Citrus Sinensis ID: 037807

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30

MYLAGQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLCSIPNPKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRVILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPINPIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKKPAHSHIPSTRWPEANICQC

ccccccEEEEEEEEEEEEccccccEEEEEEccccccEEEEcccEEEEcccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHccccccEEEEEEccHHHHHHHHHHcHHHHcccccccEEEEEccHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHccccccEEcccEEEcccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHccccccccccccccccc

ccccccEEEEEccEEEEEEEccccEEEEEEEcccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHcccccccEEEEEEccHHHHHHHHHHcHHHHHHHHcccEEEEEccHHHHHHHccccEEEEEEEccccccccccHHHcHHHHHHHHHHEEEEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEEcccccccEEEEEEEEccccccccccccccccccHHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHHHHccccccccccEccc

mylagqahFLEVEKIIFQGKSEYQNMMVFQsssygkvfvldgalqltekDECAYQEMIthlplcsipnpkkvlligggdggiLREISRHASVEQIHICEIDTMLINVYKEyfpeiaigyedsRVILHVcdgseylktvqsgtfdaiiidafdpirpghdlfegpFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRifkgsasyawttvptypsgvIGFMLCstesegpsvdfihpinpidpdqifgvakgplkfynsaEVHAaafclptfakkpahshipstrwpeanicqc

mylagqahFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHlplcsipnpKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRVILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPINPIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKKPAhshipstrwpeanicqc

MYLAGQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLCSIPNPKKVlligggdggilREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRVILHVCDGSEYLKTVQSGTfdaiiidafdPIRPGHDLFEGPFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPINPIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKKPAHSHIPSTRWPEANICQC

***AGQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLCSIPNPKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRVILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPINPIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKK*******************

*YLAGQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLCSIPNPKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRVILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPINPIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKKPAHSH*****WP*ANICQC

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		299	2.2.26 [Sep-21-2011]
Q96556		308	Spermidine synthase 1 OS=	N/A	no	0.913	0.886	0.688	1e-114
O48659		308	Spermidine synthase 2 OS=	N/A	no	0.929	0.902	0.679	1e-113
O82147		316	Spermidine synthase OS=Co	N/A	no	0.913	0.863	0.681	1e-112
O48660		314	Spermidine synthase OS=Ni	N/A	no	0.913	0.869	0.666	1e-111
Q96557		317	Spermidine synthase 2 OS=	N/A	no	0.909	0.858	0.670	1e-111
O48658		315	Spermidine synthase 1 OS=	N/A	no	0.909	0.863	0.673	1e-111
Q9ZS45		342	Spermidine synthase OS=So	N/A	no	0.909	0.795	0.670	1e-110
Q9ZTR1		334	Spermidine synthase 1 OS=	N/A	no	0.909	0.814	0.655	1e-110
Q9ZUB3		334	Spermidine synthase 1 OS=	yes	no	0.906	0.811	0.655	1e-110
Q9SMB1		323	Spermidine synthase 1 OS=	yes	no	0.913	0.845	0.648	1e-109

>sp\|Q96556\|SPD1_DATST Spermidine synthase 1 OS=Datura stramonium PE=2 SV=1	Back alignment and function desciption

 Score =  411 bits (1057), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/276 (68%), Positives = 233/276 (84%), Gaps = 3/276 (1%)

Query: 5   GQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLC 64
           G+AH L+VEKI+FQGKS+YQN+MVFQSS+YGKV +LDG +QLTE+DECAYQEMITHLPLC
Sbjct: 29  GEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILDGVIQLTERDECAYQEMITHLPLC 88

Query: 65  SIPNPKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRV 124
           SIPNPKKVL+IGGGDGG+LRE+SRH+SVEQI ICEID M+I+V K++FP +AIGYED RV
Sbjct: 89  SIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVIDVSKQFFPNVAIGYEDPRV 148

Query: 125 ILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAE 184
            LHV DG  +LK V  GT+DA+I+D+ DPI P  +LFE PFFE VA+ALRPGG +C QAE
Sbjct: 149 KLHVGDGVAFLKFVAEGTYDAVIVDSSDPIGPAQELFEKPFFESVARALRPGGVVCTQAE 208

Query: 185 SLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPIN 244
           S+W     ++ ++ +C +IFKGS +YAWTTVPTYPSGVIGFMLCST  EGP+VDF +PIN
Sbjct: 209 SIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST--EGPAVDFKNPIN 266

Query: 245 PIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKK 280
           P+D D      +GPLKFYNS E+H+A+FCLP+FAK+
Sbjct: 267 PVDADDSHTKTRGPLKFYNS-EIHSASFCLPSFAKR 301

Datura stramonium (taxid: 4076)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 6

>sp\|O48659\|SPD2_HYONI Spermidine synthase 2 OS=Hyoscyamus niger PE=2 SV=1	Back alignment and function description

>sp\|O82147\|SPDE_COFAR Spermidine synthase OS=Coffea arabica PE=2 SV=1	Back alignment and function description

>sp\|O48660\|SPDE_NICSY Spermidine synthase OS=Nicotiana sylvestris PE=2 SV=1	Back alignment and function description

>sp\|Q96557\|SPD2_DATST Spermidine synthase 2 OS=Datura stramonium PE=2 SV=1	Back alignment and function description

>sp\|O48658\|SPD1_HYONI Spermidine synthase 1 OS=Hyoscyamus niger PE=2 SV=1	Back alignment and function description

>sp\|Q9ZS45\|SPDE_SOLLC Spermidine synthase OS=Solanum lycopersicum GN=SPDSYN PE=2 SV=1	Back alignment and function description

>sp\|Q9ZTR1\|SPD1_PEA Spermidine synthase 1 OS=Pisum sativum GN=SPDSYN1 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZUB3\|SPD1_ARATH Spermidine synthase 1 OS=Arabidopsis thaliana GN=SPDSYN1 PE=1 SV=1	Back alignment and function description

>sp\|Q9SMB1\|SPD1_ORYSJ Spermidine synthase 1 OS=Oryza sativa subsp. japonica GN=SPDSYN1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		299
356518987		338	PREDICTED: spermidine synthase-like [Gly	0.953	0.843	0.731	1e-114
449477396		364	PREDICTED: spermidine synthase-like [Cuc	0.913	0.75	0.707	1e-113
6094327		308	RecName: Full=Spermidine synthase 1; Sho	0.913	0.886	0.688	1e-112
6094330		308	RecName: Full=Spermidine synthase 2; Sho	0.929	0.902	0.679	1e-112
255587587		346	spermidine synthase 1, putative [Ricinus	0.906	0.783	0.684	1e-111
449434907		317	PREDICTED: spermidine synthase-like [Cuc	0.909	0.858	0.688	1e-111
6094335		316	RecName: Full=Spermidine synthase; Short	0.913	0.863	0.681	1e-111
49425361		317	spermidine synthase [Cucumis sativus]	0.909	0.858	0.684	1e-110
126153731		328	spermidine synthase [Lotus japonicus]	0.909	0.829	0.673	1e-110
357485917		343	Spermidine synthase [Medicago truncatula	0.909	0.793	0.670	1e-110

>gi\|356518987\|ref\|XP_003528156.1\| PREDICTED: spermidine synthase-like [Glycine max]	Back alignment and taxonomy information

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/290 (73%), Positives = 252/290 (86%), Gaps = 5/290 (1%)

Query: 5   GQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLC 64
           GQAHFL+VEKI FQGKSEYQNM+VFQSS+YGKVFVLDGALQLTEKDECAYQEM+THLPLC
Sbjct: 52  GQAHFLKVEKICFQGKSEYQNMLVFQSSTYGKVFVLDGALQLTEKDECAYQEMMTHLPLC 111

Query: 65  SIPNPKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRV 124
           SIP+PKKVLLIGGGDGGILREISRH+SVEQI ICEIDTMLI+VYKE+FP++A+GY+D RV
Sbjct: 112 SIPSPKKVLLIGGGDGGILREISRHSSVEQIDICEIDTMLIDVYKEFFPDVAVGYKDPRV 171

Query: 125 ILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAE 184
            LH+ DG+ +L +V  G +DAII+DAFDPIRP H+LFE  FFELV+KALRPGG +CIQAE
Sbjct: 172 KLHIIDGTLFLNSVPKGMYDAIIVDAFDPIRPDHELFESEFFELVSKALRPGGVLCIQAE 231

Query: 185 SLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPIN 244
           S+WF    ++ L+  C + FKGS+ YAWTTVP YPSGVIGF+LCST  EGP VDF +PIN
Sbjct: 232 SIWFHSLDIEELLTKCRQTFKGSSDYAWTTVPAYPSGVIGFLLCST--EGPFVDFRNPIN 289

Query: 245 PIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKKPAHSHIPST-RWPE 293
           PIDP+  +G++K PLKFYNS EVH+AAFCLP+FAK+ ++S   ST +WP+
Sbjct: 290 PIDPEN-YGISKQPLKFYNS-EVHSAAFCLPSFAKRFSNSKAKSTAKWPQ 337

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449477396\|ref\|XP_004155011.1\| PREDICTED: spermidine synthase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|6094327\|sp\|Q96556.1\|SPD1_DATST RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: Full=Putrescine aminopropyltransferase 1 gi\|1561577\|emb\|CAA69420.1\| spermidine synthase 1 [Datura stramonium]	Back alignment and taxonomy information

>gi\|6094330\|sp\|O48659.1\|SPD2_HYONI RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi\|2821957\|dbj\|BAA24534.1\| spermidine synthase 2 [Hyoscyamus niger]	Back alignment and taxonomy information

>gi\|255587587\|ref\|XP_002534321.1\| spermidine synthase 1, putative [Ricinus communis] gi\|223525495\|gb\|EEF28057.1\| spermidine synthase 1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449434907\|ref\|XP_004135237.1\| PREDICTED: spermidine synthase-like [Cucumis sativus] gi\|449478562\|ref\|XP_004155353.1\| PREDICTED: spermidine synthase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|6094335\|sp\|O82147.1\|SPDE_COFAR RecName: Full=Spermidine synthase; Short=SPDSY; AltName: Full=Putrescine aminopropyltransferase gi\|3242659\|dbj\|BAA29033.1\| spermidine synthase [Coffea arabica]	Back alignment and taxonomy information

>gi\|49425361\|gb\|AAT66041.1\| spermidine synthase [Cucumis sativus]	Back alignment and taxonomy information

>gi\|126153731\|emb\|CAM35497.1\| spermidine synthase [Lotus japonicus]	Back alignment and taxonomy information

>gi\|357485917\|ref\|XP_003613246.1\| Spermidine synthase [Medicago truncatula] gi\|355514581\|gb\|AES96204.1\| Spermidine synthase [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		299
TAIR\|locus:2016129		340	SPDS2 "spermidine synthase 2"	0.913	0.802	0.597	2.3e-87
UNIPROTKB\|P19623		302	SRM "Spermidine synthase" [Hom	0.892	0.884	0.434	4.2e-56
RGD\|620796		302	Srm "spermidine synthase" [Rat	0.892	0.884	0.416	1.1e-53
POMBASE\|SPBC12C2.07c		298	SPBC12C2.07c "spermidine synth	0.886	0.889	0.410	2.4e-53
UNIPROTKB\|E1BM12		302	SRM "Uncharacterized protein"	0.892	0.884	0.416	3e-53
UNIPROTKB\|I3LPB8		302	SRM "Uncharacterized protein"	0.892	0.884	0.413	4.9e-53
CGD\|CAL0006284		297	SPE3 [Candida albicans (taxid:	0.886	0.892	0.427	2.1e-52
MGI\|MGI:102690		302	Srm "spermidine synthase" [Mus	0.892	0.884	0.405	2.1e-52
DICTYBASE\|DDB_G0268630		284	spsA "Spermidine synthase" [Di	0.879	0.926	0.398	2.4e-51
ZFIN\|ZDB-GENE-040426-1183		289	srm "spermidine synthase" [Dan	0.892	0.923	0.405	3.1e-51

TAIR\|locus:2016129 SPDS2 "spermidine synthase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 873 (312.4 bits), Expect = 2.3e-87, P = 2.3e-87
 Identities = 165/276 (59%), Positives = 205/276 (74%)

Query:     5 GQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLC 64
             G+AH L+VEKI+FQGKS+YQ+++VFQS++YGKV VLDG +QLTE+DECAYQEMITHLPLC
Sbjct:    61 GEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLC 120

Query:    65 SIPNPKKVXXXXXXXXXXXREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRV 124
             SI NPKKV           RE++RH+SVEQI ICEID M+++V K+YFP +A+GYED RV
Sbjct:   121 SISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQYFPNVAVGYEDPRV 180

Query:   125 ILHVCDGSEYLKTVQSGTXXXXXXXXXXPIRPGHDLFEGPFFELVAKALRPGGAMCIQAE 184
              L + DG  +LK    GT          PI P  +LFE PFFE V +ALRPGG +C QAE
Sbjct:   181 NLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRALRPGGVVCTQAE 240

Query:   185 SLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPIN 244
             SLW     ++ ++ +C  IFKGS +YAWT+VPTYPSGVIGFMLCS  SEGP VDF  P++
Sbjct:   241 SLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSGVIGFMLCS--SEGPQVDFKKPVS 298

Query:   245 PIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKK 280
              ID D+    +  PLK+YN AE+H+AAFCLP+FAKK
Sbjct:   299 LIDTDESSIKSHCPLKYYN-AEIHSAAFCLPSFAKK 333

GO:0003824 "catalytic activity" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0004766 "spermidine synthase activity" evidence=IDA

GO:0008295 "spermidine biosynthetic process" evidence=RCA;IDA

GO:0005515 "protein binding" evidence=IPI

GO:0005886 "plasma membrane" evidence=IDA

GO:0000096 "sulfur amino acid metabolic process" evidence=RCA

GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA

GO:0009069 "serine family amino acid metabolic process" evidence=RCA

GO:0009616 "virus induced gene silencing" evidence=RCA

GO:0010050 "vegetative phase change" evidence=RCA

GO:0042545 "cell wall modification" evidence=RCA

UNIPROTKB\|P19623 SRM "Spermidine synthase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|620796 Srm "spermidine synthase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

POMBASE\|SPBC12C2.07c SPBC12C2.07c "spermidine synthase (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BM12 SRM "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LPB8 SRM "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

CGD\|CAL0006284 SPE3 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

MGI\|MGI:102690 Srm "spermidine synthase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0268630 spsA "Spermidine synthase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1183 srm "spermidine synthase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q1CLX1	SPEE_YERPN	2, ., 5, ., 1, ., 1, 6	0.3454	0.8862	0.8952	yes	no
A6TRI3	SPEE_ALKMQ	2, ., 5, ., 1, ., 1, 6	0.3516	0.8662	0.9119	yes	no
Q96556	SPD1_DATST	2, ., 5, ., 1, ., 1, 6	0.6884	0.9130	0.8863	N/A	no
Q96557	SPD2_DATST	2, ., 5, ., 1, ., 1, 6	0.6702	0.9096	0.8580	N/A	no
B0K172	SPEE_THEPX	2, ., 5, ., 1, ., 1, 6	0.3649	0.8394	0.9061	yes	no
B0SI93	SPEE_LEPBA	2, ., 5, ., 1, ., 1, 6	0.4218	0.8729	0.9288	yes	no
Q64674	SPEE_MOUSE	2, ., 5, ., 1, ., 1, 6	0.4601	0.8929	0.8841	yes	no
O48658	SPD1_HYONI	2, ., 5, ., 1, ., 1, 6	0.6739	0.9096	0.8634	N/A	no
O48659	SPD2_HYONI	2, ., 5, ., 1, ., 1, 6	0.6797	0.9297	0.9025	N/A	no
A5IJD3	SPEE_THEP1	2, ., 5, ., 1, ., 1, 6	0.3576	0.8662	0.875	yes	no
B0K9I5	SPEE_THEP3	2, ., 5, ., 1, ., 1, 6	0.3649	0.8394	0.9061	yes	no
B5Y1R1	SPEE_KLEP3	2, ., 5, ., 1, ., 1, 6	0.3444	0.8695	0.9090	yes	no
Q8RA94	SPEE1_THETN	2, ., 5, ., 1, ., 1, 6	0.3759	0.8394	0.9061	yes	no
A9R1H4	SPEE_YERPG	2, ., 5, ., 1, ., 1, 6	0.3454	0.8862	0.8952	yes	no
Q0SVK7	SPEE_CLOPS	2, ., 5, ., 1, ., 1, 6	0.3393	0.8494	0.8975	yes	no
Q8ZBJ8	SPEE_YERPE	2, ., 5, ., 1, ., 1, 6	0.3454	0.8862	0.8952	yes	no
Q9ZUB3	SPD1_ARATH	2, ., 5, ., 1, ., 1, 6	0.6557	0.9063	0.8113	yes	no
Q09741	SPEE_SCHPO	2, ., 5, ., 1, ., 1, 6	0.4654	0.8862	0.8892	yes	no
Q0TTQ7	SPEE_CLOP1	2, ., 5, ., 1, ., 1, 6	0.3429	0.8494	0.8975	yes	no
Q9XY92	SPEE_DICDI	2, ., 5, ., 1, ., 1, 6	0.4372	0.8896	0.9366	yes	no
Q9SMB1	SPD1_ORYSJ	2, ., 5, ., 1, ., 1, 6	0.6485	0.9130	0.8452	yes	no
O48660	SPDE_NICSY	2, ., 5, ., 1, ., 1, 6	0.6666	0.9130	0.8694	N/A	no
A4W6M6	SPEE_ENT38	2, ., 5, ., 1, ., 1, 6	0.3454	0.8662	0.8961	yes	no
A3DDA0	SPEE_CLOTH	2, ., 5, ., 1, ., 1, 6	0.3740	0.8528	0.9272	yes	no
Q1C3U7	SPEE_YERPA	2, ., 5, ., 1, ., 1, 6	0.3454	0.8862	0.8952	yes	no
O82147	SPDE_COFAR	2, ., 5, ., 1, ., 1, 6	0.6811	0.9130	0.8639	N/A	no
A9MZR2	SPEE_SALPB	2, ., 5, ., 1, ., 1, 6	0.3406	0.8595	0.8986	yes	no
P19623	SPEE_HUMAN	2, ., 5, ., 1, ., 1, 6	0.4891	0.8929	0.8841	yes	no
Q8EXA3	SPEE2_LEPIN	2, ., 5, ., 1, ., 1, 6	0.4456	0.8762	0.9357	yes	no
A1JJM8	SPEE_YERE8	2, ., 5, ., 1, ., 1, 6	0.3418	0.8862	0.9233	yes	no
B9KAY3	SPEE_THENN	2, ., 5, ., 1, ., 1, 6	0.3613	0.8662	0.875	yes	no
A4TPU4	SPEE_YERPP	2, ., 5, ., 1, ., 1, 6	0.3454	0.8862	0.8952	yes	no
Q18A85	SPEE_CLOD6	2, ., 5, ., 1, ., 1, 6	0.3731	0.8595	0.9081	yes	no
Q12074	SPEE_YEAST	2, ., 5, ., 1, ., 1, 6	0.4420	0.8896	0.9078	yes	no
Q9WZC2	SPEE_THEMA	2, ., 5, ., 1, ., 1, 6	0.3613	0.8662	0.875	yes	no
B0STV8	SPEE_LEPBP	2, ., 5, ., 1, ., 1, 6	0.4218	0.8729	0.9288	yes	no
Q9ZTR1	SPD1_PEA	2, ., 5, ., 1, ., 1, 6	0.6557	0.9096	0.8143	N/A	no
Q8XMY8	SPEE_CLOPE	2, ., 5, ., 1, ., 1, 6	0.3393	0.8494	0.8975	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.5.1.22	LOW CONFIDENCE prediction!
4th Layer	2.5.1.16	0.946
3rd Layer	2.5.1	0.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		299
PLN02366		308	PLN02366, PLN02366, spermidine synthase	1e-173
pfam01564		240	pfam01564, Spermine_synth, Spermine/spermidine syn	1e-93
PRK00811		283	PRK00811, PRK00811, spermidine synthase; Provision	4e-88
COG0421		282	COG0421, SpeE, Spermidine synthase [Amino acid tra	8e-87
TIGR00417		271	TIGR00417, speE, spermidine synthase	1e-85
PLN02823		336	PLN02823, PLN02823, spermine synthase	1e-36
COG4262		508	COG4262, COG4262, Predicted spermidine synthase wi	1e-28
PRK01581		374	PRK01581, speE, spermidine synthase; Validated	3e-26
PRK03612		521	PRK03612, PRK03612, spermidine synthase; Provision	1e-25
PRK04457		262	PRK04457, PRK04457, spermidine synthase; Provision	1e-10
cd02440		107	cd02440, AdoMet_MTases, S-adenosylmethionine-depen	3e-08
pfam13659		117	pfam13659, Methyltransf_26, Methyltransferase doma	5e-07
COG4122		219	COG4122, COG4122, Predicted O-methyltransferase [G	2e-06
PRK00536		262	PRK00536, speE, spermidine synthase; Provisional	2e-06
pfam12847		104	pfam12847, Methyltransf_18, Methyltransferase doma	5e-04
pfam08242		98	pfam08242, Methyltransf_12, Methyltransferase doma	0.001
pfam13578		105	pfam13578, Methyltransf_24, Methyltransferase doma	0.004

>gnl\|CDD\|215208 PLN02366, PLN02366, spermidine synthase	Back alignment and domain information

 Score =  481 bits (1241), Expect = e-173
 Identities = 183/276 (66%), Positives = 230/276 (83%), Gaps = 3/276 (1%)

Query: 5   GQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLC 64
           G+AH L+VEK++FQGKS++Q+++VF+S++YGKV VLDG +QLTE+DECAYQEMITHLPLC
Sbjct: 28  GEAHSLKVEKVLFQGKSDFQDVLVFESATYGKVLVLDGVIQLTERDECAYQEMITHLPLC 87

Query: 65  SIPNPKKVLLIGGGDGGILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRV 124
           SIPNPKKVL++GGGDGG+LREI+RH+SVEQI ICEID M+I+V K++FP++A+G++D RV
Sbjct: 88  SIPNPKKVLVVGGGDGGVLREIARHSSVEQIDICEIDKMVIDVSKKFFPDLAVGFDDPRV 147

Query: 125 ILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLFEGPFFELVAKALRPGGAMCIQAE 184
            LH+ DG E+LK    GT+DAII+D+ DP+ P  +LFE PFFE VA+ALRPGG +C QAE
Sbjct: 148 NLHIGDGVEFLKNAPEGTYDAIIVDSSDPVGPAQELFEKPFFESVARALRPGGVVCTQAE 207

Query: 185 SLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIHPIN 244
           S+W     ++ LI  C   FKGS +YAWTTVPTYPSGVIGF+LCS   EGP+VDF HP+N
Sbjct: 208 SMWLHMDLIEDLIAICRETFKGSVNYAWTTVPTYPSGVIGFVLCSK--EGPAVDFKHPVN 265

Query: 245 PIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKK 280
           PID  +  G AK PLKFYNS EVH AAFCLP+FAK+
Sbjct: 266 PIDKLEGAGKAKRPLKFYNS-EVHRAAFCLPSFAKR 300

Length = 308

>gnl\|CDD\|216573 pfam01564, Spermine_synth, Spermine/spermidine synthase	Back alignment and domain information

>gnl\|CDD\|234843 PRK00811, PRK00811, spermidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|223498 COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|188048 TIGR00417, speE, spermidine synthase	Back alignment and domain information

>gnl\|CDD\|178418 PLN02823, PLN02823, spermine synthase	Back alignment and domain information

>gnl\|CDD\|226713 COG4262, COG4262, Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234961 PRK01581, speE, spermidine synthase; Validated	Back alignment and domain information

>gnl\|CDD\|235139 PRK03612, PRK03612, spermidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|179854 PRK04457, PRK04457, spermidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>gnl\|CDD\|222295 pfam13659, Methyltransf_26, Methyltransferase domain	Back alignment and domain information

>gnl\|CDD\|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|134311 PRK00536, speE, spermidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|221804 pfam12847, Methyltransf_18, Methyltransferase domain	Back alignment and domain information

>gnl\|CDD\|219760 pfam08242, Methyltransf_12, Methyltransferase domain	Back alignment and domain information

>gnl\|CDD\|222236 pfam13578, Methyltransf_24, Methyltransferase domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		299
PLN02366		308	spermidine synthase	100.0
PRK00536		262	speE spermidine synthase; Provisional	100.0
PRK00811		283	spermidine synthase; Provisional	100.0
COG0421		282	SpeE Spermidine synthase [Amino acid transport and	100.0
PLN02823		336	spermine synthase	100.0
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	100.0
KOG1562		337	consensus Spermidine synthase [Amino acid transpor	100.0
PF01564		246	Spermine_synth: Spermine/spermidine synthase; Inte	100.0
PRK03612		521	spermidine synthase; Provisional	100.0
PRK01581		374	speE spermidine synthase; Validated	100.0
COG4262		508	Predicted spermidine synthase with an N-terminal m	100.0
PRK04457		262	spermidine synthase; Provisional	99.94
COG2521		287	Predicted archaeal methyltransferase [General func	99.72
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	99.62
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	99.55
COG4123		248	Predicted O-methyltransferase [General function pr	99.53
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	99.52
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	99.51
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	99.49
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	99.49
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	99.47
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	99.46
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	99.45
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	99.45
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	99.45
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	99.43
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	99.43
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	99.43
COG1092		393	Predicted SAM-dependent methyltransferases [Genera	99.42
PF01596		205	Methyltransf_3: O-methyltransferase; InterPro: IPR	99.41
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	99.41
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	99.41
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	99.4
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	99.4
COG4122		219	Predicted O-methyltransferase [General function pr	99.4
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	99.4
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	99.4
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	99.4
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	99.39
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	99.39
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	99.39
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	99.38
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	99.38
COG4106		257	Tam Trans-aconitate methyltransferase [General fun	99.37
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	99.37
PRK07402		196	precorrin-6B methylase; Provisional	99.37
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	99.36
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	99.36
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	99.36
PLN02476		278	O-methyltransferase	99.35
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	99.35
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	99.35
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	99.34
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	99.32
PLN02233		261	ubiquinone biosynthesis methyltransferase	99.32
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	99.32
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	99.31
PRK14967		223	putative methyltransferase; Provisional	99.31
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	99.3
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	99.3
PRK11207		197	tellurite resistance protein TehB; Provisional	99.3
PRK04266		226	fibrillarin; Provisional	99.29
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	99.29
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	99.29
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	99.29
PLN02244		340	tocopherol O-methyltransferase	99.28
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	99.28
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	99.28
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	99.28
PLN02589		247	caffeoyl-CoA O-methyltransferase	99.28
PLN03075		296	nicotianamine synthase; Provisional	99.28
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	99.27
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	99.27
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	99.27
COG2890		280	HemK Methylase of polypeptide chain release factor	99.27
TIGR00740		239	methyltransferase, putative. A simple BLAST search	99.26
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	99.26
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	99.25
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	99.25
PF02390		195	Methyltransf_4: Putative methyltransferase ; Inter	99.25
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	99.25
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	99.25
PF10672		286	Methyltrans_SAM: S-adenosylmethionine-dependent me	99.23
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	99.23
KOG2352		482	consensus Predicted spermine/spermidine synthase [	99.23
PRK10258		251	biotin biosynthesis protein BioC; Provisional	99.22
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	99.22
KOG1270		282	consensus Methyltransferases [Coenzyme transport a	99.2
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	99.19
COG0220		227	Predicted S-adenosylmethionine-dependent methyltra	99.18
PRK14968		188	putative methyltransferase; Provisional	99.17
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	99.17
KOG1540		296	consensus Ubiquinone biosynthesis methyltransferas	99.17
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	99.16
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	99.15
PLN02490		340	MPBQ/MSBQ methyltransferase	99.15
PHA03411		279	putative methyltransferase; Provisional	99.15
PRK12335		287	tellurite resistance protein TehB; Provisional	99.14
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	99.14
PLN02336		475	phosphoethanolamine N-methyltransferase	99.14
PLN02672		1082	methionine S-methyltransferase	99.13
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	99.13
PRK06922		677	hypothetical protein; Provisional	99.12
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	99.11
TIGR00095		189	RNA methyltransferase, RsmD family. This model rep	99.11
TIGR00452		314	methyltransferase, putative. Known examples to dat	99.11
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	99.11
PRK08317		241	hypothetical protein; Provisional	99.11
PRK14902		444	16S rRNA methyltransferase B; Provisional	99.1
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	99.1
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	99.09
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	99.09
PRK10901		427	16S rRNA methyltransferase B; Provisional	99.09
PF03602		183	Cons_hypoth95: Conserved hypothetical protein 95;	99.09
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	99.09
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	99.09
TIGR00438		188	rrmJ cell division protein FtsJ.	99.09
KOG1271		227	consensus Methyltransferases [General function pre	99.09
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	99.08
PHA03412		241	putative methyltransferase; Provisional	99.07
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	99.07
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	99.06
KOG4300		252	consensus Predicted methyltransferase [General fun	99.06
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	99.05
PRK14903		431	16S rRNA methyltransferase B; Provisional	99.05
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	99.05
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	99.05
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	99.05
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	99.03
PRK03522		315	rumB 23S rRNA methyluridine methyltransferase; Rev	99.03
PRK14901		434	16S rRNA methyltransferase B; Provisional	99.02
PRK14904		445	16S rRNA methyltransferase B; Provisional	99.02
TIGR02085		374	meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer	99.02
KOG2904		328	consensus Predicted methyltransferase [General fun	99.01
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	99.0
TIGR00479		431	rumA 23S rRNA (uracil-5-)-methyltransferase RumA.	99.0
PLN02336		475	phosphoethanolamine N-methyltransferase	99.0
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	98.99
KOG2899		288	consensus Predicted methyltransferase [General fun	98.98
PTZ00146		293	fibrillarin; Provisional	98.98
TIGR02716		306	C20_methyl_CrtF C-20 methyltransferase BchU. Membe	98.97
PF03848		192	TehB: Tellurite resistance protein TehB; InterPro:	98.96
KOG3010		261	consensus Methyltransferase [General function pred	98.95
COG0742		187	N6-adenine-specific methylase [DNA replication, re	98.95
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	98.95
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	98.94
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	98.94
PRK04338		382	N(2),N(2)-dimethylguanosine tRNA methyltransferase	98.92
TIGR03438		301	probable methyltransferase. This model represents	98.92
PRK05031		362	tRNA (uracil-5-)-methyltransferase; Validated	98.91
PRK05785		226	hypothetical protein; Provisional	98.91
COG2263		198	Predicted RNA methylase [Translation, ribosomal st	98.9
TIGR00308		374	TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi	98.89
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	98.89
PRK06202		232	hypothetical protein; Provisional	98.88
TIGR02143		353	trmA_only tRNA (uracil-5-)-methyltransferase. This	98.88
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	98.88
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	98.86
PRK13255		218	thiopurine S-methyltransferase; Reviewed	98.84
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	98.84
KOG1663		237	consensus O-methyltransferase [Secondary metabolit	98.81
PF02475		200	Met_10: Met-10+ like-protein; InterPro: IPR003402	98.81
PF05891		218	Methyltransf_PK: AdoMet dependent proline di-methy	98.8
PLN02585		315	magnesium protoporphyrin IX methyltransferase	98.77
PF08003		315	Methyltransf_9: Protein of unknown function (DUF16	98.77
COG4976		287	Predicted methyltransferase (contains TPR repeat)	98.77
PF00891		241	Methyltransf_2: O-methyltransferase; InterPro: IPR	98.66
PTZ00338		294	dimethyladenosine transferase-like protein; Provis	98.65
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	98.64
KOG1709		271	consensus Guanidinoacetate methyltransferase and r	98.64
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	98.61
COG3963		194	Phospholipid N-methyltransferase [Lipid metabolism	98.6
PRK14896		258	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	98.6
PF10294		173	Methyltransf_16: Putative methyltransferase; Inter	98.59
KOG1661		237	consensus Protein-L-isoaspartate(D-aspartate) O-me	98.59
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	98.58
PF05185		448	PRMT5: PRMT5 arginine-N-methyltransferase; InterPr	98.58
PRK13256		226	thiopurine S-methyltransferase; Reviewed	98.57
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	98.56
KOG1541		270	consensus Predicted protein carboxyl methylase [Ge	98.55
COG2520		341	Predicted methyltransferase [General function pred	98.54
PF09445		163	Methyltransf_15: RNA cap guanine-N2 methyltransfer	98.52
KOG3191		209	consensus Predicted N6-DNA-methyltransferase [Tran	98.5
PF05219		265	DREV: DREV methyltransferase; InterPro: IPR007884	98.49
COG0030		259	KsgA Dimethyladenosine transferase (rRNA methylati	98.49
TIGR00755		253	ksgA dimethyladenosine transferase. Alternate name	98.45
PF05724		218	TPMT: Thiopurine S-methyltransferase (TPMT); Inter	98.44
COG2265		432	TrmA SAM-dependent methyltransferases related to t	98.44
COG1041		347	Predicted DNA modification methylase [DNA replicat	98.44
PF01170		179	UPF0020: Putative RNA methylase family UPF0020; In	98.36
KOG2940		325	consensus Predicted methyltransferase [General fun	98.34
PF03291		331	Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971	98.32
TIGR02987		524	met_A_Alw26 type II restriction m6 adenine DNA met	98.28
PF05958		352	tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas	98.27
PF05430		124	Methyltransf_30: S-adenosyl-L-methionine-dependent	98.24
PRK00050		296	16S rRNA m(4)C1402 methyltranserfase; Provisional	98.21
TIGR00478		228	tly hemolysin TlyA family protein. Hemolysins are	98.21
PLN02232		160	ubiquinone biosynthesis methyltransferase	98.2
KOG1975		389	consensus mRNA cap methyltransferase [RNA processi	98.19
COG4076		252	Predicted RNA methylase [General function predicti	98.18
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	98.16
PF01728		181	FtsJ: FtsJ-like methyltransferase; InterPro: IPR00	98.15
PF02527		184	GidB: rRNA small subunit methyltransferase G; Inte	98.15
KOG3420		185	consensus Predicted RNA methylase [Translation, ri	98.12
PRK10742		250	putative methyltransferase; Provisional	98.11
KOG1499		346	consensus Protein arginine N-methyltransferase PRM	98.1
PF02384		311	N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T	98.09
PF13578		106	Methyltransf_24: Methyltransferase domain; PDB: 3S	98.09
COG0144		355	Sun tRNA and rRNA cytosine-C5-methylases [Translat	98.08
PF03059		276	NAS: Nicotianamine synthase protein; InterPro: IPR	98.07
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	98.06
KOG2361		264	consensus Predicted methyltransferase [General fun	98.03
KOG0820		315	consensus Ribosomal RNA adenine dimethylase [RNA p	97.97
KOG3178		342	consensus Hydroxyindole-O-methyltransferase and re	97.92
KOG1500		517	consensus Protein arginine N-methyltransferase CAR	97.88
PF02005		377	TRM: N2,N2-dimethylguanosine tRNA methyltransferas	97.86
PRK04148		134	hypothetical protein; Provisional	97.85
PF01861		243	DUF43: Protein of unknown function DUF43; InterPro	97.84
KOG2915		314	consensus tRNA(1-methyladenosine) methyltransferas	97.84
COG0293		205	FtsJ 23S rRNA methylase [Translation, ribosomal st	97.84
KOG0822		649	consensus Protein kinase inhibitor [Cell cycle con	97.82
PF00398		262	RrnaAD: Ribosomal RNA adenine dimethylase; InterPr	97.82
PF01739		196	CheR: CheR methyltransferase, SAM binding domain;	97.79
PF12147		311	Methyltransf_20: Putative methyltransferase; Inter	97.79
COG0357		215	GidB Predicted S-adenosylmethionine-dependent meth	97.72
PF01189		283	Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR	97.69
COG1867		380	TRM1 N2,N2-dimethylguanosine tRNA methyltransferas	97.68
PF01269		229	Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr	97.67
PF08123		205	DOT1: Histone methylation protein DOT1 ; InterPro:	97.62
COG0116		381	Predicted N6-adenine-specific DNA methylase [DNA r	97.59
PF06080		204	DUF938: Protein of unknown function (DUF938); Inte	97.58
PRK10611		287	chemotaxis methyltransferase CheR; Provisional	97.51
KOG2730		263	consensus Methylase [General function prediction o	97.45
COG1352		268	CheR Methylase of chemotaxis methyl-accepting prot	97.41
PF05148		219	Methyltransf_8: Hypothetical methyltransferase; In	97.39
PF04816		205	DUF633: Family of unknown function (DUF633) ; Inte	97.39
TIGR00006		305	S-adenosyl-methyltransferase MraW. Genetics paper	97.33
PF03141		506	Methyltransf_29: Putative S-adenosyl-L-methionine-	97.32
PRK11760		357	putative 23S rRNA C2498 ribose 2'-O-ribose methylt	97.28
COG1889		231	NOP1 Fibrillarin-like rRNA methylase [Translation,	97.28
KOG1562		337	consensus Spermidine synthase [Amino acid transpor	97.28
PF07942		270	N2227: N2227-like protein; InterPro: IPR012901 Thi	97.28
KOG3115		249	consensus Methyltransferase-like protein [General	97.23
TIGR01444		143	fkbM_fam methyltransferase, FkbM family. Members o	97.22
PF09243		274	Rsm22: Mitochondrial small ribosomal subunit Rsm22	97.16
KOG2187		534	consensus tRNA uracil-5-methyltransferase and rela	97.07
COG0500		257	SmtA SAM-dependent methyltransferases [Secondary m	97.03
COG0275		314	Predicted S-adenosylmethionine-dependent methyltra	97.02
TIGR03439		319	methyl_EasF probable methyltransferase domain, Eas	97.01
COG3897		218	Predicted methyltransferase [General function pred	96.91
COG2384		226	Predicted SAM-dependent methyltransferase [General	96.9
PF01795		310	Methyltransf_5: MraW methylase family; InterPro: I	96.88
PRK11524		284	putative methyltransferase; Provisional	96.86
KOG3987		288	consensus Uncharacterized conserved protein DREV/C	96.83
PF04445		234	SAM_MT: Putative SAM-dependent methyltransferase;	96.82
COG1189		245	Predicted rRNA methylase [Translation, ribosomal s	96.8
PF04989		206	CmcI: Cephalosporin hydroxylase; InterPro: IPR0070	96.77
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	96.76
KOG1253		525	consensus tRNA methyltransferase [Translation, rib	96.75
PF13679		141	Methyltransf_32: Methyltransferase domain	96.73
KOG3201		201	consensus Uncharacterized conserved protein [Funct	96.6
PF04672		267	Methyltransf_19: S-adenosyl methyltransferase; Int	96.59
KOG3045		325	consensus Predicted RNA methylase involved in rRNA	96.5
PF07091		251	FmrO: Ribosomal RNA methyltransferase (FmrO); PDB:	96.46
COG5459		484	Predicted rRNA methylase [Translation, ribosomal s	96.43
PTZ00357		1072	methyltransferase; Provisional	96.4
PF05971		299	Methyltransf_10: Protein of unknown function (DUF8	96.4
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	96.4
KOG2198		375	consensus tRNA cytosine-5-methylases and related e	96.32
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	96.31
PRK13699		227	putative methylase; Provisional	96.29
KOG4589		232	consensus Cell division protein FtsJ [Cell cycle c	96.25
KOG1122		460	consensus tRNA and rRNA cytosine-C5-methylase (nuc	96.24
PF06962		140	rRNA_methylase: Putative rRNA methylase; InterPro:	96.18
KOG2352		482	consensus Predicted spermine/spermidine synthase [	96.17
PF10354		166	DUF2431: Domain of unknown function (DUF2431); Int	96.1
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	96.01
cd08283		386	FDH_like_1 Glutathione-dependent formaldehyde dehy	96.0
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	95.97
COG1568		354	Predicted methyltransferases [General function pre	95.94
KOG0024		354	consensus Sorbitol dehydrogenase [Secondary metabo	95.93
PRK10309		347	galactitol-1-phosphate dehydrogenase; Provisional	95.77
TIGR03451		358	mycoS_dep_FDH mycothiol-dependent formaldehyde deh	95.75
cd00315		275	Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth	95.67
PRK05562		223	precorrin-2 dehydrogenase; Provisional	95.63
COG0286		489	HsdM Type I restriction-modification system methyl	95.54
cd08281		371	liver_ADH_like1 Zinc-dependent alcohol dehydrogena	95.51
KOG1596		317	consensus Fibrillarin and related nucleolar RNA-bi	95.41
KOG1269		364	consensus SAM-dependent methyltransferases [Lipid	95.39
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	95.15
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	95.15
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	95.1
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	95.08
PF00107		130	ADH_zinc_N: Zinc-binding dehydrogenase; InterPro:	95.07
cd08293		345	PTGR2 Prostaglandin reductase. Prostaglandins and	94.95
COG4121		252	Uncharacterized conserved protein [Function unknow	94.94
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	94.9
cd08239		339	THR_DH_like L-threonine dehydrogenase (TDH)-like.	94.78
PHA01634		156	hypothetical protein	94.78
PF03269		177	DUF268: Caenorhabditis protein of unknown function	94.76
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	94.76
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	94.69
cd05188		271	MDR Medium chain reductase/dehydrogenase (MDR)/zin	94.67
KOG4058		199	consensus Uncharacterized conserved protein [Funct	94.59
cd05278		347	FDH_like Formaldehyde dehydrogenases. Formaldehyde	94.49
PF07279		218	DUF1442: Protein of unknown function (DUF1442); In	94.45
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	94.42
cd08254		338	hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo	94.41
PF14314		675	Methyltrans_Mon: Virus-capping methyltransferase	94.4
KOG1099		294	consensus SAM-dependent methyltransferase/cell div	94.39
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	94.29
PF04378		245	RsmJ: Ribosomal RNA small subunit methyltransferas	94.27
PLN02740		381	Alcohol dehydrogenase-like	94.17
cd08294		329	leukotriene_B4_DH_like 13-PGR is a bifunctional en	94.09
COG0604		326	Qor NADPH:quinone reductase and related Zn-depende	94.09
PF11968		219	DUF3321: Putative methyltransferase (DUF3321); Int	94.06
PLN02827		378	Alcohol dehydrogenase-like	93.98
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	93.92
TIGR03201		349	dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co	93.84
KOG0821		326	consensus Predicted ribosomal RNA adenine dimethyl	93.75
cd08285		351	NADP_ADH NADP(H)-dependent alcohol dehydrogenases.	93.74
TIGR02825		325	B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15	93.72
PLN03154		348	putative allyl alcohol dehydrogenase; Provisional	93.69
cd05285		343	sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a	93.55
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.26
PF06460		299	NSP13: Coronavirus NSP13; InterPro: IPR009461 This	93.24
cd08295		338	double_bond_reductase_like Arabidopsis alkenal dou	93.24
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.23
cd08232		339	idonate-5-DH L-idonate 5-dehydrogenase. L-idonate	93.12
PLN02353		473	probable UDP-glucose 6-dehydrogenase	93.06
cd08238		410	sorbose_phosphate_red L-sorbose-1-phosphate reduct	93.06
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.01
KOG2078		495	consensus tRNA modification enzyme [RNA processing	93.0
KOG2671		421	consensus Putative RNA methylase [Replication, rec	92.93
PF01555		231	N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th	92.87
cd05279		365	Zn_ADH1 Liver alcohol dehydrogenase and related zi	92.83
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	92.83
KOG1501		636	consensus Arginine N-methyltransferase [General fu	92.78
PF01234		256	NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I	92.66
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	92.64
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	92.64
cd08233		351	butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog	92.63
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	92.63
PF05711		248	TylF: Macrocin-O-methyltransferase (TylF); InterPr	92.58
cd08286		345	FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik	92.56
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	92.48
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	92.48
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	92.46
PRK10637		457	cysG siroheme synthase; Provisional	92.45
PRK03562		621	glutathione-regulated potassium-efflux system prot	92.41
PRK08618		325	ornithine cyclodeaminase; Validated	92.4
cd01485		198	E1-1_like Ubiquitin activating enzyme (E1), repeat	92.38
KOG2798		369	consensus Putative trehalase [Carbohydrate transpo	92.36
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	92.34
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	92.27
cd08300		368	alcohol_DH_class_III class III alcohol dehydrogena	92.26
PRK15116		268	sulfur acceptor protein CsdL; Provisional	92.25
cd01491		286	Ube1_repeat1 Ubiquitin activating enzyme (E1), rep	92.2
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	92.15
COG4798		238	Predicted methyltransferase [General function pred	92.14
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	92.14
TIGR02818		368	adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr	92.04
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	92.03
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	91.97
cd08278		365	benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be	91.96
cd08237		341	ribitol-5-phosphate_DH ribitol-5-phosphate dehydro	91.96
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	91.86
PRK11524		284	putative methyltransferase; Provisional	91.85
PF00145		335	DNA_methylase: C-5 cytosine-specific DNA methylase	91.8
COG1062		366	AdhC Zn-dependent alcohol dehydrogenases, class II	91.72
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	91.64
cd08277		365	liver_alcohol_DH_like Liver alcohol dehydrogenase.	91.63
PRK10669		558	putative cation:proton antiport protein; Provision	91.62
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	91.58
PRK03659		601	glutathione-regulated potassium-efflux system prot	91.57
COG1565		370	Uncharacterized conserved protein [Function unknow	91.43
cd08236		343	sugar_DH NAD(P)-dependent sugar dehydrogenases. Th	91.24
cd08301		369	alcohol_DH_plants Plant alcohol dehydrogenase. NAD	91.16
COG2961		279	ComJ Protein involved in catabolism of external DN	91.16
cd08234		334	threonine_DH_like L-threonine dehydrogenase. L-thr	91.14
PF10237		162	N6-adenineMlase: Probable N6-adenine methyltransfe	91.09
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	91.05
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	91.01
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	90.96
PF11599		246	AviRa: RRNA methyltransferase AviRa; InterPro: IPR	90.85
PF12692		160	Methyltransf_17: S-adenosyl-L-methionine methyltra	90.79
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	90.73
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	90.72
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	90.72
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	90.68
TIGR02819		393	fdhA_non_GSH formaldehyde dehydrogenase, glutathio	90.61
KOG2015		422	consensus NEDD8-activating complex, catalytic comp	90.53
TIGR00497		501	hsdM type I restriction system adenine methylase (	90.51
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	90.49
PF02636		252	Methyltransf_28: Putative S-adenosyl-L-methionine-	90.48
PRK09496		453	trkA potassium transporter peripheral membrane com	90.44
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	90.44
PRK08328		231	hypothetical protein; Provisional	90.43
COG1179		263	Dinucleotide-utilizing enzymes involved in molybdo	90.32
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	90.15
PRK06719		157	precorrin-2 dehydrogenase; Validated	90.07
cd05288		329	PGDH Prostaglandin dehydrogenases. Prostaglandins	90.02
TIGR00675		315	dcm DNA-methyltransferase (dcm). All proteins in t	89.95
PF03141		506	Methyltransf_29: Putative S-adenosyl-L-methionine-	89.92
cd08261		337	Zn_ADH7 Alcohol dehydrogenases of the MDR family.	89.88
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	89.88
PRK10083		339	putative oxidoreductase; Provisional	89.79
PLN02586		360	probable cinnamyl alcohol dehydrogenase	89.73
TIGR02822		329	adh_fam_2 zinc-binding alcohol dehydrogenase famil	89.68
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	89.59
cd08240		350	6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy	89.52
cd01493		425	APPBP1_RUB Ubiquitin activating enzyme (E1) subuni	89.51
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	89.51
COG0677		436	WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas	89.5
cd08263		367	Zn_ADH10 Alcohol dehydrogenases of the MDR family.	89.49
PTZ00117		319	malate dehydrogenase; Provisional	89.49
PF11899		380	DUF3419: Protein of unknown function (DUF3419); In	89.45
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	89.35
KOG2793		248	consensus Putative N2,N2-dimethylguanosine tRNA me	89.33
PF02719		293	Polysacc_synt_2: Polysaccharide biosynthesis prote	88.99
cd05281		341	TDH Threonine dehydrogenase. L-threonine dehydroge	88.94
TIGR02371		325	ala_DH_arch alanine dehydrogenase, Archaeoglobus f	88.89
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	88.88
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	88.53
PRK13699		227	putative methylase; Provisional	88.45
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	88.42
PTZ00082		321	L-lactate dehydrogenase; Provisional	88.42
TIGR00692		340	tdh L-threonine 3-dehydrogenase. E. coli His-90 mo	88.27
cd08265		384	Zn_ADH3 Alcohol dehydrogenases of the MDR family.	88.1
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	88.02
PRK06223		307	malate dehydrogenase; Reviewed	87.95
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	87.92
TIGR01408		1008	Ube1 ubiquitin-activating enzyme E1. This model re	87.87
cd08255		277	2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_	87.8
KOG1331		293	consensus Predicted methyltransferase [General fun	87.73
cd08287		345	FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik	87.51
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	87.48
cd08296		333	CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci	87.47
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	87.46
PRK05396		341	tdh L-threonine 3-dehydrogenase; Validated	87.45
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	87.38
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	87.2
cd08231		361	MDR_TM0436_like Hypothetical enzyme TM0436 resembl	87.08
COG0270		328	Dcm Site-specific DNA methylase [DNA replication,	87.0
PRK06141		314	ornithine cyclodeaminase; Validated	86.99
PRK11730		715	fadB multifunctional fatty acid oxidation complex	86.77
TIGR03693		637	ocin_ThiF_like putative thiazole-containing bacter	86.74
COG1086		588	Predicted nucleoside-diphosphate sugar epimerases	86.7
cd01488		291	Uba3_RUB Ubiquitin activating enzyme (E1) subunit	86.69
COG0569		225	TrkA K+ transport systems, NAD-binding component [	86.64
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	86.56
PRK07102		243	short chain dehydrogenase; Provisional	86.47
PRK09496		453	trkA potassium transporter peripheral membrane com	86.46
cd08243		320	quinone_oxidoreductase_like_1 Quinone oxidoreducta	86.39
PF06859		110	Bin3: Bicoid-interacting protein 3 (Bin3); InterPr	86.13
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	86.1
PRK07417		279	arogenate dehydrogenase; Reviewed	86.09
PRK09422		338	ethanol-active dehydrogenase/acetaldehyde-active r	86.08
cd08284		344	FDH_like_2 Glutathione-dependent formaldehyde dehy	86.05
PRK06949		258	short chain dehydrogenase; Provisional	86.02
cd08252		336	AL_MDR Arginate lyase and other MDR family members	85.91
PRK07340		304	ornithine cyclodeaminase; Validated	85.89
PLN02702		364	L-idonate 5-dehydrogenase	85.83
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	85.71
PRK10458		467	DNA cytosine methylase; Provisional	85.7
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	85.5
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	85.46
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	85.2
cd08245		330	CAD Cinnamyl alcohol dehydrogenases (CAD) and rela	85.07
COG5379		414	BtaA S-adenosylmethionine:diacylglycerol 3-amino-3	85.01
PF00072		112	Response_reg: Response regulator receiver domain;	84.92
PLN00016		378	RNA-binding protein; Provisional	84.77
cd08235		343	iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ	84.73
PRK05225		487	ketol-acid reductoisomerase; Validated	84.71
cd08297		341	CAD3 Cinnamyl alcohol dehydrogenases (CAD). These	84.66
PF11312		315	DUF3115: Protein of unknown function (DUF3115); In	84.63
PRK08267		260	short chain dehydrogenase; Provisional	84.49
cd08279		363	Zn_ADH_class_III Class III alcohol dehydrogenase.	84.34
PRK07523		255	gluconate 5-dehydrogenase; Provisional	84.3
cd08262		341	Zn_ADH8 Alcohol dehydrogenases of the MDR family.	84.26
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	83.99
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	83.89
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	83.81
KOG1098		780	consensus Putative SAM-dependent rRNA methyltransf	83.77
PRK06194		287	hypothetical protein; Provisional	83.72
KOG0022		375	consensus Alcohol dehydrogenase, class III [Second	83.67
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	83.62
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	83.52
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	83.42
PRK08306		296	dipicolinate synthase subunit A; Reviewed	83.36
PRK08213		259	gluconate 5-dehydrogenase; Provisional	83.36
cd05284		340	arabinose_DH_like D-arabinose dehydrogenase. This	83.28
cd08282		375	PFDH_like Pseudomonas putida aldehyde-dismutating	83.0
PRK08300		302	acetaldehyde dehydrogenase; Validated	82.95
PRK08507		275	prephenate dehydrogenase; Validated	82.91
PF11899		380	DUF3419: Protein of unknown function (DUF3419); In	82.87
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	82.86
cd08299		373	alcohol_DH_class_I_II_IV class I, II, IV alcohol d	82.84
TIGR00027		260	mthyl_TIGR00027 methyltransferase, putative, TIGR0	82.81
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	82.71

>PLN02366 spermidine synthase	Back alignment and domain information

Probab=100.00  E-value=7.2e-63  Score=453.59  Aligned_cols=282  Identities=65%  Similarity=1.173  Sum_probs=251.8

Q ss_pred             CCCCceEeeeeceEEEEeeCCcccEEEEEecCCceEEEEcCeeeccCcchhhHHHHHHhhcccCCCCCCeEEEEeccccH
Q 037807            2 YLAGQAHFLEVEKIIFQGKSEYQNMMVFQSSSYGKVFVLDGALQLTEKDECAYQEMITHLPLCSIPNPKKVLLIGGGDGG   81 (299)
Q Consensus         2 ~~~~~~~~~~~~~~l~~~~s~~q~i~v~e~~~~g~~l~ldg~~q~~~~de~~Y~e~l~~~~l~~~~~~~~VL~IG~G~G~   81 (299)
                      .|++.+++++++++|++++|+||+|+|++++.+|++|+|||.+|++++||+.|||||+|+|++.|+++++||+||||+|+
T Consensus        25 ~~~~~~~~~~v~~~l~~~~s~yQ~i~v~~~~~~g~~L~lDg~~q~~~~de~~Y~e~l~h~~l~~~~~pkrVLiIGgG~G~  104 (308)
T PLN02366         25 MWPGEAHSLKVEKVLFQGKSDFQDVLVFESATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVVGGGDGG  104 (308)
T ss_pred             CCCCceEEEEEeeEEEeccCCCeeEEEEEcCCCceEEEECCEeeecCccHHHHHHHHHHHHHhhCCCCCeEEEEcCCccH
Confidence            47889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCccEEEEEECCHHHHHHHHhhchhhhcCCCCCCEEEEEccHHHHHHhcCCCCccEEEEcCCCCCCCCCCCC
Q 037807           82 ILREISRHASVEQIHICEIDTMLINVYKEYFPEIAIGYEDSRVILHVCDGSEYLKTVQSGTFDAIIIDAFDPIRPGHDLF  161 (299)
Q Consensus        82 ~~~~l~~~~~~~~v~~VEid~~vi~~a~~~~~~~~~~~~~~rv~v~~~D~~~~l~~~~~~~fDvIi~D~~~~~~~~~~l~  161 (299)
                      +++++++++++.+|++||||++|++.||++|+..+.+++++|++++++|+++|+++.++++||+||+|+++|.+++..|+
T Consensus       105 ~~rellk~~~v~~V~~VEiD~~Vi~~ar~~f~~~~~~~~dpRv~vi~~Da~~~l~~~~~~~yDvIi~D~~dp~~~~~~L~  184 (308)
T PLN02366        105 VLREIARHSSVEQIDICEIDKMVIDVSKKFFPDLAVGFDDPRVNLHIGDGVEFLKNAPEGTYDAIIVDSSDPVGPAQELF  184 (308)
T ss_pred             HHHHHHhCCCCCeEEEEECCHHHHHHHHHhhhhhccccCCCceEEEEChHHHHHhhccCCCCCEEEEcCCCCCCchhhhh
Confidence            99999999888999999999999999999998765567899999999999999986545789999999999998888999


Q ss_pred             cHHHHHHHHHhcCCCcEEEEecCCcccchHHHHHHHHHHhhhcCCceeeeEEeecccCCcceeEEecccCCCCCCCCCCC
Q 037807          162 EGPFFELVAKALRPGGAMCIQAESLWFQQFSVQHLIDDCHRIFKGSASYAWTTVPTYPSGVIGFMLCSTESEGPSVDFIH  241 (299)
Q Consensus       162 t~ef~~~~~~~LkpgGvlv~~~~s~~~~~~~~~~~~~~l~~~F~~~v~~~~~~vP~~~~g~w~~~~ask~~~~~~~~~~~  241 (299)
                      +.+||+.++++|+|||++++|++++|...+.++.+.++++++|++.+.++.+.||+|++|.|||++|||  +.+..++.+
T Consensus       185 t~ef~~~~~~~L~pgGvlv~q~~s~~~~~~~~~~i~~tl~~~F~~~v~~~~~~vPsy~~g~w~f~~as~--~~~~~~~~~  262 (308)
T PLN02366        185 EKPFFESVARALRPGGVVCTQAESMWLHMDLIEDLIAICRETFKGSVNYAWTTVPTYPSGVIGFVLCSK--EGPAVDFKH  262 (308)
T ss_pred             HHHHHHHHHHhcCCCcEEEECcCCcccchHHHHHHHHHHHHHCCCceeEEEecCCCcCCCceEEEEEEC--CCccccccc
Confidence            999999999999999999999999999999999999999999966788888999999999999999999  433333445


Q ss_pred             CCCCCCccccccCCCCCCeeeCHHHHHHHHhcccHHHHHhhcccC
Q 037807          242 PINPIDPDQIFGVAKGPLKFYNSAEVHAAAFCLPTFAKKPAHSHI  286 (299)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~yy~~~~~h~~~f~lp~~~~~~l~~~~  286 (299)
                      |.+..+.....+....+|||||+ ++|+++|+||+|+++.|+...
T Consensus       263 ~~~~~~~~~~~~~~~~~l~yy~~-~~h~~~f~lp~~~~~~l~~~~  306 (308)
T PLN02366        263 PVNPIDKLEGAGKAKRPLKFYNS-EVHRAAFCLPSFAKRELESLL  306 (308)
T ss_pred             cccccchhhhhhcccCCCeEECH-HHHHHHhcChHHHHHHHHhcc
Confidence            54443321111122356999999 999999999999999998654

>PRK00536 speE spermidine synthase; Provisional	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only]	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>COG2521 Predicted archaeal methyltransferase [General function prediction only]	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only]	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>TIGR00095 RNA methyltransferase, RsmD family	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>KOG1271 consensus Methyltransferases [General function prediction only]	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>KOG4300 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>KOG2899 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU	Back alignment and domain information

>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB	Back alignment and domain information

>KOG3010 consensus Methyltransferase [General function prediction only]	Back alignment and domain information

>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>TIGR03438 probable methyltransferase	Back alignment and domain information

>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family	Back alignment and domain information

>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PTZ00338 dimethyladenosine transferase-like protein; Provisional	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>COG3963 Phospholipid N-methyltransferase [Lipid metabolism]	Back alignment and domain information

>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional	Back alignment and domain information

>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases	Back alignment and domain information

>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase []	Back alignment and domain information

>PRK13256 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only]	Back alignment and domain information

>COG2520 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ]

Back alignment and domain information

>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes	Back alignment and domain information

>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00755 ksgA dimethyladenosine transferase	Back alignment and domain information

>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase	Back alignment and domain information

>KOG2940 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes	Back alignment and domain information

>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family	Back alignment and domain information

>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2	Back alignment and domain information

>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function	Back alignment and domain information

>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional	Back alignment and domain information

>TIGR00478 tly hemolysin TlyA family protein	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification]	Back alignment and domain information

>COG4076 Predicted RNA methylase [General function prediction only]	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes	Back alignment and domain information

>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G	Back alignment and domain information

>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10742 putative methyltransferase; Provisional	Back alignment and domain information

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2	Back alignment and domain information

>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D	Back alignment and domain information

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>KOG2361 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification]	Back alignment and domain information

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription]	Back alignment and domain information

>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised	Back alignment and domain information

>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e	Back alignment and domain information

>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length	Back alignment and domain information

>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins	Back alignment and domain information

>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ]	Back alignment and domain information

>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 []	Back alignment and domain information

>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes	Back alignment and domain information

>PRK10611 chemotaxis methyltransferase CheR; Provisional	Back alignment and domain information

>KOG2730 consensus Methylase [General function prediction only]	Back alignment and domain information

>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms]	Back alignment and domain information

>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases	Back alignment and domain information

>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins	Back alignment and domain information

>TIGR00006 S-adenosyl-methyltransferase MraW	Back alignment and domain information

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases	Back alignment and domain information

>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional	Back alignment and domain information

>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT)	Back alignment and domain information

>KOG3115 consensus Methyltransferase-like protein [General function prediction only]	Back alignment and domain information

>TIGR01444 fkbM_fam methyltransferase, FkbM family	Back alignment and domain information

>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family	Back alignment and domain information

>COG3897 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only]	Back alignment and domain information

>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown]	Back alignment and domain information

>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised	Back alignment and domain information

>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) []	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF13679 Methyltransf_32: Methyltransferase domain	Back alignment and domain information

>KOG3201 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins	Back alignment and domain information

>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification]	Back alignment and domain information

>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A	Back alignment and domain information

>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00357 methyltransferase; Provisional	Back alignment and domain information

>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>PRK13699 putative methylase; Provisional	Back alignment and domain information

>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification]	Back alignment and domain information

>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases	Back alignment and domain information

>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>COG1568 Predicted methyltransferases [General function prediction only]	Back alignment and domain information

>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase	Back alignment and domain information

>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms]	Back alignment and domain information

>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase)	Back alignment and domain information

>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1	Back alignment and domain information

>cd08293 PTGR2 Prostaglandin reductase	Back alignment and domain information

>COG4121 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>PHA01634 hypothetical protein	Back alignment and domain information

>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>KOG4058 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd05278 FDH_like Formaldehyde dehydrogenases	Back alignment and domain information

>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members	Back alignment and domain information

>PF14314 Methyltrans_Mon: Virus-capping methyltransferase	Back alignment and domain information

>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted	Back alignment and domain information

>PLN02740 Alcohol dehydrogenase-like	Back alignment and domain information

>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity	Back alignment and domain information

>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]	Back alignment and domain information

>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein	Back alignment and domain information

>PLN02827 Alcohol dehydrogenase-like	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase	Back alignment and domain information

>KOG0821 consensus Predicted ribosomal RNA adenine dimethylase [RNA processing and modification]	Back alignment and domain information

>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases	Back alignment and domain information

>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase	Back alignment and domain information

>PLN03154 putative allyl alcohol dehydrogenase; Provisional	Back alignment and domain information

>cd05285 sorbitol_DH Sorbitol dehydrogenase	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein	Back alignment and domain information

>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08232 idonate-5-DH L-idonate 5-dehydrogenase	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>KOG2078 consensus tRNA modification enzyme [RNA processing and modification]	Back alignment and domain information

>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair]	Back alignment and domain information

>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases	Back alignment and domain information

>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>KOG1501 consensus Arginine N-methyltransferase [General function prediction only]	Back alignment and domain information

>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PF05711 TylF: Macrocin-O-methyltransferase (TylF); InterPro: IPR008884 This family consists of bacterial macrocin O-methyltransferase (TylF) proteins	Back alignment and domain information

>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>PRK10637 cysG siroheme synthase; Provisional	Back alignment and domain information

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>COG4798 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase	Back alignment and domain information

>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2	Back alignment and domain information

>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>COG1565 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases	Back alignment and domain information

>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase	Back alignment and domain information

>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only]	Back alignment and domain information

>cd08234 threonine_DH_like L-threonine dehydrogenase	Back alignment and domain information

>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes	Back alignment and domain information

>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent	Back alignment and domain information

>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00497 hsdM type I restriction system adenine methylase (hsdM)	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>cd05288 PGDH Prostaglandin dehydrogenases	Back alignment and domain information

>TIGR00675 dcm DNA-methyltransferase (dcm)	Back alignment and domain information

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases	Back alignment and domain information

>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>PRK10083 putative oxidoreductase; Provisional	Back alignment and domain information

>PLN02586 probable cinnamyl alcohol dehydrogenase	Back alignment and domain information

>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase	Back alignment and domain information

>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification]	Back alignment and domain information

>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases	Back alignment and domain information

>cd05281 TDH Threonine dehydrogenase	Back alignment and domain information

>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>PRK13699 putative methylase; Provisional	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>TIGR00692 tdh L-threonine 3-dehydrogenase	Back alignment and domain information

>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>TIGR01408 Ube1 ubiquitin-activating enzyme E1	Back alignment and domain information

>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members	Back alignment and domain information

>KOG1331 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PRK05396 tdh L-threonine 3-dehydrogenase; Validated	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH)	Back alignment and domain information

>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein	Back alignment and domain information

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR)	Back alignment and domain information

>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3)	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional	Back alignment and domain information

>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd08252 AL_MDR Arginate lyase and other MDR family members	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PLN02702 L-idonate 5-dehydrogenase	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PRK10458 DNA cytosine methylase; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins	Back alignment and domain information

>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism]	Back alignment and domain information

>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase	Back alignment and domain information

>PRK05225 ketol-acid reductoisomerase; Validated	Back alignment and domain information

>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>PF11312 DUF3115: Protein of unknown function (DUF3115); InterPro: IPR021463 This eukaryotic family of proteins has no known function	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd05284 arabinose_DH_like D-arabinose dehydrogenase	Back alignment and domain information

>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH)	Back alignment and domain information

>PRK08300 acetaldehyde dehydrogenase; Validated	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases	Back alignment and domain information

>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		299
1xj5_A		334	X-Ray Structure Of Spermidine Synthase From Arabido		4e-96
3rw9_A		304	Crystal Structure Of Human Spermidine Synthase In C		6e-59
2o05_A		304	Human Spermidine Synthase Length = 304		7e-59
2pss_A		321	The Structure Of Plasmodium Falciparum Spermidine S		4e-52
2hte_A		283	The Crystal Structure Of Spermidine Synthase From P		5e-52
2pwp_A		282	Crystal Structure Of Spermidine Synthase From Plasm		5e-52
2b2c_A		314	Cloning, Expression, Characterisation And Three- Di		4e-51
3bwb_A		304	Crystal Structure Of The Apo Form Of Spermidine Syn		4e-39
1jq3_A		296	Crystal Structure Of Spermidine Synthase In Complex		5e-33
3o4f_A		294	Crystal Structure Of Spermidine Synthase From E. Co		5e-30
1iy9_A		275	Crystal Structure Of Spermidine Synthase Length = 2		2e-29
3anx_A		314	Crystal Structure Of TriamineAGMATINE AMINOPROPYLTR		5e-23
1uir_A		314	Crystal Structure Of Polyamine Aminopropyltransfeas		2e-22
1mjf_A		281	Putative Spermidine Synthetase From Pyrococcus Furi		3e-13
2e5w_A		280	Crystal Structure Of Spermidine Synthase From Pyroc		2e-11

>pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 Length = 334