Citrus Sinensis ID: 037671


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTI
cEEcccccHHHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHccccccEEcccccccccHHHHHHHHHccccccEEccccccccHHHHHHHHcc
ccEEcccccHHHHHHHHHHHHHHHHHHcccHcHEHHHHccccccHHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccEEcHHHHHHHHHccccccEEEccccHHccHHHHHHHHHccccccEEEccccccccHHHHHHHcc
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLsfagwkmdddstaRLVGYAYSLKELEISrsrwgcqitdnglYRMSFAKCISNLTSISlwgltgitdkGVVQLISRASSlqhlniggtfitdeSLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKcgrlesinvwgtrlpldcfigllti
flfvfvipFVCLLRVSSVckkwklgvkqslarrknlsfagwkmdddstARLVGYAYSLKeleisrsrwGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLesinvwgtrlplDCFIGLLTI
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTI
*LFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLL**
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTI
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTI
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
Q9FH99228 F-box protein At5g67140 O yes no 1.0 0.820 0.695 6e-75
Q9LPL4 360 F-box protein SKP2A OS=Ar no no 0.748 0.388 0.292 3e-11
Q9SKK0 628 EIN3-binding F-box protei no no 0.604 0.179 0.318 4e-10
O49286360 F-box protein SKP2B OS=Ar no no 0.689 0.358 0.253 3e-09
Q9UJT9491 F-box/LRR-repeat protein yes no 0.721 0.274 0.288 1e-08
Q5BJ29491 F-box/LRR-repeat protein yes no 0.679 0.258 0.296 2e-08
Q5U201258 Protein AMN1 homolog OS=R no no 0.518 0.375 0.398 8e-08
Q9CZV8 436 F-box/LRR-repeat protein no no 0.534 0.229 0.359 2e-07
Q9QZH7276 F-box/LRR-repeat protein no no 0.534 0.362 0.359 2e-07
Q8LB33 353 F-box protein At3g58530 O no no 0.545 0.288 0.301 5e-07
>sp|Q9FH99|FB302_ARATH F-box protein At5g67140 OS=Arabidopsis thaliana GN=At5g67140 PE=2 SV=1 Back     alignment and function desciption
 Score =  280 bits (715), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 130/187 (69%), Positives = 154/187 (82%)

Query: 1   FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKE 60
           ++F     F  L + S VCKKW+  V QS+ARR+ LSFAGWKMDDDST+RLV  A++LKE
Sbjct: 17  YIFSLATSFTVLAQASGVCKKWRKAVNQSMARRETLSFAGWKMDDDSTSRLVHLAFNLKE 76

Query: 61  LEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNI 120
           L+ISRSRWGC ITDNGLY+++ A+C+SNL S+SLWG+T ITD GVVQLISR SSLQHLNI
Sbjct: 77  LDISRSRWGCHITDNGLYQIASARCVSNLNSVSLWGMTAITDSGVVQLISRTSSLQHLNI 136

Query: 121 GGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDC 180
           GGTFITDESL+AIA  C QLK+I +W CR VT  GLL LVNKC +LESIN+WGTR+P+DC
Sbjct: 137 GGTFITDESLFAIAERCHQLKTIGMWCCRHVTERGLLVLVNKCRKLESINLWGTRVPVDC 196

Query: 181 FIGLLTI 187
           FI LLTI
Sbjct: 197 FIALLTI 203





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 Back     alignment and function description
>sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 Back     alignment and function description
>sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 Back     alignment and function description
>sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 Back     alignment and function description
>sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 Back     alignment and function description
>sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 Back     alignment and function description
>sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
255565258227 ubiquitin-protein ligase, putative [Rici 1.0 0.823 0.754 6e-77
225438758232 PREDICTED: F-box protein At5g67140 [Viti 0.994 0.801 0.741 5e-76
224081705228 predicted protein [Populus trichocarpa] 1.0 0.820 0.737 1e-75
297794281228 F-box family protein [Arabidopsis lyrata 1.0 0.820 0.705 3e-74
449463955235 PREDICTED: F-box protein At5g67140-like 1.0 0.795 0.716 4e-74
388509932208 unknown [Lotus japonicus] 0.989 0.889 0.718 2e-73
15240225228 F-box protein [Arabidopsis thaliana] gi| 1.0 0.820 0.695 3e-73
351723989226 uncharacterized protein LOC100306324 [Gl 0.983 0.814 0.722 4e-72
357482823211 F-box protein [Medicago truncatula] gi|3 1.0 0.886 0.684 5e-72
356541783226 PREDICTED: LOW QUALITY PROTEIN: F-box pr 0.983 0.814 0.722 3e-71
>gi|255565258|ref|XP_002523621.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223537183|gb|EEF38816.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 161/187 (86%)

Query: 1   FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKE 60
            +FV +  F  L   SSVC+KWK GVK+SL RR +LSFAG KMDD STAR+V YAYSLKE
Sbjct: 17  HIFVLINSFTDLAHASSVCRKWKEGVKRSLGRRNSLSFAGLKMDDHSTARVVRYAYSLKE 76

Query: 61  LEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNI 120
           L+ISRSRWGCQITDNGLY +S AKCISNLTSISLWG+TGITDKGVVQL+SRA+SLQHLN+
Sbjct: 77  LDISRSRWGCQITDNGLYEISLAKCISNLTSISLWGMTGITDKGVVQLMSRANSLQHLNV 136

Query: 121 GGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDC 180
           GGTFITDESL AIA+SCP LKSI LWSCR VT  GL++LVNKC +LESIN WGTR+P+DC
Sbjct: 137 GGTFITDESLCAIADSCPHLKSIGLWSCRHVTEIGLIYLVNKCRKLESINAWGTRVPIDC 196

Query: 181 FIGLLTI 187
           F+ LLT+
Sbjct: 197 FLCLLTV 203




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438758|ref|XP_002282881.1| PREDICTED: F-box protein At5g67140 [Vitis vinifera] gi|296082395|emb|CBI21400.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224081705|ref|XP_002306478.1| predicted protein [Populus trichocarpa] gi|222855927|gb|EEE93474.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297794281|ref|XP_002865025.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297310860|gb|EFH41284.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449463955|ref|XP_004149695.1| PREDICTED: F-box protein At5g67140-like [Cucumis sativus] gi|449508293|ref|XP_004163274.1| PREDICTED: F-box protein At5g67140-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388509932|gb|AFK43032.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|15240225|ref|NP_201515.1| F-box protein [Arabidopsis thaliana] gi|75262475|sp|Q9FH99.1|FB302_ARATH RecName: Full=F-box protein At5g67140 gi|10177601|dbj|BAB10948.1| unnamed protein product [Arabidopsis thaliana] gi|18252175|gb|AAL61920.1| unknown protein [Arabidopsis thaliana] gi|21386939|gb|AAM47873.1| unknown protein [Arabidopsis thaliana] gi|332010923|gb|AED98306.1| F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|351723989|ref|NP_001237042.1| uncharacterized protein LOC100306324 [Glycine max] gi|255628203|gb|ACU14446.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357482823|ref|XP_003611698.1| F-box protein [Medicago truncatula] gi|355513033|gb|AES94656.1| F-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356541783|ref|XP_003539352.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At5g67140-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
TAIR|locus:2155548228 AT5G67140 [Arabidopsis thalian 1.0 0.820 0.695 8.9e-70
TAIR|locus:2027082 360 SKP2A [Arabidopsis thaliana (t 0.711 0.369 0.292 1.7e-12
TAIR|locus:2040105 628 EBF1 "AT2G25490" [Arabidopsis 0.705 0.210 0.330 2.5e-12
TAIR|locus:2076376353 AT3G58530 [Arabidopsis thalian 0.705 0.373 0.347 2.6e-12
TAIR|locus:2166978 405 AT5G23340 [Arabidopsis thalian 0.743 0.343 0.3 2.1e-10
RGD|621722276 Fbxl20 "F-box and leucine-rich 0.877 0.594 0.315 2.7e-10
MGI|MGI:1919444 436 Fbxl20 "F-box and leucine-rich 0.877 0.376 0.315 8.4e-10
UNIPROTKB|D6RDY7444 FBXL7 "F-box/LRR-repeat protei 0.711 0.299 0.328 1.4e-09
RGD|1305813449 Fbxl7 "F-box and leucine-rich 0.711 0.296 0.335 1.5e-09
UNIPROTKB|J3KNM9479 FBXL7 "F-box/LRR-repeat protei 0.711 0.277 0.328 1.6e-09
TAIR|locus:2155548 AT5G67140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 707 (253.9 bits), Expect = 8.9e-70, P = 8.9e-70
 Identities = 130/187 (69%), Positives = 154/187 (82%)

Query:     1 FLFVFVIPFVCLLRVSSVCKKWKLGVKQSLARRKNLSFAGWKMDDDSTARLVGYAYSLKE 60
             ++F     F  L + S VCKKW+  V QS+ARR+ LSFAGWKMDDDST+RLV  A++LKE
Sbjct:    17 YIFSLATSFTVLAQASGVCKKWRKAVNQSMARRETLSFAGWKMDDDSTSRLVHLAFNLKE 76

Query:    61 LEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNI 120
             L+ISRSRWGC ITDNGLY+++ A+C+SNL S+SLWG+T ITD GVVQLISR SSLQHLNI
Sbjct:    77 LDISRSRWGCHITDNGLYQIASARCVSNLNSVSLWGMTAITDSGVVQLISRTSSLQHLNI 136

Query:   121 GGTFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDC 180
             GGTFITDESL+AIA  C QLK+I +W CR VT  GLL LVNKC +LESIN+WGTR+P+DC
Sbjct:   137 GGTFITDESLFAIAERCHQLKTIGMWCCRHVTERGLLVLVNKCRKLESINLWGTRVPVDC 196

Query:   181 FIGLLTI 187
             FI LLTI
Sbjct:   197 FIALLTI 203


GO:0005737 "cytoplasm" evidence=ISM
TAIR|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040105 EBF1 "AT2G25490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076376 AT3G58530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|621722 Fbxl20 "F-box and leucine-rich repeat protein 20" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D6RDY7 FBXL7 "F-box/LRR-repeat protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305813 Fbxl7 "F-box and leucine-rich repeat protein 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNM9 FBXL7 "F-box/LRR-repeat protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FH99FB302_ARATHNo assigned EC number0.69511.00.8201yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019521001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (232 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 4e-11
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 5e-08
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-05
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
 Score = 59.3 bits (144), Expect = 4e-11
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 70  CQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGG-TFITDE 128
           C I+D  L ++S       L  + L G   I D+G++ L     +LQ L++     ITD 
Sbjct: 38  CPISDPPLDQLSNCN---KLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDS 94

Query: 129 SLYAIANSCPQLKSIVL---WSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGL 184
            + A+A +CP+L++I L    +   +T   L  L   C  L+++   G  +       L
Sbjct: 95  GIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGCDVTDKGVWEL 153


Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG4341 483 consensus F-box protein containing LRR [General fu 99.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.8
KOG4341 483 consensus F-box protein containing LRR [General fu 99.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
KOG1947 482 consensus Leucine rich repeat proteins, some prote 99.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
KOG1947 482 consensus Leucine rich repeat proteins, some prote 99.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.8
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.58
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.45
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.42
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.34
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.31
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.24
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.8
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.68
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.6
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.49
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 97.45
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.45
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.42
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.41
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.4
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.28
PLN03150623 hypothetical protein; Provisional 97.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.19
KOG4308 478 consensus LRR-containing protein [Function unknown 97.16
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG4308 478 consensus LRR-containing protein [Function unknown 97.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.96
PLN03150 623 hypothetical protein; Provisional 96.92
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.9
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.7
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.68
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.65
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.25
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.15
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.1
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.0
KOG4237 498 consensus Extracellular matrix protein slit, conta 95.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.19
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 94.72
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.45
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 94.41
KOG0617264 consensus Ras suppressor protein (contains leucine 94.21
KOG0472565 consensus Leucine-rich repeat protein [Function un 93.98
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 93.85
KOG0617264 consensus Ras suppressor protein (contains leucine 93.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 93.15
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 92.86
KOG4237 498 consensus Extracellular matrix protein slit, conta 92.51
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 92.21
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 91.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 90.98
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.58
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 89.71
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 88.27
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 85.6
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 84.86
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 84.85
PLN03215 373 ascorbic acid mannose pathway regulator 1; Provisi 84.3
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 83.45
smart0037026 LRR Leucine-rich repeats, outliers. 83.34
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.34
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.93
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 82.15
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 80.76
PRK15386 426 type III secretion protein GogB; Provisional 80.74
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
Probab=99.81  E-value=6.5e-21  Score=142.91  Aligned_cols=177  Identities=28%  Similarity=0.444  Sum_probs=142.0

Q ss_pred             CccccccchhHHHHHHHhhHHHHH-HhhhhhcccceeeecccccCHHHHHHHHhcCC-CCcEEEeeeccCCcccchhhhh
Q 037671            1 FLFVFVIPFVCLLRVSSVCKKWKL-GVKQSLARRKNLSFAGWKMDDDSTARLVGYAY-SLKELEISRSRWGCQITDNGLY   78 (187)
Q Consensus         1 ~I~~~l~~~~~~~~~~~vck~w~~-~~~~~l~~~~~l~~~~~~l~~~~~~~~~~~~~-~L~~L~l~~~~~~~~~~~~~l~   78 (187)
                      .||++|+. +.+.+++++|+.|+. ++++..|+++++--....++-..++.+.++|. .|+.|.+.++.   .+.+..+.
T Consensus        82 kvFS~LDt-ksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r---~v~~sslr  157 (483)
T KOG4341|consen   82 KVFSMLDT-KSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCR---AVGDSSLR  157 (483)
T ss_pred             HHHHHHhH-HHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccc---cCCcchhh
Confidence            38999996 999999999999999 55778998866522222344445666777764 58889888653   56677766


Q ss_pred             hhhhhccCCCccEEEecCCCCCCHHHHHHHHhcCCCCCEEEecC-CCCCHHHHHHHHhcCCccceeeccCCCCCcHHHHH
Q 037671           79 RMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSLQHLNIGG-TFITDESLYAIANSCPQLKSIVLWSCRQVTGNGLL  157 (187)
Q Consensus        79 ~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~-~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~  157 (187)
                      ..  +..||++++|++.+|.++++..+..+.+.|++|++|++-. ..+++..++.++.+||+|+.|++++|+.++..+++
T Consensus       158 t~--~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~  235 (483)
T KOG4341|consen  158 TF--ASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQ  235 (483)
T ss_pred             HH--hhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchhhcCcch
Confidence            65  5679999999999998899999999999999999999988 67888888889999999999999999999988888


Q ss_pred             HHHhcCCCCcEEEeeCC-CCCHHHHHh
Q 037671          158 FLVNKCGRLESINVWGT-RLPLDCFIG  183 (187)
Q Consensus       158 ~l~~~~~~L~~L~l~~~-~i~~~~~~~  183 (187)
                      .+..+|+.++.+.++|| +..++.+..
T Consensus       236 ~~~rG~~~l~~~~~kGC~e~~le~l~~  262 (483)
T KOG4341|consen  236 ALQRGCKELEKLSLKGCLELELEALLK  262 (483)
T ss_pred             HHhccchhhhhhhhcccccccHHHHHH
Confidence            88888888888877777 666666544



>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-17
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-15
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-10
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 1e-16
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-16
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-15
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-16
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-14
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-14
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-12
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score = 78.4 bits (193), Expect = 2e-17
 Identities = 29/144 (20%), Positives = 58/144 (40%), Gaps = 11/144 (7%)

Query: 35  NLSFAGWKMDDDSTARLVGYAY-SLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSIS 93
           NL   GW          +  +Y  L+E+ + R      +TD+ L     AK   N   + 
Sbjct: 83  NLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKR----MVVTDDCLE--LIAKSFKNFKVLV 136

Query: 94  LWGLTGITDKGVVQLISRASSLQHLNIGG---TFITDESLYAIANSCPQLKSIVLWSCR- 149
           L    G +  G+  + +   +L+ L++       ++   L    ++   L S+ +     
Sbjct: 137 LSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLAS 196

Query: 150 QVTGNGLLFLVNKCGRLESINVWG 173
           +V+ + L  LV +C  L+S+ +  
Sbjct: 197 EVSFSALERLVTRCPNLKSLKLNR 220


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.73
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.68
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.66
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.36
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.34
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.29
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.26
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.1
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.03
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.95
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.84
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.76
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.71
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.71
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.7
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.65
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.63
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.59
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.58
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.58
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.57
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.57
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.55
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.55
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 98.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.55
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.53
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.53
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.52
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.51
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.5
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.48
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.48
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.47
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.46
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.46
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.45
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.45
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.45
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.45
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.44
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.41
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.41
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.4
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.39
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.39
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.39
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.39
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.38
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.35
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.34
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.3
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.3
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.29
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.27
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.26
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.24
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.23
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.21
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.2
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.2
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.18
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.03
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.02
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.0
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.83
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.82
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.65
3sb4_A 329 Hypothetical leucine rich repeat protein; LRR, rig 97.58
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.52
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.48
3l2o_B 312 F-box only protein 4; small G protein fold, UBL co 97.42
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.29
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.26
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.17
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.1
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.0
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 96.87
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.75
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 96.72
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.36
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.29
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.98
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.76
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 92.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 92.45
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.04
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 88.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 87.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 84.4
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 81.33
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.90  E-value=2.6e-22  Score=151.54  Aligned_cols=177  Identities=21%  Similarity=0.348  Sum_probs=129.8

Q ss_pred             CccccccchhHHHHHHHhhHHHHHHhh-hhhcccce--------------------------------------------
Q 037671            1 FLFVFVIPFVCLLRVSSVCKKWKLGVK-QSLARRKN--------------------------------------------   35 (187)
Q Consensus         1 ~I~~~l~~~~~~~~~~~vck~w~~~~~-~~l~~~~~--------------------------------------------   35 (187)
                      +||+||+ .+|+.++++|||+|++++. +.+|+..+                                            
T Consensus        19 ~If~~L~-~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~~~~~~~~~~~L~~   97 (336)
T 2ast_B           19 GIFSCLC-LPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQH   97 (336)
T ss_dssp             HHHTTSC-HHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECSCCCSCCCCBCCCE
T ss_pred             HHHHhCC-HHHHHHHHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCccccccchhhccCCCCCE
Confidence            4899999 5999999999999999763 44454321                                            


Q ss_pred             eeecccccCHHHHHHHHhcCCCCcEEEeeeccCCcccchhhhhhhhhhccCCCccEEEecCCCCCCHHHHHHHHhcCCCC
Q 037671           36 LSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRASSL  115 (187)
Q Consensus        36 l~~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L  115 (187)
                      +++.++.++...+......+++|++|++++|    .+++.....+   ..+++|++|++++|..+++.++......+++|
T Consensus        98 L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~----~l~~~~~~~l---~~~~~L~~L~L~~~~~l~~~~l~~~~~~~~~L  170 (336)
T 2ast_B           98 MDLSNSVIEVSTLHGILSQCSKLQNLSLEGL----RLSDPIVNTL---AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL  170 (336)
T ss_dssp             EECTTCEECHHHHHHHHTTBCCCSEEECTTC----BCCHHHHHHH---TTCTTCSEEECTTCBSCCHHHHHHHHHHCTTC
T ss_pred             EEccCCCcCHHHHHHHHhhCCCCCEEeCcCc----ccCHHHHHHH---hcCCCCCEEECCCCCCCCHHHHHHHHhcCCCC
Confidence            2223333444445666666777777777754    5666666555   23788888888888558887777777778888


Q ss_pred             CEEEecCC-CCCHHHHHHHHhcCC-ccceeeccCCC-CCcHHHHHHHHhcCCCCcEEEeeCCC-CCHHHHHhhh
Q 037671          116 QHLNIGGT-FITDESLYAIANSCP-QLKSIVLWSCR-QVTGNGLLFLVNKCGRLESINVWGTR-LPLDCFIGLL  185 (187)
Q Consensus       116 ~~L~l~~~-~~~~~~~~~l~~~~~-~L~~L~l~~~~-~~~~~~~~~l~~~~~~L~~L~l~~~~-i~~~~~~~L~  185 (187)
                      ++|+++++ .+++.++......+| +|++|++++|. .+++.++..+...+|+|++|++++|. +++++...+.
T Consensus       171 ~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~  244 (336)
T 2ast_B          171 DELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF  244 (336)
T ss_dssp             CEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG
T ss_pred             CEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHHHh
Confidence            88888887 888877777777788 88888888865 67777777777778888888888887 7777665543



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.0 bits (86), Expect = 4e-04
 Identities = 12/93 (12%), Positives = 36/93 (38%), Gaps = 9/93 (9%)

Query: 88  NLTSISLWGLTGITDKGVVQLISRASSLQHLNIGGTFITDESLYAIAN---SCPQLKSIV 144
           ++ S+ +     ++D    +L+      Q + +    +T+     I++     P L  + 
Sbjct: 3   DIQSLDIQC-EELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELN 61

Query: 145 LWSCRQVTGNGLL----FLVNKCGRLESINVWG 173
           L S  ++   G+      L     +++ +++  
Sbjct: 62  LRSN-ELGDVGVHCVLQGLQTPSCKIQKLSLQN 93


>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.79
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.15
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.85
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.68
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.32
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.22
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.14
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.12
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.05
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.01
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.98
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.89
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.83
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.81
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.61
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 97.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.18
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 96.95
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.8
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 96.72
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.48
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.23
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=5.4e-19  Score=129.08  Aligned_cols=145  Identities=19%  Similarity=0.328  Sum_probs=103.8

Q ss_pred             ceeeecccccCHHHHHHHHhcCCCCcEEEeeeccCCcccchhhhhhhhhhccCCCccEEEecCCCCCCHHHHHHHHhcCC
Q 037671           34 KNLSFAGWKMDDDSTARLVGYAYSLKELEISRSRWGCQITDNGLYRMSFAKCISNLTSISLWGLTGITDKGVVQLISRAS  113 (187)
Q Consensus        34 ~~l~~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~  113 (187)
                      ++++++++.+++..+..+...+++|++|++++    +.+++.++..++   .+++|++|++++|..+++.++..+.+.++
T Consensus        49 ~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~----~~l~~~~~~~l~---~~~~L~~L~Ls~c~~itd~~l~~l~~~~~  121 (284)
T d2astb2          49 QHMDLSNSVIEVSTLHGILSQCSKLQNLSLEG----LRLSDPIVNTLA---KNSNLVRLNLSGCSGFSEFALQTLLSSCS  121 (284)
T ss_dssp             CEEECTTCEECHHHHHHHHTTBCCCSEEECTT----CBCCHHHHHHHT---TCTTCSEEECTTCBSCCHHHHHHHHHHCT
T ss_pred             CEEECCCCccCHHHHHHHHHhCCCcccccccc----cCCCcHHHHHHh---cCCCCcCccccccccccccccchhhHHHH
Confidence            45677777778777888888888888888874    367777776652   36778888887777777777777777777


Q ss_pred             CCCEEEecC-CCCCHHHHHH-HHhcCCccceeeccCC-CCCcHHHHHHHHhcCCCCcEEEeeCC-CCCHHHHHhhh
Q 037671          114 SLQHLNIGG-TFITDESLYA-IANSCPQLKSIVLWSC-RQVTGNGLLFLVNKCGRLESINVWGT-RLPLDCFIGLL  185 (187)
Q Consensus       114 ~L~~L~l~~-~~~~~~~~~~-l~~~~~~L~~L~l~~~-~~~~~~~~~~l~~~~~~L~~L~l~~~-~i~~~~~~~L~  185 (187)
                      +|++|++++ ..++++++.. +...++.|++|++++| ..+++.++..++..||+|++|++++| .++++++..+.
T Consensus       122 ~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~  197 (284)
T d2astb2         122 RLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF  197 (284)
T ss_dssp             TCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG
T ss_pred             hccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc
Confidence            788887777 4677766643 4455567777777765 35777777777777777777777776 56777666554



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure