Citrus Sinensis ID: 037989


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MAAQAESSAKVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAPVTTTSAPESEPVQVANQSVTNHTTTTIMETAKTTLPDEVITKENDKKISETLPQNGHDQDNHSVSNQTSTTTSSAEAISTTTTNNVNRPAETSSHDHLHKKANDHLIPEKKSGVANHDHPPVVSEIKTPRTPDSSSRKSFASIVHALKDNSSPFQNKVPPPNLKKGSNTTQSSADPFSNNALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYVEQKKGKLNCLRRL
ccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHccccccEEEcccccccccEEcHHHHHHHHHcccccccEEEEEEEEEEEEcccccEEEEEEEEEEccccccEEEEEEEEcccccEEEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEEccccccccEEEEEEccHHHHHHHHHHcccEEccEEEEEEEccccccccccc
ccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccEEEcccccccccEEccHHHHHHHHHHccccccEEEEEEEcccccccccEEEEEEEEEccccccEEEEEEEEEEEEccEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHcccccccEEEEccccccccEEEEEEccHHHHHHHHHcccEEEccEEEEEEEEcccccccccc
maaqaessakvdpqlvgnSFVEQYFKALHQYPEHlhrfyqdssflsrpgpdgvmtSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGymsgktgkrrfsqsfflapqengffvLNDIFrfvdddlsvgmvmpindvdktaapvtttsapesepvqvanqsvtnHTTTTIMETakttlpdevitkeNDKKIsetlpqnghdqdnhsvsnqtstttsSAEAISTtttnnvnrpaetsshdhlhkkandhlipekksgvanhdhppvvseiktprtpdsssrkSFASIVHALKdnsspfqnkvpppnlkkgsnttqssadpfsnnalrnniddqaaknpvifvanlpmdvtaDQIKSVFVkfgpikangirirtnqlrpncfsfvEFESISSMQNAlkaspitfgdrKVYVEQkkgklnclrrl
maaqaessakvdpqlvgNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAPVTTtsapesepvqvanqsvtnhTTTTImetakttlpdeviTKENDKKISETlpqnghdqdnhsvsnQTSTTTSSAEAISttttnnvnrpaetssHDHLHKKANDHLIPEKksgvanhdhppvvseiktprtpdsssRKSFASIVHALkdnsspfqnkvpppnlkkgsnttQSSADPFSNNALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKAngirirtnqlrpNCFSFVEFESISSMQNALKaspitfgdrkvyveqkkgklnclrrl
MAAQAESSAKVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAPVTTTSAPESEPVQVANQSVTNHttttimetakttLPDEVITKENDKKISETLPQNGHDQDNHSVSNQtstttssaeaisttttNNVNRPAETSSHDHLHKKANDHLIPEKKSGVANHDHPPVVSEIKTPRTPDSSSRKSFASIVHALKDNSSPFQNKVPPPNLKKGSNTTQSSADPFSNNALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYVEQKKGKLNCLRRL
**************LVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSR**PDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDV*****************************************************************************************************************************************************************************************************KNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYVE************
*************QLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLS******************************************************************************************************************************************************************************************************************VIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYV*************
************PQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAP**************ANQSVTNHTTTTIMETAKTTLPDEVITKENDKKISETLPQ***************************TTNNVN************KKANDHLIPEKKSGVANHDHPPVVSEI************SFASIVHALKDNSSPFQNKVPPPNL**********ADPFSNNALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYVEQKKGKLNCLRRL
*********KVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDD*****************************************************************************************************************************************************************************************************************KNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYVEQKKG********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAQAESSAKVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAPVTTTSAPESEPVQVANQSVTNHTTTTIMETAKTTLPDEVITKENDKKISETLPQNGHDQDNHSVSNQTSTTTSSAEAISTTTTNNVNRPAETSSHDHLHKKANDHLIPEKKSGVANHDHPPVVSEIKTPRTPDSSSRKSFASIVHALKDNSSPFQNKVPPPNLKKGSNTTQSSADPFSNNALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKASPITFGDRKVYVEQKKGKLNCLRRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query432 2.2.26 [Sep-21-2011]
O94260434 Putative G3BP-like protei yes no 0.824 0.820 0.255 5e-22
P97855465 Ras GTPase-activating pro yes no 0.289 0.268 0.409 6e-18
Q32LC7465 Ras GTPase-activating pro yes no 0.289 0.268 0.409 1e-17
Q13283466 Ras GTPase-activating pro yes no 0.289 0.268 0.409 2e-17
Q5RB87466 Ras GTPase-activating pro yes no 0.289 0.268 0.409 2e-17
P97379482 Ras GTPase-activating pro no no 0.289 0.259 0.386 6e-17
Q5R9L3482 Ras GTPase-activating pro no no 0.289 0.259 0.386 7e-17
Q9UN86482 Ras GTPase-activating pro no no 0.289 0.259 0.386 7e-17
Q9C7F5126 Nuclear transport factor no no 0.270 0.928 0.349 2e-08
Q75AA5125 Nuclear transport factor yes no 0.266 0.92 0.325 1e-07
>sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 117/458 (25%), Positives = 194/458 (42%), Gaps = 102/458 (22%)

Query: 5   AESSAKVDPQL----VGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSIT-T 59
           AE++  ++P L    +G  FV++Y+  L++ P  LH FY   S L   G +G   S+   
Sbjct: 3   AENATLLEPVLGKDEIGWMFVQEYYTYLNKEPNRLHCFYTKKSTLIH-GDEGESISLCHG 61

Query: 60  MKEINDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGK--RRFSQSFFLAP 117
            +EI+++IL LD+QN +  I  VD+ AS   G+++ V G MS K GK  R+F+Q+FFLA 
Sbjct: 62  QQEIHNKILDLDFQNCKVLISNVDSLASSNGGIVIQVLGEMSNK-GKLSRKFAQTFFLAE 120

Query: 118 QENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAPVTTT-------------SAPESEP 164
           Q NG+FVLNDIFRF+ +D+      P + V+K    V +              SA E   
Sbjct: 121 QPNGYFVLNDIFRFLREDVEEEEESP-DAVEKEKKDVASEPYVNGVQSQEHLPSAKEEGH 179

Query: 165 VQVANQSVTNHTTTTI-------METAKTTLPDEVITKENDKKISETLPQNGHDQDNHSV 217
            Q    +  N  T  +       +  A   +P+E + +  +  +   + Q    Q+N   
Sbjct: 180 YQDPAATENNFATAALISNETDSLNQATLAVPEEPVIQVTEASVPSFVSQ----QENQLQ 235

Query: 218 SNQTSTTTSSAEAISTTTTNNVNRPAETSSHDHLHKKANDHLIPEKKSGVANHDHPPVVS 277
               ++ + +A+AI  +                    AN    P+  + +   +HP V S
Sbjct: 236 DEALTSNSKNADAIGAS-------------------DANVATAPKSWADLIARNHPDVKS 276

Query: 278 EIKTPRTPDSSSRKSFASIVHALKDNSSPFQNKVPPPNLKKGSNT--TQSSADPF--SNN 333
           +     T  ++ +                           KG N   TQ    P+  SN 
Sbjct: 277 QASVSSTASTTGQTV-------------------------KGVNADQTQQPTAPYTQSNE 311

Query: 334 ALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCFSFV 393
            L  ++          FV N+P + +   +KS    FGP+KA     R         ++V
Sbjct: 312 LLETSV----------FVKNIPPETSDVSLKSAMSIFGPVKAIEFARRKGT------AYV 355

Query: 394 EFESISSMQNALKASPITFGDRKVYVEQKK----GKLN 427
           +F +   +Q AL    +   +  + +E+++    GK N
Sbjct: 356 DFVNHECVQLALNKKTLQINNATLNIEERRRLFSGKFN 393




Probable scaffold protein that may be involved in mRNA transport.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|P97855|G3BP1_MOUSE Ras GTPase-activating protein-binding protein 1 OS=Mus musculus GN=G3bp1 PE=1 SV=1 Back     alignment and function description
>sp|Q32LC7|G3BP1_BOVIN Ras GTPase-activating protein-binding protein 1 OS=Bos taurus GN=G3BP PE=2 SV=1 Back     alignment and function description
>sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens GN=G3BP1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RB87|G3BP1_PONAB Ras GTPase-activating protein-binding protein 1 OS=Pongo abelii GN=G3BP1 PE=2 SV=1 Back     alignment and function description
>sp|P97379|G3BP2_MOUSE Ras GTPase-activating protein-binding protein 2 OS=Mus musculus GN=G3bp2 PE=1 SV=2 Back     alignment and function description
>sp|Q5R9L3|G3BP2_PONAB Ras GTPase-activating protein-binding protein 2 OS=Pongo abelii GN=G3BP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9UN86|G3BP2_HUMAN Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens GN=G3BP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9C7F5|NTF2_ARATH Nuclear transport factor 2 OS=Arabidopsis thaliana GN=NTF2 PE=2 SV=1 Back     alignment and function description
>sp|Q75AA5|NTF2_ASHGO Nuclear transport factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTF2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
356521632454 PREDICTED: LOW QUALITY PROTEIN: putative 0.826 0.786 0.389 2e-69
356577025465 PREDICTED: putative G3BP-like protein-li 0.842 0.782 0.397 1e-68
225423458486 PREDICTED: ras GTPase-activating protein 0.925 0.823 0.395 5e-66
388509658468 unknown [Medicago truncatula] 0.851 0.786 0.390 6e-66
255542010493 RNA binding protein, putative [Ricinus c 0.875 0.766 0.372 1e-65
297738096484 unnamed protein product [Vitis vinifera] 0.921 0.822 0.395 7e-65
357475049455 Ras GTPase-activating protein-binding pr 0.847 0.804 0.390 1e-64
224108876486 predicted protein [Populus trichocarpa] 0.916 0.814 0.362 1e-64
224101451454 predicted protein [Populus trichocarpa] 0.856 0.814 0.363 9e-63
118481830454 unknown [Populus trichocarpa] 0.856 0.814 0.363 9e-63
>gi|356521632|ref|XP_003529458.1| PREDICTED: LOW QUALITY PROTEIN: putative G3BP-like protein-like [Glycine max] Back     alignment and taxonomy information
 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 163/418 (38%), Positives = 240/418 (57%), Gaps = 61/418 (14%)

Query: 13  PQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDY 72
           PQ VGN+FVEQY+  LHQ P+ +HRFY +SS LSRP  DG MT +TT  EIN +ILSLDY
Sbjct: 10  PQTVGNAFVEQYYSILHQKPDQVHRFYHESSILSRPEEDGTMTMVTTTLEINKKILSLDY 69

Query: 73  QNYQTEILTVDAQASYCKGVLVLVTGYMSGKTG-KRRFSQSFFLAPQENGFFVLNDIFRF 131
            +++ EIL+ DAQ SY  GV+V+VTG ++G    KR+F+QSFFLAPQ+ G+FVLND+FR+
Sbjct: 70  TSFRVEILSADAQPSYKDGVIVVVTGCLTGSDNLKRKFTQSFFLAPQDKGYFVLNDVFRY 129

Query: 132 VDDDLSVGM-VMPINDVDKTAAPVTTTSAPESEPVQVANQSVTNHTTTTIMETAKTTLPD 190
           VD+  SV +  +P ND    +AP T    PE E + VA     + T     +   +    
Sbjct: 130 VDEYKSVDIESVPANDAADESAP-TDAFVPEPEAIHVAEDVPASQTDVVDADIGVS---- 184

Query: 191 EVITKENDKKISETLPQNGHDQDNHSVSNQTSTTTSSAEAISTTTTNNVNRPAETSSHDH 250
                   K++S+ L +NG    N SV+ +                ++V   +    H H
Sbjct: 185 --------KEVSQPL-ENG----NLSVTEK------------VVPVDHVKECSHQEHHSH 219

Query: 251 LHKKANDHLIPEKKSGVANHDHPPVVSEIKTPRTPDSSSRKSFASIVHALKDNSSPFQNK 310
             K A+++ +                         + + +KSFASIV+ALK+N++PF  +
Sbjct: 220 AEKAASNNSL-------------------------EDTPKKSFASIVNALKENAAPFHVR 254

Query: 311 VPPPNL---KKGSNTTQSSADPFSNNALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVF 367
           V P  L    + S+     A   S ++     ++   K   IFVANLPM+ T +Q++ VF
Sbjct: 255 VSPVKLLEQPRVSSIPAPEAPAPSTDSPPEKNNEIGGKAYAIFVANLPMNATVEQLERVF 314

Query: 368 VKFGPIKANGIRIRTNQLRPNCFSFVEFESISSMQNALKAS-PITFGDRKVYVEQKKG 424
            KFGPIK +GI++R+N+ + +CF FVEFES +SMQ+AL+AS P+T   R++ +E+++ 
Sbjct: 315 QKFGPIKRDGIQVRSNKQQQSCFGFVEFESATSMQSALEASPPVTLDGRRLSIEERRA 372




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356577025|ref|XP_003556630.1| PREDICTED: putative G3BP-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|225423458|ref|XP_002273995.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|388509658|gb|AFK42895.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542010|ref|XP_002512069.1| RNA binding protein, putative [Ricinus communis] gi|223549249|gb|EEF50738.1| RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297738096|emb|CBI27297.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475049|ref|XP_003607810.1| Ras GTPase-activating protein-binding protein [Medicago truncatula] gi|355508865|gb|AES90007.1| Ras GTPase-activating protein-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224108876|ref|XP_002315000.1| predicted protein [Populus trichocarpa] gi|222864040|gb|EEF01171.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101451|ref|XP_002312286.1| predicted protein [Populus trichocarpa] gi|222852106|gb|EEE89653.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118481830|gb|ABK92852.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
TAIR|locus:2173567460 AT5G60980 [Arabidopsis thalian 0.386 0.363 0.5 2e-61
TAIR|locus:2026423427 AT1G69250 [Arabidopsis thalian 0.428 0.433 0.342 2.8e-42
TAIR|locus:2152566458 AT5G48650 [Arabidopsis thalian 0.312 0.294 0.467 5.4e-40
TAIR|locus:2023854428 AT1G13730 [Arabidopsis thalian 0.365 0.369 0.477 1.9e-35
TAIR|locus:2172472450 AT5G43960 [Arabidopsis thalian 0.268 0.257 0.396 5.4e-32
TAIR|locus:2098555 1294 AT3G07250 [Arabidopsis thalian 0.335 0.112 0.394 9.7e-30
UNIPROTKB|I3LPH5448 G3BP2 "Uncharacterized protein 0.370 0.357 0.341 2.2e-24
UNIPROTKB|Q9UN86482 G3BP2 "Ras GTPase-activating p 0.289 0.259 0.386 3.1e-24
UNIPROTKB|F6XCI1490 G3BP2 "Uncharacterized protein 0.289 0.255 0.386 3.5e-24
MGI|MGI:1351465465 G3bp1 "GTPase activating prote 0.358 0.333 0.361 5.2e-24
TAIR|locus:2173567 AT5G60980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 415 (151.1 bits), Expect = 2.0e-61, Sum P(2) = 2.0e-61
 Identities = 88/176 (50%), Positives = 119/176 (67%)

Query:     3 AQAESSAKVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKE 62
             AQ E+S     ++VG +FVEQY+  LHQ P  +HRFYQDSSFL+RP   G +T++TTM+ 
Sbjct:     2 AQQEASPSPGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSFLTRPDVTGAVTTVTTMQA 61

Query:    63 INDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTG-KRRFSQSFFLAPQENG 121
             IND+ILSL Y++Y  EI T DAQ S+ +GV+VLVTG ++G    +++FSQSFFLAPQ+ G
Sbjct:    62 INDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQSFFLAPQDKG 121

Query:   122 FFVLNDIFRFVDDDLSVGMV--MPIN----DVDKTAAP--VTTTSAPESEPVQVAN 169
             +FVLND+FRF+++         +PIN    DV     P  V  +  PE EP  VA+
Sbjct:   122 YFVLNDVFRFLEEKEVTAQARSVPINGTTRDVQAPIEPERVVVSHEPEVEPEPVAS 177


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0006913 "nucleocytoplasmic transport" evidence=ISS
GO:0009737 "response to abscisic acid stimulus" evidence=IDA
TAIR|locus:2026423 AT1G69250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152566 AT5G48650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2023854 AT1G13730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172472 AT5G43960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098555 AT3G07250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LPH5 G3BP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UN86 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6XCI1 G3BP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1351465 G3bp1 "GTPase activating protein (SH3 domain) binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.1LOW CONFIDENCE prediction!
3rd Layer5.3.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00101480
hypothetical protein (487 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
cd00780119 cd00780, NTF2, Nuclear transport factor 2 (NTF2) d 7e-41
pfam02136116 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) 8e-33
cd00531124 cd00531, NTF2_like, Nuclear transport factor 2 (NT 1e-17
smart0036073 smart00360, RRM, RNA recognition motif 1e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-12
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 4e-11
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-11
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 9e-09
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 9e-09
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-08
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 3e-08
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 5e-08
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 9e-08
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-07
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 2e-07
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-07
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 5e-07
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 7e-07
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 8e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2e-06
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 3e-06
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 3e-06
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 3e-06
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 4e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 4e-06
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 4e-06
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 6e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-06
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 7e-06
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 7e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 8e-06
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 8e-06
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 1e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 1e-05
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 2e-05
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 3e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 4e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-05
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 6e-05
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 7e-05
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 7e-05
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 1e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 2e-04
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 3e-04
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 3e-04
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 3e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 5e-04
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 6e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 6e-04
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 6e-04
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 7e-04
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 7e-04
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 8e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 0.001
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 0.001
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.001
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 0.001
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.001
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 0.001
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.001
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.001
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 0.002
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.002
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.002
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 0.002
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.002
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 0.002
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.002
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 0.002
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 0.002
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 0.002
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.002
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.003
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 0.003
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 0.003
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.003
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 0.004
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 0.004
cd1272979 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 0.004
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 0.004
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 0.004
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 0.004
>gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
 Score =  141 bits (357), Expect = 7e-41
 Identities = 54/123 (43%), Positives = 74/123 (60%), Gaps = 5/123 (4%)

Query: 12  DPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLD 71
             + V  +FV+QY+       E LHR Y D+S LSR G    M  +T    I +++ SL 
Sbjct: 1   SAEDVAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREG----MKQVTGRDAIVEKLSSLP 56

Query: 72  YQNYQTEILTVDAQASYCKGVLVLVTGYMSGKTGK-RRFSQSFFLAPQENGFFVLNDIFR 130
           +Q  + +I TVD+Q +   GV+V+VTG +       R+FSQ+F LAPQ  G+FVLNDIFR
Sbjct: 57  FQKTKHKITTVDSQPTPSGGVIVMVTGSLKLDEQPPRKFSQTFVLAPQNGGYFVLNDIFR 116

Query: 131 FVD 133
           FVD
Sbjct: 117 FVD 119


This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119

>gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain Back     alignment and domain information
>gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241173 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 432
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 100.0
KOG2104126 consensus Nuclear transport factor 2 [Intracellula 100.0
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 99.97
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 99.93
KOG4353139 consensus RNA export factor NXT1 [RNA processing a 99.89
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.62
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.51
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 99.47
KOG0122270 consensus Translation initiation factor 3, subunit 99.45
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.44
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.44
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.41
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 99.34
PLN03213 759 repressor of silencing 3; Provisional 99.32
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.32
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.31
PLN03120 260 nucleic acid binding protein; Provisional 99.31
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.31
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.3
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 99.3
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.3
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.26
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.25
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.23
smart0036272 RRM_2 RNA recognition motif. 99.22
PLN03121 243 nucleic acid binding protein; Provisional 99.22
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 99.21
KOG4207 256 consensus Predicted splicing factor, SR protein su 99.2
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.19
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.19
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.18
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.16
smart0036071 RRM RNA recognition motif. 99.16
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.15
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.13
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 99.13
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.13
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.12
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.08
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.08
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.07
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.07
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.06
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.01
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.01
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.01
KOG0131 203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.01
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.98
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.97
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.97
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.97
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.96
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 98.95
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.89
smart0036170 RRM_1 RNA recognition motif. 98.89
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 98.88
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.87
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.86
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.84
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 98.78
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.77
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.76
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 98.76
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 98.75
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 98.73
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.72
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.62
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.61
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.58
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.58
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.55
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.55
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.54
KOG4206 221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.51
PF10429166 Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int 98.46
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.45
KOG0110 725 consensus RNA-binding protein (RRM superfamily) [G 98.45
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 98.44
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.4
KOG1457 284 consensus RNA binding protein (contains RRM repeat 98.36
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.35
KOG0106 216 consensus Alternative splicing factor SRp55/B52/SR 98.23
KOG0226290 consensus RNA-binding proteins [General function p 98.22
KOG1548 382 consensus Transcription elongation factor TAT-SF1 98.21
KOG0151 877 consensus Predicted splicing regulator, contains R 98.2
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.19
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.08
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.02
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.95
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 97.81
KOG4660 549 consensus Protein Mei2, essential for commitment t 97.76
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 97.64
PF15008262 DUF4518: Domain of unknown function (DUF4518) 97.6
KOG0120 500 consensus Splicing factor U2AF, large subunit (RRM 97.37
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.32
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 97.3
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 97.3
KOG4210285 consensus Nuclear localization sequence binding pr 97.08
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 97.03
KOG1457284 consensus RNA binding protein (contains RRM repeat 96.94
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 96.89
KOG0129 520 consensus Predicted RNA-binding protein (RRM super 96.78
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 96.67
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 96.64
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.57
KOG1995 351 consensus Conserved Zn-finger protein [General fun 96.56
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.52
TIGR02246128 conserved hypothetical protein. This family consis 96.49
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.22
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 96.17
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 96.09
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 95.99
KOG3152 278 consensus TBP-binding protein, activator of basal 95.99
KOG2314 698 consensus Translation initiation factor 3, subunit 95.94
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 95.83
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.74
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.63
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 95.5
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 95.36
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.25
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 95.16
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 95.07
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 94.91
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 94.82
PF12893116 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL 94.64
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 94.63
KOG1548382 consensus Transcription elongation factor TAT-SF1 94.46
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 94.25
KOG1855 484 consensus Predicted RNA-binding protein [General f 93.83
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 93.64
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 93.59
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 93.22
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 93.06
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 92.1
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 91.76
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 90.81
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 90.14
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 89.95
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 89.23
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 89.14
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 89.07
PF15023166 DUF4523: Protein of unknown function (DUF4523) 88.76
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 88.45
KOG1996378 consensus mRNA splicing factor [RNA processing and 87.99
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 87.18
TIGR02096129 conserved hypothetical protein, steroid delta-isom 86.72
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 84.5
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 84.25
KOG2591 684 consensus c-Mpl binding protein, contains La domai 82.58
KOG2068 327 consensus MOT2 transcription factor [Transcription 81.72
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 81.14
KOG4210 285 consensus Nuclear localization sequence binding pr 81.09
KOG4410396 consensus 5-formyltetrahydrofolate cyclo-ligase [C 80.78
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.1e-57  Score=455.72  Aligned_cols=359  Identities=41%  Similarity=0.660  Sum_probs=241.6

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHccCcccccccccCCCeeecCCCCCccceeccHHHHHHHHhcCCCCcceEEEe
Q 037989            1 MAAQAESSAKVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEIL   80 (432)
Q Consensus         1 ma~~~~~~~~~~~~~vg~~Fv~~YY~~l~~~p~~l~~fY~~~S~l~~~~~~g~~~~~~g~~~I~~~~~sl~~~~~~~~I~   80 (432)
                      |++++.....++++.||+.||+|||++|++.|+.||+||.+.|.|+|.|.||+|..++|+++|+++|++|+|..|+++|.
T Consensus         1 ~~~~~~~~~~~~~~~vg~~Fv~qYY~~L~~~P~~lhrfY~~~S~ltr~~~dg~m~s~t~~~~I~~~i~sld~~~~s~eI~   80 (419)
T KOG0116|consen    1 MDAQAMLSPVPTPQLVGNEFVRQYYNVLQNSPSKLHRFYMDDSVLTRPGLDGKMVSVTGLEAIHEKIMSLDYEVCSVEIS   80 (419)
T ss_pred             CCccccccCCCCHHHHHHHHHHHHHHHHhhChHHHHHHhhccceeeccCCCCceEEEecHHHhhhheeecCCCceeEEEE
Confidence            44455445779999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeeeeCCCcEEEEEEEEEeeCC-CCceeEEEEEeeeeCCeEEEEeceEEeecCccccccccCCCccCCCCCCCCCCCC
Q 037989           81 TVDAQASYCKGVLVLVTGYMSGKT-GKRRFSQSFFLAPQENGFFVLNDIFRFVDDDLSVGMVMPINDVDKTAAPVTTTSA  159 (432)
Q Consensus        81 s~d~q~s~~~~vlV~V~G~l~~~~-~~~~F~qtF~L~p~~~~y~V~nDifr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (432)
                      ++|+|.|+++||+|+|+|+|++++ ++|+|+|||+|+|++++|||+||||||||+.+..+++ ..             ..
T Consensus        81 tvdsQ~S~~~GvvI~VtG~lt~~~~~rRkF~QtFfLapq~~~yfVlNDiFRfvde~~~~e~~-~~-------------~v  146 (419)
T KOG0116|consen   81 TVDSQASLEKGVVIMVTGYLTNKDGPRRKFSQTFFLAPQEKGYFVLNDIFRFVDEEFEPEAN-TD-------------EV  146 (419)
T ss_pred             EEehhhhccCCeEEEEEEEEEeCCCcceEEEEEEEEeecCCceEEEechhhhcccccccccc-cc-------------cC
Confidence            999999999999999999999999 9999999999999999999999999999988722100 00             00


Q ss_pred             CCCCCccccCcccccCcccccccccccCCCcchhhcccccccccCCCCCCCCCCCCccccCCCCcCccccccccccccCC
Q 037989          160 PESEPVQVANQSVTNHTTTTIMETAKTTLPDEVITKENDKKISETLPQNGHDQDNHSVSNQTSTTTSSAEAISTTTTNNV  239 (432)
Q Consensus       160 pe~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~  239 (432)
                      |++-+.........+.    ..+        +         +.......    +..+..+   .              .+
T Consensus       147 p~~~~~~~~~~~~~~~----~~~--------~---------~~~~~~~~----~~~~~~~---~--------------~V  184 (419)
T KOG0116|consen  147 PEANPAVVVSVEKASQ----LVE--------A---------VVESEPEP----EPEPKAE---D--------------EV  184 (419)
T ss_pred             CCCCcceeeccccccc----ccc--------c---------ccccCCCC----ccccccc---C--------------ce
Confidence            0000000000000000    000        0         00000000    0000000   0              00


Q ss_pred             CCCCCCCcccccccccCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCchhhHhhhccCCCCCCCCCCCCCC----
Q 037989          240 NRPAETSSHDHLHKKANDHLIPEKKSGVANHDHPPVVSEIKTPRTPDSSSRKSFASIVHALKDNSSPFQNKVPPPN----  315 (432)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~p~~~~~~~~~~~~~~~kks~Asi~~~~k~~~~p~~~~~~~~~----  315 (432)
                      .++..        +..+.+ ..++...+...+.. + ...+ ..++.+.+++|||||+++++.+.++......|..    
T Consensus       185 ~~~~~--------~~~~~~-~~~~~~ee~v~~~~-~-~~~p-~~~~~~~~~~s~asv~~~~~~~~~~~~~~~~p~~~~~~  252 (419)
T KOG0116|consen  185 EVPEE--------ATVEDE-AKEKTKEELVIQQT-V-SEAP-AAPQGDAPKKSFASVVKVLKKSAAVQQSKGSPPQIQPQ  252 (419)
T ss_pred             ecccc--------cccccc-ccccCchhhccccc-c-cCCC-ccccccccchhhhhhhhhcccccccceeccCCCccccc
Confidence            00000        000000 11111111000000 0 0011 1126789999999999998877665222221211    


Q ss_pred             --CCCCCCCCCCCCC-CCCCc--cCCCCcCCCCCCCCEEEEcCCCCCCcHHHHHHHhhcCCCeEEEEEEeeCCCCCCccE
Q 037989          316 --LKKGSNTTQSSAD-PFSNN--ALRNNIDDQAAKNPVIFVANLPMDVTADQIKSVFVKFGPIKANGIRIRTNQLRPNCF  390 (432)
Q Consensus       316 --p~~~~~~~~~~~~-~~~~~--~~~~~~~~~~~~~~~vfV~NLp~~vte~~L~~~F~~fG~I~~~~v~~~~~~g~~~gf  390 (432)
                        |...+.+...+.+ .+...  ....+..+...++..|||+|||++++..+|+++|++||.|+..+|.++...++..||
T Consensus       253 ~~p~~~~~~~~~s~~~~p~~~~~~~n~~~~~~~~~~~~i~V~nlP~da~~~~l~~~Fk~FG~Ik~~~I~vr~~~~~~~~f  332 (419)
T KOG0116|consen  253 QQPSTKPQAERQSKPPSPVRESKSGNSNNQEPRADGLGIFVKNLPPDATPAELEEVFKQFGPIKEGGIQVRSPGGKNPCF  332 (419)
T ss_pred             cCCccCcchhhccCCCCccccccccccCCcceeecccceEeecCCCCCCHHHHHHHHhhcccccccceEEeccCCCcCce
Confidence              2222221111111 11111  112344455567778999999999999999999999999999999998855666699


Q ss_pred             EEEEeCCHHHHHHHHHhCCCeeCCeEEEEEEccCCcc
Q 037989          391 SFVEFESISSMQNALKASPITFGDRKVYVEQKKGKLN  427 (432)
Q Consensus       391 aFVeF~~~~~a~~Al~~~~~~i~Gr~l~Ve~ar~~~~  427 (432)
                      |||+|.+..+++.+|.+.++.|+||+|.|++++++.+
T Consensus       333 gFV~f~~~~~~~~~i~Asp~~ig~~kl~Veek~~~~~  369 (419)
T KOG0116|consen  333 GFVEFENAAAVQNAIEASPLEIGGRKLNVEEKRPGFR  369 (419)
T ss_pred             EEEEEeecchhhhhhhcCccccCCeeEEEEecccccc
Confidence            9999999999999999999999999999999998544



>KOG2104 consensus Nuclear transport factor 2 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>KOG4353 consensus RNA export factor NXT1 [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF15008 DUF4518: Domain of unknown function (DUF4518) Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4410 consensus 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
3q90_A140 Crystal Structure Of The Ntf2 Domain Of Ras Gtpase- 9e-18
3ujm_A120 Crystal Structure Of The Ntf2-Like Domain Of The Dr 2e-15
1gy7_A125 N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 2e-07
1zo2_A129 Structure Of Nuclear Transport Factor 2 (Ntf2) From 2e-07
3pgw_S 437 Crystal Structure Of Human U1 Snrnp Length = 437 7e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 9e-04
>pdb|3Q90|A Chain A, Crystal Structure Of The Ntf2 Domain Of Ras Gtpase-Activating Protein- Binding Protein 1 Length = 140 Back     alignment and structure

Iteration: 1

Score = 87.8 bits (216), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 53/129 (41%), Positives = 74/129 (57%), Gaps = 7/129 (5%) Query: 13 PQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGV---MTSITTMKEINDQILS 69 P LVG FV QY+ L+Q P+ LHRFY +S G D ++ KEI+ +++S Sbjct: 9 PLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMS 68 Query: 70 LDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGKT-GKRRFSQSFFLAPQ---ENGFFVL 125 ++ N T+I VDA A+ GV+V V G +S RRF Q+F LAP+ N F+V Sbjct: 69 QNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVH 128 Query: 126 NDIFRFVDD 134 NDIFR+ D+ Sbjct: 129 NDIFRYQDE 137
>pdb|3UJM|A Chain A, Crystal Structure Of The Ntf2-Like Domain Of The Drosophila Melanogaster Rasputin Protein Length = 120 Back     alignment and structure
>pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 Back     alignment and structure
>pdb|1ZO2|A Chain A, Structure Of Nuclear Transport Factor 2 (Ntf2) From Cryptosporidium Parvum Length = 129 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 1e-44
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 1e-41
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 1e-40
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 1e-39
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 6e-38
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 1e-37
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 5e-32
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 2e-31
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-14
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-13
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-13
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-12
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-12
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 6e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-11
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-11
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-11
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-11
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-11
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 4e-11
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-11
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-11
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-08
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 7e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-11
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 8e-11
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 8e-11
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 9e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 9e-11
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-10
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-10
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-10
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-10
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 4e-10
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-10
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-10
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 6e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-06
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 6e-10
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-10
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-09
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-08
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-09
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-09
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-09
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-09
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-09
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-09
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-09
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-09
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-09
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-09
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-09
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 6e-09
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-09
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 7e-09
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-08
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 8e-09
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 8e-09
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 8e-09
3q2s_C229 Cleavage and polyadenylation specificity factor S; 9e-09
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-08
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-08
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-08
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-08
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-08
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-08
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-08
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-08
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-08
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 4e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-08
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 2e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 5e-08
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-08
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 7e-08
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 8e-08
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 8e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 8e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 9e-08
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-08
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 9e-08
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-07
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-07
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-05
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-07
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-07
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-07
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-07
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-07
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-07
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-07
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-07
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-07
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-07
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-07
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-07
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-07
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 4e-07
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-07
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 5e-07
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-07
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 5e-07
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 6e-07
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 6e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 6e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 6e-07
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 8e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 6e-07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 6e-07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 6e-07
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 9e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 9e-07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-07
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-06
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-06
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-06
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-06
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-06
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-06
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-06
1x5p_A97 Negative elongation factor E; structure genomics, 4e-06
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 7e-06
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 7e-06
1x5o_A114 RNA binding motif, single-stranded interacting pro 8e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 9e-06
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-05
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-05
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-05
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-05
2div_A99 TRNA selenocysteine associated protein; structural 3e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-05
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 6e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 7e-05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 9e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-04
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 Back     alignment and structure
 Score =  151 bits (382), Expect = 1e-44
 Identities = 54/137 (39%), Positives = 75/137 (54%), Gaps = 7/137 (5%)

Query: 7   SSAKVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDG---VMTSITTMKEI 63
              K  P LVG  FV QY+  L+Q P+ LHRFY  +S     G D       ++   KEI
Sbjct: 3   VMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEI 62

Query: 64  NDQILSLDYQNYQTEILTVDAQASYCKGVLVLVTGYMSGK-TGKRRFSQSFFLAPQ---E 119
           + +++S ++ N  T+I  VDA A+   GV+V V G +S      RRF Q+F LAP+    
Sbjct: 63  HRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVA 122

Query: 120 NGFFVLNDIFRFVDDDL 136
           N F+V NDIFR+ D+  
Sbjct: 123 NKFYVHNDIFRYQDEVF 139


>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 100.0
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 100.0
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 100.0
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 100.0
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 100.0
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 100.0
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 100.0
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 99.98
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 99.84
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 99.84
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 99.8
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.76
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.69
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.69
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.68
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.68
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.68
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.67
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.67
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.67
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.67
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.67
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.66
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.66
3nv0_A205 Nuclear RNA export factor 2; NTF2-like domain, bet 99.66
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.66
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.66
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.66
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.66
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.66
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.65
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.65
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.65
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.65
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.65
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.65
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.65
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.65
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.65
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.65
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.65
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.65
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.65
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.64
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.64
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.64
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.64
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.64
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.64
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.64
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.64
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.64
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.64
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.64
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.64
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.64
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.63
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.63
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.63
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.63
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.63
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.63
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.62
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.62
2div_A99 TRNA selenocysteine associated protein; structural 99.62
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.62
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.62
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.62
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.62
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.61
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.61
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.61
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.61
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.61
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.6
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.6
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.6
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.6
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.6
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.6
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.6
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.6
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.59
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.59
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.59
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.59
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.59
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.59
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.58
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.58
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.58
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.58
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.58
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.58
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.58
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.58
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.57
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.57
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.57
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.57
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.57
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.57
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.57
2dis_A109 Unnamed protein product; structural genomics, RRM 99.56
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.56
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.56
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.56
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.56
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.56
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.56
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.56
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.56
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.56
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.56
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.55
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.55
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.55
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.55
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.55
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.55
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.55
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.55
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.55
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.54
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.54
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.54
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.54
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.54
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.53
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.53
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.53
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.53
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.53
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.53
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.53
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.52
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.52
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.52
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.52
1q42_A201 MTR2, mRNA transport regulator MTR2; NTF2-fold, nu 99.52
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.27
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.52
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.52
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.52
1x5p_A97 Negative elongation factor E; structure genomics, 99.51
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.51
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.5
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.5
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.49
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.49
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.49
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.49
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.49
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.48
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.47
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.47
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.47
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.47
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.46
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.46
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.46
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.45
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.45
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.45
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.44
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.44
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.44
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.44
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.44
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.43
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.43
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.43
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.43
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.42
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.42
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.41
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.4
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.39
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.39
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.39
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.37
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.36
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.35
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.35
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.35
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.34
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.33
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.33
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.33
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.33
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.32
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.31
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.29
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.29
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.28
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.26
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.26
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.26
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.24
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.23
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.23
1of5_B184 MTR2, YKL186C, mRNA transport regulator MTR2; nucl 99.21
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.19
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.17
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.17
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.17
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.16
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.13
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.11
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.1
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.09
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.08
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.03
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.81
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.75
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.75
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.61
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.3
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.29
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.43
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 97.34
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.11
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 96.78
3cu3_A172 Domain of unknown function with A cystatin-like F; 96.68
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 96.58
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 96.42
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 96.07
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 95.76
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 95.31
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 95.29
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.23
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.2
3h51_A156 Putative calcium/calmodulin dependent protein KIN 95.15
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 95.11
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 94.87
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 94.7
2rcd_A129 Uncharacterized protein; structural genomics, join 94.23
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 94.1
1tp6_A128 Hypothetical protein PA1314; structural genomics, 94.07
3duk_A125 NTF2-like protein of unknown function; structural 94.04
3bb9_A148 Putative orphan protein; structural genomics, join 93.41
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.29
3soy_A145 NTF2-like superfamily protein; structural genomics 93.29
3rob_A139 Uncharacterized conserved protein; structural geno 93.17
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.17
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 92.74
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 92.63
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 92.42
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 92.4
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 92.26
2rfr_A155 Uncharacterized protein; structural genomics, join 91.8
3blz_A128 NTF2-like protein of unknown function; structural 91.6
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 91.45
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 91.38
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 90.62
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 90.54
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 90.33
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 90.24
3h3h_A122 Uncharacterized snoal-like protein; structural gen 88.44
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 88.22
3fsd_A134 NTF2-like protein of unknown function in nutrient; 88.2
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 88.04
3fka_A120 Uncharacterized NTF-2 like protein; structural gen 87.96
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 87.8
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 87.41
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 87.29
3k0z_A159 Putative polyketide cyclase; structural genomics, 87.26
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 86.8
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 86.73
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 85.75
3dxo_A121 Uncharacterized snoal-like protein; putative isome 85.73
3dmc_A134 NTF2-like protein; structural genomics, joint cent 84.69
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 84.46
3f7x_A151 Putative polyketide cyclase; structural genomics, 84.24
2kn4_A 158 Immunoglobulin G-binding protein G, splicing FACT 84.05
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 83.84
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 82.76
3g8z_A148 Protein of unknown function with cystatin-like FO; 82.45
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 82.11
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 82.02
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 81.71
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 80.87
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 80.68
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 80.32
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 80.19
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 Back     alignment and structure
Probab=100.00  E-value=1.7e-37  Score=272.51  Aligned_cols=127  Identities=43%  Similarity=0.708  Sum_probs=112.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHccCcccccccccCCCeeecCCC--CCcc-ceeccHHHHHHHHhcCCCCcceEEEeeeeeee
Q 037989           10 KVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGP--DGVM-TSITTMKEINDQILSLDYQNYQTEILTVDAQA   86 (432)
Q Consensus        10 ~~~~~~vg~~Fv~~YY~~l~~~p~~l~~fY~~~S~l~~~~~--~g~~-~~~~g~~~I~~~~~sl~~~~~~~~I~s~d~q~   86 (432)
                      .|++++||++||++||++|+++|+.|++||+++|.|+|.+.  +|.+ ..+.|+++|.++|++|||++|+++|.++|||+
T Consensus         6 ~p~~~~vg~~Fv~~YY~~ld~~r~~L~~~Y~~~S~l~~~~~~~ng~~~~~~~G~~~I~~~l~~Lp~~~~~~~I~tvD~Qp   85 (140)
T 3q90_A            6 KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHA   85 (140)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHCGGGGGGGEEEEEEEC----------CCCEEHHHHHHHHHHHTCCCSCEEEEEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHhcCHHHHHhhcccCceEEEEccCCCCceeecccCHHHHHHHHHhCCCccceEEEEeEEEEE
Confidence            47899999999999999999999999999999999999764  3543 47899999999999999999999999999999


Q ss_pred             eCCCcEEEEEEEEEeeCC-CCceeEEEEEeeeeC---CeEEEEeceEEeecCcc
Q 037989           87 SYCKGVLVLVTGYMSGKT-GKRRFSQSFFLAPQE---NGFFVLNDIFRFVDDDL  136 (432)
Q Consensus        87 s~~~~vlV~V~G~l~~~~-~~~~F~qtF~L~p~~---~~y~V~nDifr~~~~~~  136 (432)
                      +++|||||+|+|.|+.++ +.|+|+|+|+|+|++   ++|||+||||||+|+.+
T Consensus        86 s~~~gilI~V~G~l~~~~~~~~~F~QtF~L~p~~~~~~~y~V~nDifR~~de~~  139 (140)
T 3q90_A           86 TLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF  139 (140)
T ss_dssp             CGGGCEEEEEEEEEECTTCCCEEEEEEEEEEECSSSTTCEEEEEEEEEEGGGC-
T ss_pred             eCCCCEEEEEEEEEecCCCCccEEEEEEEEeecCCCCCCEEEEEEEeEeehhhc
Confidence            999999999999999999 999999999999996   89999999999999876



>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 432
d1gy6a_125 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R 9e-38
d1gy7a_121 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B 6e-37
d1zo2a1117 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT 3e-36
d2qiya1139 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B 2e-29
d1jkga_139 d.17.4.2 (A:) NTF2-related export protein 1 (p15) 2e-29
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-13
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 6e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-12
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 7e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-11
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-11
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 5e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 7e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 9e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-09
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-09
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 3e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 5e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-09
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-09
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 8e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 2e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-07
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 3e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-07
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 4e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 6e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 7e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 7e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 9e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-06
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 1e-06
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-06
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-06
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-06
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-06
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 4e-06
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 5e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 8e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 3e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 3e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 0.002
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  131 bits (331), Expect = 9e-38
 Identities = 28/124 (22%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 13  PQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDY 72
            + +G+SF++ Y++        L   Y D+S L+  G             I +++ SL +
Sbjct: 5   WEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEG-----QQFQGKAAIVEKLSSLPF 59

Query: 73  QNYQTEILTVDAQASYCKGVLVLVTGYMSGKTG-KRRFSQSFFLAPQENGFFVLNDIFRF 131
           Q  Q  I   D Q +    ++ +V G +         F Q F L    + +   ND+FR 
Sbjct: 60  QKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRL 119

Query: 132 VDDD 135
              +
Sbjct: 120 ALHN 123


>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 100.0
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 100.0
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 100.0
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 99.97
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 99.96
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.75
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.74
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.73
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.73
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.73
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.72
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.72
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.72
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.71
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.71
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.71
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.7
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.7
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.69
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.69
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.69
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.68
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.67
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.67
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.66
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.66
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.66
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.66
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.64
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.63
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.62
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.61
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.61
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.61
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.61
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.6
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.6
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.6
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.59
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.59
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.59
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.58
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.58
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.57
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.57
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.55
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.55
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.54
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.54
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.54
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.53
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.53
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.53
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.52
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.52
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.52
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.51
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.51
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.5
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.5
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.5
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.49
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.49
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.48
d1q40b_205 NTF2-like domain of mRNA export factor MEX67 {Yeas 99.47
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.46
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.44
d1of5b_165 mRNA transport regulator MTR2 {Baker's yeast (Sacc 99.42
d1of5a_221 NTF2-like domain of mRNA export factor MEX67 {Bake 99.42
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d1jkgb_186 NTF2-like domain of Tip associating protein, TAP { 99.38
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.34
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.32
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.28
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.23
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.15
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.14
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.1
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.04
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.8
d1q42a_174 mRNA transport regulator MTR2 {Yeast (Candida albi 98.03
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 96.91
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 96.83
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 96.5
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 96.47
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 96.03
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 95.92
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.15
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.13
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 95.07
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 95.06
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 94.92
d2ux0a1135 Association domain of calcium/calmodulin-dependent 94.9
d2f86b1129 Association domain of calcium/calmodulin-dependent 94.83
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 94.55
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 93.83
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 92.89
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 92.87
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 92.31
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 91.77
d3blza1124 Uncharacterized protein Sbal0622 {Shewanella balti 91.2
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 91.15
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 91.14
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 89.68
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 89.61
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 88.65
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 87.01
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 86.65
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 85.81
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 83.58
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 83.38
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 83.05
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 82.36
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 80.86
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 80.38
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=8.2e-36  Score=254.95  Aligned_cols=122  Identities=24%  Similarity=0.394  Sum_probs=118.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHccCcccccccccCCCeeecCCCCCccceeccHHHHHHHHhcCCCCcceEEEeeeeeeeeCC
Q 037989           10 KVDPQLVGNSFVEQYFKALHQYPEHLHRFYQDSSFLSRPGPDGVMTSITTMKEINDQILSLDYQNYQTEILTVDAQASYC   89 (432)
Q Consensus        10 ~~~~~~vg~~Fv~~YY~~l~~~p~~l~~fY~~~S~l~~~~~~g~~~~~~g~~~I~~~~~sl~~~~~~~~I~s~d~q~s~~   89 (432)
                      .|.+++||+.||++||++|+++|+.|++||.++|.|+|+|.     .+.|.++|.++|++|++++|+++|.++|||++.+
T Consensus         2 ~p~~e~ig~~Fv~~YY~~l~~~r~~L~~~Y~~~S~l~~~g~-----~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Q~~~~   76 (125)
T d1gy6a_           2 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQ-----QFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPD   76 (125)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEETTE-----EEESHHHHHHHHHHCSCSCEEEEEEEEEEEECTT
T ss_pred             CCCHHHHHHHHHHHHHHHHhCCHHHHHHHcCCCcEEEECCc-----cccCHHHHHHHHHcCCCcccEEEEeEEEEEEcCC
Confidence            47889999999999999999999999999999999999997     8999999999999999999999999999999999


Q ss_pred             CcEEEEEEEEEeeCC-CCceeEEEEEeeeeCCeEEEEeceEEeecCcc
Q 037989           90 KGVLVLVTGYMSGKT-GKRRFSQSFFLAPQENGFFVLNDIFRFVDDDL  136 (432)
Q Consensus        90 ~~vlV~V~G~l~~~~-~~~~F~qtF~L~p~~~~y~V~nDifr~~~~~~  136 (432)
                      |+|||+|+|.|+.++ +.|+|+|+|+|++++++|||+||||||+.+++
T Consensus        77 ~~ili~V~G~~~~~~~~~~~F~qtF~L~~~~~~y~I~NDiFR~v~~~~  124 (125)
T d1gy6a_          77 SCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF  124 (125)
T ss_dssp             SCEEEEEEEEEEETTSCCEEEEEEEEEEEETTEEEEEEEEEEECCCCC
T ss_pred             CCEEEEEEEEEEECCCCCcceEEEEEEeccCCEEEEEeeEEEEEeccC
Confidence            999999999999999 99999999999999999999999999998875



>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure