTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKL 427

Query: 448 LTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSN 507
             + FL +SNN+L G I     +   +  L L  N+  G +P   G     L  L L  N
Sbjct: 428 PLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSK--RLENLDLSRN 485

Query: 508 HFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKG 567
            F+G +P +L  LS L  L LS N LSG IP                             
Sbjct: 486 QFSGAVPRKLGSLSELMQLKLSENKLSGEIPD---------------------------- 517

Query: 568 TQYVYQQTLYLMPVELTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSI 627
                         EL+S   L +L+LS NQL G+IP    ++  L  LDLS+N+LSG I
Sbjct: 518 --------------ELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI 563

Query: 628 PPSMVSIRFLSFLNLSFNNLSGEIPTANQF 657
           P ++ ++  L  +N+S N+L G +P+   F
Sbjct: 564 PKNLGNVESLVQVNISHNHLHGSLPSTGAF 593

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 750
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.45
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
PLN03150623 hypothetical protein; Provisional 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.8
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.06
PRK15386426 type III secretion protein GogB; Provisional 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.82
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.67
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.6
KOG4341483 consensus F-box protein containing LRR [General fu 97.47
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.35
KOG4341483 consensus F-box protein containing LRR [General fu 97.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.8
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.14
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.02
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.65
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.64
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.26
KOG4308478 consensus LRR-containing protein [Function unknown 93.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.77
KOG4308478 consensus LRR-containing protein [Function unknown 91.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.55
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.3
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.01
smart0037026 LRR Leucine-rich repeats, outliers. 89.01
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.67
smart0037026 LRR Leucine-rich repeats, outliers. 87.67
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.14
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.14
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.2e-65  Score=613.85  Aligned_cols=541  Identities=35%  Similarity=0.544  Sum_probs=482.1

Q ss_pred             CCCCcEEECCCCCCCCCccccccCCCCCCEEeCcCCCCcccCCcccC-CCCCCCEEECcCCCCcccccccccCCCCCCCE
Q 037651           30 FTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPDGFA-SLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQT  108 (750)
Q Consensus        30 l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~-~l~~L~~L~Ls~n~~~~~~~~~~l~~l~~L~~  108 (750)
                      ..+++.|+|++|.+++.++..|..+++|++|+|++|++.+.+|..+. ++++|++|++++|. +.+.+|.  +.+++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~-l~~~~p~--~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNN-FTGSIPR--GSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCc-cccccCc--cccCCCCE
Confidence            45799999999999999999999999999999999999988887654 99999999999999 6666664  56899999


Q ss_pred             EeCcCcccccccchhhhccccccCCCCccEEEccCCcCcccCCccccCCCCCcEEEccCCcccccCCccccCCCCCCeee
Q 037651          109 LKLSLNQFRGEVSDFIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELY  188 (750)
Q Consensus       109 L~Ls~n~l~~~~~~~l~~l~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  188 (750)
                      |++++|.+.+..|..++.++      +|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|+
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~------~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  218 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFS------SLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY  218 (968)
T ss_pred             EECcCCcccccCChHHhcCC------CCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE
Confidence            99999999999999898887      999999999999989999999999999999999999999999999999999999


Q ss_pred             cccccCCcccchhccCCCCCCEEEcccCcCccccChhhhcCCCCCCEEecccCCCCCceEeccCCCCCCCceeEEEeccc
Q 037651          189 LTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNISFDWIPPFKLRYLVIRYY  268 (750)
Q Consensus       189 Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~  268 (750)
                      +++|.+++.+|..++++++|++|++++|.+.+.+|. .++++++|++|++++|.                          
T Consensus       219 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~~n~--------------------------  271 (968)
T PLN00113        219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPS-SLGNLKNLQYLFLYQNK--------------------------  271 (968)
T ss_pred             CcCCccCCcCChhHhcCCCCCEEECcCceeccccCh-hHhCCCCCCEEECcCCe--------------------------
Confidence            999999999999999999999999999999887776 78888888888877642                          


Q ss_pred             cCCCCCChhhccCCcccEEEcCCCCcCCCcChHHHhhcCCCcEEEcCCCcCCCcCCCccccCCCceEECCCCCCCCCCCC
Q 037651          269 QLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVGGNHLSGRIPNTLVFRFPGSVDLSSNRFEGPLPL  348 (750)
Q Consensus       269 ~~~~~~p~~l~~~~~L~~L~L~~n~i~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~l~~l~l~~n~l~~~~~~  348 (750)
                       +.+..|.++..+++|++|++++|.+.+.+|..+... ++|+.|++++|.+++.+|..+..                   
T Consensus       272 -l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l-~~L~~L~l~~n~~~~~~~~~~~~-------------------  330 (968)
T PLN00113        272 -LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQL-QNLEILHLFSNNFTGKIPVALTS-------------------  330 (968)
T ss_pred             -eeccCchhHhhccCcCEEECcCCeeccCCChhHcCC-CCCcEEECCCCccCCcCChhHhc-------------------
Confidence             344566677777777777777777777777666543 57777777777777666554332                   


Q ss_pred             CCCCCcEEEeecccccCCCCcchhccCCCCCEEecCCCcCcccCCcCCcCCCCCCeEECccCccccccCccccCCCCCCE
Q 037651          349 WSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYI  428 (750)
Q Consensus       349 ~~~~L~~L~l~~n~l~~~i~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~  428 (750)
                       +++|+.|++++|.+++.+|..+.. +++|+.|++++|++.+.+|..++.+++|+.|++++|.+.+.+|..+..+++|+.
T Consensus       331 -l~~L~~L~L~~n~l~~~~p~~l~~-~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~  408 (968)
T PLN00113        331 -LPRLQVLQLWSNKFSGEIPKNLGK-HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRR  408 (968)
T ss_pred             -CCCCCEEECcCCCCcCcCChHHhC-CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCE
Confidence             567888888888888888877665 889999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCCccceeCCccccCCCCCCEEEccCCcCcCCCCccccCCCCCCEEecCCCcccccCChhhhhcCCCCCEEEccCcc
Q 037651          429 LDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNH  508 (750)
Q Consensus       429 L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~l~~L~~L~Ls~n~  508 (750)
                      |++++|++++..|..+..++.|+.|++++|.+++.+|..+..+++|+.|++++|++.+.+|....  .++|+.|++++|+
T Consensus       409 L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~--~~~L~~L~ls~n~  486 (968)
T PLN00113        409 VRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG--SKRLENLDLSRNQ  486 (968)
T ss_pred             EECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc--cccceEEECcCCc
Confidence            99999999999999999999999999999999999999899999999999999999988888663  7899999999999


Q ss_pred             ceeecCccccCCCCCcEEEcccCcCCCcCCccccccccCccCCCCCccccCceEEEEecceEeecccccccchhhhcccc
Q 037651          509 FNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLLH  588 (750)
Q Consensus       509 l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~~l~~  588 (750)
                      +.+.+|..+..+++|+.|++++|++++.+|.                                          .+.++++
T Consensus       487 l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~------------------------------------------~~~~l~~  524 (968)
T PLN00113        487 FSGAVPRKLGSLSELMQLKLSENKLSGEIPD------------------------------------------ELSSCKK  524 (968)
T ss_pred             cCCccChhhhhhhccCEEECcCCcceeeCCh------------------------------------------HHcCccC
Confidence            9999999999999999999999999987664                                          5667888


Q ss_pred             CCeEeccCCcCCCCcccccCCCccCcEEEccCCccCcCCCccccCCCCCCeEECcCCcceecCCCCCCCCCcccccccCC
Q 037651          589 LGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLIRQFMRI  668 (750)
Q Consensus       589 L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~g~ip~~~~~~~~~~~~~~~n  668 (750)
                      |++|+|++|.+++.+|..++.+++|+.|||++|+++|.+|..+..+++|+++++++|+++|.+|..+++.++...++.||
T Consensus       525 L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n  604 (968)
T PLN00113        525 LVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGN  604 (968)
T ss_pred             CCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988889999


Q ss_pred             CCCCC
Q 037651          669 PGADE  673 (750)
Q Consensus       669 ~~~~~  673 (750)
                      |..|.
T Consensus       605 ~~lc~  609 (968)
T PLN00113        605 IDLCG  609 (968)
T ss_pred             ccccC
Confidence            87664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query750
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-41
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-28
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-41
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-28
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 6e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 6e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 6e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 7e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  165 bits (418), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 187/645 (28%), Positives = 291/645 (45%), Gaps = 76/645 (11%)
Query: 75  FASLNSLQLLDLSGNSF-LEGQLSRNLGTLCNLQTLKLSLNQFRGE-VSDFI--DGLSEC 130
             S + L+ L++S N+    G++S  L  L +L+ L LS N   G  V  ++  DG  E 
Sbjct: 119 LGSCSGLKFLNVSSNTLDFPGKVSGGL-KLNSLEVLDLSANSISGANVVGWVLSDGCGE- 176
Query: 131 INSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLT 190
                L  L +  N+++G++ +S     NL +L++  N+F   IP  +G+ + L+ L ++
Sbjct: 177 -----LKHLAISGNKISGDVDVS--RCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDIS 228
Query: 191 SNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTSNSSLSFNI 250
            N+++G F  +    + +++L +S NQ+ G I    L++L  L           SL+ N 
Sbjct: 229 GNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYL-----------SLAENK 277
Query: 251 SFDWIPPF------KLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQ 304
               IP F       L  L +         P +  + + L +L L+  + S  LP     
Sbjct: 278 FTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLL 337
Query: 305 LNLTLDELDVGGNHLSGRIPNTLVFRFPG--SVDLSSNRFEGP-LPLWSSN----LTKLY 357
               L  LD+  N  SG +P +L        ++DLSSN F GP LP    N    L +LY
Sbjct: 338 KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 397
Query: 358 LRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSGGIP 417
           L++N F+G IP  L   +  L  L +SFN L+G+IP S+G+L +L  L +  N L G IP
Sbjct: 398 LQNNGFTGKIPPTLSNCSE-LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 456
Query: 418 QFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLMDSL 477
           Q L  + +L  L +  N+ +GEIP  + +   + ++ LSNN L+GEIP  +     +  L
Sbjct: 457 QELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAIL 516
Query: 478 DLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLSGP- 536
            L  N  SGNIPA +G+   SL  L L +N FNGTIP+ + K S      ++ N ++G  
Sbjct: 517 KLSNNSFSGNIPAELGDCR-SLIWLDLNTNLFNGTIPAAMFKQSG----KIAANFIAGKR 571
Query: 537 ---------IPHCVG-----DFSAMK--------VKPP---DTEIYQGSLQVAIKGTQYV 571
                       C G     +F  ++         + P    + +Y G           +
Sbjct: 572 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM 631
Query: 572 ------YQQTLYLMPVEXXXXXXXXXXXXXXXQLVGKIPTQIGKLEWLESLDLSRNKLSG 625
                 Y      +P E                + G IP ++G L  L  LDLS NKL G
Sbjct: 632 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG 691
Query: 626 SIPPSMVSIRXXXXXXXXXXXXXGEIPTANQFQTSLIRQFMRIPG 670
            IP +M ++              G IP   QF+T    +F+  PG
Sbjct: 692 RIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPG 736
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query750
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-157
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-150
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-138
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-108
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-84
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-76
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-71
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-70
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-70
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-59
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-52
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-42
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  475 bits (1224), Expect = e-157
 Identities = 187/662 (28%), Positives = 300/662 (45%), Gaps = 55/662 (8%)

Query: 7   SIVELHLPNSNLPILPIHFPS--LNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNS 64
            +  + L +  L +      S  L+ T L+ L LSN+  N ++        +L SLDL+ 
Sbjct: 51  KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSR 109

Query: 65  NDLQGDIPDG--FASLNSLQLLDLSGNSFLEGQLSRNLGTLCNLQTLKLSLNQFRGEVSD 122
           N L G +       S + L+ L++S N+            L +L+ L LS N   G    
Sbjct: 110 NSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVV 169

Query: 123 FIDGLSECINSSSLARLELGYNQLTGNLPISLGYLKNLRYLELWYNSFLGSIPPSIGNLT 182
                        L  L +  N+++G++ +S     NL +L++  N+F   IP  +G+ +
Sbjct: 170 GWVLSD---GCGELKHLAISGNKISGDVDVSR--CVNLEFLDVSSNNFSTGIP-FLGDCS 223

Query: 183 FLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEELSLIKTS 242
            L+ L ++ N+++G F  +    + +++L +S NQ+ G I    L++L  L         
Sbjct: 224 ALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYL--------- 274

Query: 243 NSSLSFNISFDWIPPFKLRYLVIRYYQLGPKFPTWLRNQ-TELTTLVLNGASISDTLPSW 301
             SL+ N                   +   + P +L      LT L L+G      +P +
Sbjct: 275 --SLAEN-------------------KFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF 313

Query: 302 FWQLNLTLDELDVGGNHLSGRIPNTLVFRFPG--SVDLSSNRFEGPLPLW----SSNLTK 355
           F   +  L+ L +  N+ SG +P   + +  G   +DLS N F G LP      S++L  
Sbjct: 314 FGSCS-LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 372

Query: 356 LYLRDNLFSGPIPNDLGQKT-PFLTDLDISFNSLNGSIPQSVGNLKQLLTLVISNNNLSG 414
           L L  N FSGPI  +L Q     L +L +  N   G IP ++ N  +L++L +S N LSG
Sbjct: 373 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 432

Query: 415 GIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLM 474
            IP  L ++S L  L +  N   GEIP+ +  + T+  L+L  N L+GEIP  L NC+ +
Sbjct: 433 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 492

Query: 475 DSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILDLSHNNLS 534
           + + L  N+L+G IP WIG  + +L+IL+L +N F+G IP+EL    +L  LDL+ N  +
Sbjct: 493 NWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN 551

Query: 535 GPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLM----PVELTSLLHLG 590
           G IP  +   S               ++      +      L         +L  L    
Sbjct: 552 GTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRN 611

Query: 591 TLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGE 650
             N++     G           +  LD+S N LSG IP  + S+ +L  LNL  N++SG 
Sbjct: 612 PCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGS 671

Query: 651 IP 652
           IP
Sbjct: 672 IP 673
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query750
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.99
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.03
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.46
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-76  Score=688.04  Aligned_cols=630  Identities=32%  Similarity=0.442  Sum_probs=545.5

Q ss_pred             CCcCEEecCCCCCCCC---CCCCCCCCCCCCcEEECCCCCCCCCccccccCCCCCCEEeCcCCCCcccCCc--ccCCCCC
Q 037651            6 PSIVELHLPNSNLPIL---PIHFPSLNFTSLQVLDLSNNGFNSTIPHWLFNITNLLSLDLNSNDLQGDIPD--GFASLNS   80 (750)
Q Consensus         6 ~~L~~L~L~~~~l~~~---~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~--~~~~l~~   80 (750)
                      .+++.|+|+++.+.+.   .+ ..+.++++|+.++++.+.+. ..|..|+++++|++|+|++|.+.+.+|.  .++++++
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~-~~l~~L~~L~~l~~~~~~~~-~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~  127 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVS-SSLLSLTGLESLFLSNSHIN-GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSG  127 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHH-HHTTTCTTCCEEECTTSCEE-ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTT
T ss_pred             CcEEEEECCCCCcCCccCccC-hhHhccCcccccCCcCCCcC-CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCC
Confidence            4688999999999884   33 36778899999999988774 3557899999999999999999988888  8999999


Q ss_pred             CCEEECcCCCCccccccccc-CCCCCCCEEeCcCcccccccchh---hhccccccCCCCccEEEccCCcCcccCCccccC
Q 037651           81 LQLLDLSGNSFLEGQLSRNL-GTLCNLQTLKLSLNQFRGEVSDF---IDGLSECINSSSLARLELGYNQLTGNLPISLGY  156 (750)
Q Consensus        81 L~~L~Ls~n~~~~~~~~~~l-~~l~~L~~L~Ls~n~l~~~~~~~---l~~l~~~~~~~~L~~L~L~~n~l~~~~~~~l~~  156 (750)
                      |++|++++|. +.+..|..+ .++++|++|++++|.+++..+..   +..++      +|++|++++|.+++..|.  ..
T Consensus       128 L~~L~Ls~n~-l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~------~L~~L~Ls~n~l~~~~~~--~~  198 (768)
T 3rgz_A          128 LKFLNVSSNT-LDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG------ELKHLAISGNKISGDVDV--SR  198 (768)
T ss_dssp             CCEEECCSSE-EECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCT------TCCEEECCSSEEESCCBC--TT
T ss_pred             CCEEECcCCc-cCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCC------CCCEEECCCCcccccCCc--cc
Confidence            9999999998 566666655 88999999999999999888876   55555      999999999999876654  78


Q ss_pred             CCCCcEEEccCCcccccCCccccCCCCCCeeecccccCCcccchhccCCCCCCEEEcccCcCccccChhhhcCCCCCCEE
Q 037651          157 LKNLRYLELWYNSFLGSIPPSIGNLTFLEELYLTSNQMNGKFPESFGQLSAIRVLELSDNQWEGFITEAHLRNLTSLEEL  236 (750)
Q Consensus       157 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L  236 (750)
                      +++|++|++++|++.+.+|. ++++++|++|++++|++++.+|..++++++|++|++++|.+.+.++..   .+++|++|
T Consensus       199 l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~---~l~~L~~L  274 (768)
T 3rgz_A          199 CVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL---PLKSLQYL  274 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC---CCTTCCEE
T ss_pred             CCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc---ccCCCCEE
Confidence            99999999999999988887 999999999999999999999999999999999999999998877762   88999999


Q ss_pred             ecccCCCCCceEeccCCCCCC-CceeEEEeccccCCCCCChhhccCCcccEEEcCCCCcCCCcChHHHhhcCCCcEEEcC
Q 037651          237 SLIKTSNSSLSFNISFDWIPP-FKLRYLVIRYYQLGPKFPTWLRNQTELTTLVLNGASISDTLPSWFWQLNLTLDELDVG  315 (750)
Q Consensus       237 ~l~~~~~~~~~~~~~~~~~~~-~~L~~L~l~~~~~~~~~p~~l~~~~~L~~L~L~~n~i~~~~~~~~~~~~~~L~~L~l~  315 (750)
                      ++++|   .+.+.++..+... ++|++|++++|.+.+..|.+++.+++|++|++++|.+.+.+|......+++|++|+++
T Consensus       275 ~L~~n---~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls  351 (768)
T 3rgz_A          275 SLAEN---KFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS  351 (768)
T ss_dssp             ECCSS---EEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECC
T ss_pred             ECcCC---ccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCc
Confidence            99985   4555666666554 8999999999999999999999999999999999999988888755556899999999


Q ss_pred             CCcCCCcCCCcccc-C-CCceEECCCCCCCCCCCCC-----CCCCcEEEeecccccCCCCcchhccCCCCCEEecCCCcC
Q 037651          316 GNHLSGRIPNTLVF-R-FPGSVDLSSNRFEGPLPLW-----SSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSL  388 (750)
Q Consensus       316 ~n~l~~~~~~~~~~-~-~l~~l~l~~n~l~~~~~~~-----~~~L~~L~l~~n~l~~~i~~~~~~~~~~L~~L~ls~n~l  388 (750)
                      +|++++.+|..+.. . .++.+++++|.+.+.+|..     +++|++|++++|.+++.+|..+.. +++|++|++++|++
T Consensus       352 ~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~Ls~N~l  430 (768)
T 3rgz_A          352 FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYL  430 (768)
T ss_dssp             SSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG-CTTCCEEECCSSEE
T ss_pred             CCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc-CCCCCEEECcCCcc
Confidence            99999888887653 3 8999999999998877764     457999999999999888887765 89999999999999


Q ss_pred             cccCCcCCcCCCCCCeEECccCccccccCccccCCCCCCEEeCCCCccceeCCccccCCCCCCEEEccCCcCcCCCCccc
Q 037651          389 NGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSL  468 (750)
Q Consensus       389 ~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~  468 (750)
                      ++.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|++++.+|..+..+++|++|++++|++++.+|..+
T Consensus       431 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~  510 (768)
T 3rgz_A          431 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI  510 (768)
T ss_dssp             ESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             cCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCEEecCCCcccccCChhhhhcCCCCCEEEccCccceeecCccccCCCCCcEEE---------------------
Q 037651          469 KNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTIPSELCKLSALHILD---------------------  527 (750)
Q Consensus       469 ~~l~~L~~L~L~~n~~~~~~p~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~---------------------  527 (750)
                      ..+++|++|++++|++++.+|..+.. +++|+.|++++|++.|.+|..+.....+..++                     
T Consensus       511 ~~l~~L~~L~L~~N~l~~~~p~~l~~-l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  589 (768)
T 3rgz_A          511 GRLENLAILKLSNNSFSGNIPAELGD-CRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHG  589 (768)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGG-CTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCS
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcC-CCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccc
Confidence            99999999999999999999998876 99999999999999999998776655444333                     


Q ss_pred             -------------------------cccCcCCCcCCccccccccCccCCCCCccccCceEEEEecceEeecccccccchh
Q 037651          528 -------------------------LSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVE  582 (750)
Q Consensus       528 -------------------------Ls~n~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~  582 (750)
                                               ++.|.++|.+|..+++++.++.                  ..+.++...+.+|.+
T Consensus       590 ~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~------------------LdLs~N~l~g~ip~~  651 (768)
T 3rgz_A          590 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMF------------------LDMSYNMLSGYIPKE  651 (768)
T ss_dssp             SEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCE------------------EECCSSCCBSCCCGG
T ss_pred             cccccccccccchhhhccccccccccccceecccCchhhhccccccE------------------EECcCCcccccCCHH
Confidence                                     2334455555555555444432                  233334444568889


Q ss_pred             hhccccCCeEeccCCcCCCCcccccCCCccCcEEEccCCccCcCCCccccCCCCCCeEECcCCcceecCCCCCCCCCccc
Q 037651          583 LTSLLHLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNNLSGEIPTANQFQTSLI  662 (750)
Q Consensus       583 l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~g~ip~~~~~~~~~~  662 (750)
                      ++++++|+.|+|++|+++|.+|+.++++++|++|||++|+++|.+|..+..+++|++||+|+|+++|.||.++++.++..
T Consensus       652 l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~  731 (768)
T 3rgz_A          652 IGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPP  731 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCG
T ss_pred             HhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCC
Q 037651          663 RQFMRIPGADE  673 (750)
Q Consensus       663 ~~~~~n~~~~~  673 (750)
                      .+|.|||+.|.
T Consensus       732 ~~~~gN~~Lcg  742 (768)
T 3rgz_A          732 AKFLNNPGLCG  742 (768)
T ss_dssp             GGGCSCTEEES
T ss_pred             HHhcCCchhcC
Confidence            99999987653
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 750
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 82.8 bits (203), Expect = 7e-18
 Identities = 50/305 (16%), Positives = 97/305 (31%), Gaps = 32/305 (10%)

Query: 334 SVDLSSNRFEGPLPLWSSNLTKLYLRDNLFSGPIPNDLGQKTPFLTDLDISFNSLNGSIP 393
            V  S    E        +   L L++N  +     D       L  L +  N ++   P
Sbjct: 14  VVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFK-NLKNLHTLILINNKISKISP 72

Query: 394 QSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYILDMTKNNFSGEIPESIGSLLTIRFL 453
            +   L +L  L +S N L     +  K +  L + +         +   +  ++ +  L
Sbjct: 73  GAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVV-EL 131

Query: 454 VLSNNHLSGEIPPSLKNCSLMDSLDLGENQLSGNIPAWIGESMPSLSILRLRSNHFNGTI 513
             +    SG    + +    +  + + +  ++  IP  +    PSL+ L L  N      
Sbjct: 132 GTNPLKSSGIENGAFQGMKKLSYIRIADTNIT-TIPQGL---PPSLTELHLDGNKITKVD 187

Query: 514 PSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQ 573
            + L  L+ L  L LS N++S      + +   ++                     ++  
Sbjct: 188 AASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLREL-------------------HLNN 228

Query: 574 QTLYLMPVELTSLLHLGTLNLSGNQL------VGKIPTQIGKLEWLESLDLSRNKLS-GS 626
             L  +P  L    ++  + L  N +          P    K      + L  N +    
Sbjct: 229 NKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWE 288

Query: 627 IPPSM 631
           I PS 
Sbjct: 289 IQPST 293
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query750
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.63
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.87
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.97  E-value=6e-31  Score=270.85  Aligned_cols=254  Identities=31%  Similarity=0.508  Sum_probs=217.0

Q ss_pred             CCcEEEeecccccC--CCCcchhccCCCCCEEecCC-CcCcccCCcCCcCCCCCCeEECccCccccccCccccCCCCCCE
Q 037651          352 NLTKLYLRDNLFSG--PIPNDLGQKTPFLTDLDISF-NSLNGSIPQSVGNLKQLLTLVISNNNLSGGIPQFLKNISSLYI  428 (750)
Q Consensus       352 ~L~~L~l~~n~l~~--~i~~~~~~~~~~L~~L~ls~-n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~  428 (750)
                      .++.|++++|.++|  .+|..+.. +++|++|++++ |.++|.+|..++++++|++|++++|++.+..+..+..+..|+.
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~-L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLAN-LPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGG-CTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhc-Cccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            68888999988887  47777765 89999999986 7888888988999999999999999999888888888999999


Q ss_pred             EeCCCCccceeCCccccCCCCCCEEEccCCcCcCCCCccccCCCCC-CEEecCCCcccccCChhhhhcCCCCCEEEccCc
Q 037651          429 LDMTKNNFSGEIPESIGSLLTIRFLVLSNNHLSGEIPPSLKNCSLM-DSLDLGENQLSGNIPAWIGESMPSLSILRLRSN  507 (750)
Q Consensus       429 L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~L~~n~~~~~~p~~~~~~l~~L~~L~Ls~n  507 (750)
                      +++++|.+.+.+|..+..++.++.+++++|.+++.+|..+..+..+ +.+++++|++++..|..+.. + ....++++++
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~-l-~~~~l~l~~~  207 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN-L-NLAFVDLSRN  207 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG-C-CCSEEECCSS
T ss_pred             cccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccc-c-cccccccccc
Confidence            9999999888888889999999999999999988888888888776 88999999998888877653 4 4557899999


Q ss_pred             cceeecCccccCCCCCcEEEcccCcCCCcCCccccccccCccCCCCCccccCceEEEEecceEeecccccccchhhhccc
Q 037651          508 HFNGTIPSELCKLSALHILDLSHNNLSGPIPHCVGDFSAMKVKPPDTEIYQGSLQVAIKGTQYVYQQTLYLMPVELTSLL  587 (750)
Q Consensus       508 ~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~~l~  587 (750)
                      ...+.+|..+..+++|+.+++++|.+++.+|                                           .++.++
T Consensus       208 ~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-------------------------------------------~~~~~~  244 (313)
T d1ogqa_         208 MLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-------------------------------------------KVGLSK  244 (313)
T ss_dssp             EEEECCGGGCCTTSCCSEEECCSSEECCBGG-------------------------------------------GCCCCT
T ss_pred             ccccccccccccccccccccccccccccccc-------------------------------------------cccccc
Confidence            9998888888899999999999998886544                                           355677


Q ss_pred             cCCeEeccCCcCCCCcccccCCCccCcEEEccCCccCcCCCccccCCCCCCeEECcCCc-ceec-CC
Q 037651          588 HLGTLNLSGNQLVGKIPTQIGKLEWLESLDLSRNKLSGSIPPSMVSIRFLSFLNLSFNN-LSGE-IP  652 (750)
Q Consensus       588 ~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~-l~g~-ip  652 (750)
                      +|+.|+|++|+++|.+|+.|+++++|+.|||++|+++|.+|+ +.++++|+.+++++|+ ++|. +|
T Consensus       245 ~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~plp  310 (313)
T d1ogqa_         245 NLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPLP  310 (313)
T ss_dssp             TCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTTSS
T ss_pred             ccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCCCC
Confidence            889999999999999999999999999999999999998985 5788899999999997 6664 45
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure