Citrus Sinensis ID: 038126

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MAKSRTGSGYCNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRPAKLRSSTWWI
cccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccEEEEEcccccccccccEEEEEEcccccccccccHHHHHHHccccEEEEEccccccccHHHHHHHcccccccccccccc
ccccccccccccccEEcccccccccccccccccccccccccEEEEEccccccccHHHHHHHHcccccEccEccccHHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEcHHHHccccccHHHHEEccccEEEEEccccccEEEEccHHHcccccccccccccc
maksrtgsgycndrilsgcnksgfrpdfnpgrvipgpqcsgtvrvrtgrdpetCSVVCKLLKeedneawgvepfdsddadanRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAvdylspktlpelARVSADGVVifagyphqqrAKVSelskfgrpaklrsstwwi
maksrtgsgycndrilsgcnksgFRPDFnpgrvipgpqcsgtvrvrtgrdpETCSVVCKLlkeedneawgvepfdsddadANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYphqqrakvselskfgrpaklrsstwwi
MAKSRTGSGYCNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRPAKLRSSTWWI
*********YCNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPF********RMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYPH*************************
**********CNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFA********************KLR**TWWI
********GYCNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRP**********
*********YCNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYPHQQRAKVSELSKFGR*****S*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSRTGSGYCNDRILSGCNKSGFRPDFNPGRVIPGPQCSGTVRVRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSLAIVSDAVDYLSPKTLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRPAKLRSSTWWI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
Q9M2Y6261 Uncharacterized protein A yes no 0.698 0.452 0.704 7e-45
>sp|Q9M2Y6|Y3972_ARATH Uncharacterized protein At3g49720 OS=Arabidopsis thaliana GN=At3g49720 PE=1 SV=1 Back     alignment and function desciption
 Score =  179 bits (454), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 4/122 (3%)

Query: 51  PETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSL 110
           P+TCSVV  LLKEE+ EAWGVEP+D +DAD++  S V KG+V+  DIKFPL +RAKSFSL
Sbjct: 99  PDTCSVVSSLLKEEETEAWGVEPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSL 158

Query: 111 AIVSDAVDYLSP----KTLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRPAKLRSST 166
            IVSDA+DYLSP    KT+PELARV++DGVV+FAG P QQRAKV+ELSKFGRPAK+RS++
Sbjct: 159 VIVSDALDYLSPKYLNKTVPELARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSAS 218

Query: 167 WW 168
           WW
Sbjct: 219 WW 220

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
359475519262 PREDICTED: uncharacterized protein At3g4 0.704 0.454 0.796 2e-48
147789708171 hypothetical protein VITISV_026367 [Viti 0.704 0.695 0.796 3e-48
255562096261 conserved hypothetical protein [Ricinus 0.704 0.455 0.764 3e-47
449438287261 PREDICTED: uncharacterized protein At3g4 0.704 0.455 0.788 3e-47
449526555218 PREDICTED: uncharacterized protein At3g4 0.704 0.545 0.788 3e-47
255579521248 conserved hypothetical protein [Ricinus 0.704 0.479 0.731 4e-46
359493009263 PREDICTED: uncharacterized protein At3g4 0.704 0.452 0.731 5e-46
346466083 298 hypothetical protein [Amblyomma maculatu 0.704 0.399 0.739 3e-45
224060959262 predicted protein [Populus trichocarpa] 0.704 0.454 0.723 8e-45
224105811262 predicted protein [Populus trichocarpa] 0.704 0.454 0.731 1e-44
>gi|359475519|ref|XP_002269364.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi|297736364|emb|CBI25087.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/123 (79%), Positives = 106/123 (86%), Gaps = 4/123 (3%)

Query: 51  PETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSL 110
           P TCSVV KLLKEED EAWGVEP+D DDADAN  SLVRKGIV+  DIKFPL +RAKSFSL
Sbjct: 100 PYTCSVVSKLLKEEDTEAWGVEPYDIDDADANCKSLVRKGIVRVADIKFPLPYRAKSFSL 159

Query: 111 AIVSDAVDYLSPK----TLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRPAKLRSST 166
            I+SDA DYLSPK    TLPELARVSA+G+VIFAGYP Q RAKV+ELSKFGRPAKLRSS+
Sbjct: 160 VIMSDASDYLSPKYLNRTLPELARVSAEGLVIFAGYPGQHRAKVAELSKFGRPAKLRSSS 219

Query: 167 WWI 169
           WWI
Sbjct: 220 WWI 222

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147789708|emb|CAN69582.1| hypothetical protein VITISV_026367 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255562096|ref|XP_002522056.1| conserved hypothetical protein [Ricinus communis] gi|223538655|gb|EEF40256.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449438287|ref|XP_004136920.1| PREDICTED: uncharacterized protein At3g49720-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449526555|ref|XP_004170279.1| PREDICTED: uncharacterized protein At3g49720-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|255579521|ref|XP_002530603.1| conserved hypothetical protein [Ricinus communis] gi|223529851|gb|EEF31783.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|359493009|ref|XP_002285500.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi|302142150|emb|CBI19353.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|346466083|gb|AEO32886.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|224060959|ref|XP_002300295.1| predicted protein [Populus trichocarpa] gi|118484269|gb|ABK94014.1| unknown [Populus trichocarpa] gi|222847553|gb|EEE85100.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105811|ref|XP_002313939.1| predicted protein [Populus trichocarpa] gi|118483865|gb|ABK93823.1| unknown [Populus trichocarpa] gi|222850347|gb|EEE87894.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2097380261 AT3G49720 "AT3G49720" [Arabido 0.698 0.452 0.704 1.5e-42
TAIR|locus:2156208258 CGR3 "AT5G65810" [Arabidopsis 0.704 0.461 0.691 1.4e-41
TAIR|locus:2097380 AT3G49720 "AT3G49720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 450 (163.5 bits), Expect = 1.5e-42, P = 1.5e-42
 Identities = 86/122 (70%), Positives = 104/122 (85%)

Query:    51 PETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGIVQATDIKFPLAFRAKSFSL 110
             P+TCSVV  LLKEE+ EAWGVEP+D +DAD++  S V KG+V+  DIKFPL +RAKSFSL
Sbjct:    99 PDTCSVVSSLLKEEETEAWGVEPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSL 158

Query:   111 AIVSDAVDYLSPK----TLPELARVSADGVVIFAGYPHQQRAKVSELSKFGRPAKLRSST 166
              IVSDA+DYLSPK    T+PELARV++DGVV+FAG P QQRAKV+ELSKFGRPAK+RS++
Sbjct:   159 VIVSDALDYLSPKYLNKTVPELARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSAS 218

Query:   167 WW 168
             WW
Sbjct:   219 WW 220
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2156208 CGR3 "AT5G65810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2Y6Y3972_ARATHNo assigned EC number0.70490.69820.4521yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.45
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.24
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.15
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 96.01
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.29
PRK10258251 biotin biosynthesis protein BioC; Provisional 93.75
PRK05785226 hypothetical protein; Provisional 93.23
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 92.81
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 92.19
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 91.71
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 90.63
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 87.75
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 87.5
PLN02233261 ubiquinone biosynthesis methyltransferase 86.95
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 86.51
PRK08317241 hypothetical protein; Provisional 85.54
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 85.07
PRK06202232 hypothetical protein; Provisional 84.74
PRK11207197 tellurite resistance protein TehB; Provisional 84.07
PLN02244340 tocopherol O-methyltransferase 84.0
PLN02336 475 phosphoethanolamine N-methyltransferase 83.45
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 82.97
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 81.63
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 81.63
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information 
Probab=98.45  E-value=7.9e-08  Score=78.90  Aligned_cols=93  Identities=25%  Similarity=0.345  Sum_probs=82.5

Q ss_pred             hhhccCCCchhhhhhhhcccccccccccccCCchhhHHHHHHHHhcc-eeeeeecCccc-ccCCceeEEEecccccccCC
Q 038126           45 VRTGRDPETCSVVCKLLKEEDNEAWGVEPFDSDDADANRMSLVRKGI-VQATDIKFPLA-FRAKSFSLAIVSDAVDYLSP  122 (169)
Q Consensus        45 ~aLHvGPdTC~VVskLLkEe~tEAWGVEPyd~edad~~CksLVrKGi-VRvADIkfpLP-YR~KSFSlViVSDalDyLsp  122 (169)
                      |-|++|-........|.++.+.++.|||-.     +.+..+-|+||+ |--.|+.-.|+ |..+||..||.|++|..+.-
T Consensus        16 rVLDLGCGdG~LL~~L~~~k~v~g~GvEid-----~~~v~~cv~rGv~Viq~Dld~gL~~f~d~sFD~VIlsqtLQ~~~~   90 (193)
T PF07021_consen   16 RVLDLGCGDGELLAYLKDEKQVDGYGVEID-----PDNVAACVARGVSVIQGDLDEGLADFPDQSFDYVILSQTLQAVRR   90 (193)
T ss_pred             EEEecCCCchHHHHHHHHhcCCeEEEEecC-----HHHHHHHHHcCCCEEECCHHHhHhhCCCCCccEEehHhHHHhHhH
Confidence            448999999999999999999999999832     345677799999 99999999997 99999999999999999976


Q ss_pred             --CCchhhhhcccCceEEEecC
Q 038126          123 --KTLPELARVSADGVVIFAGY  142 (169)
Q Consensus       123 --kTLPeLaRvsadglVif~G~  142 (169)
                        +.|-|+.||...+||-|.-|
T Consensus        91 P~~vL~EmlRVgr~~IVsFPNF  112 (193)
T PF07021_consen   91 PDEVLEEMLRVGRRAIVSFPNF  112 (193)
T ss_pred             HHHHHHHHHHhcCeEEEEecCh
Confidence              89999999999999988765

Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, Gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In P. putida, as in Gram-positive bacteria and certain fungi, the second and third steps are a direct sulphydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells [].
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.07
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.06
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.05
3f4k_A257 Putative methyltransferase; structural genomics, P 96.05
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 95.98
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 95.96
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 95.85
3lcc_A235 Putative methyl chloride transferase; halide methy 95.73
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 95.63
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 95.48
3dh0_A219 SAM dependent methyltransferase; cystal structure, 95.18
3cc8_A230 Putative methyltransferase; structural genomics, j 94.98
4hg2_A257 Methyltransferase type 11; structural genomics, PS 94.6
3i9f_A170 Putative type 11 methyltransferase; structural gen 94.49
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 94.3
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 94.2
1vl5_A260 Unknown conserved protein BH2331; putative methylt 94.18
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 94.18
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 94.1
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 94.09
3dtn_A234 Putative methyltransferase MM_2633; structural gen 94.06
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 93.99
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 93.83
2p7i_A250 Hypothetical protein; putative methyltransferase, 93.74
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 93.69
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 93.54
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 93.53
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 93.4
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 93.34
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 93.08
3hnr_A220 Probable methyltransferase BT9727_4108; structural 93.07
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 93.03
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 93.01
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 92.96
2i62_A265 Nicotinamide N-methyltransferase; structural genom 92.95
3ege_A 261 Putative methyltransferase from antibiotic biosyn 92.91
3m70_A286 Tellurite resistance protein TEHB homolog; structu 92.86
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 92.78
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 92.68
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 92.65
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 92.48
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 92.35
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 92.26
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 91.74
1xxl_A239 YCGJ protein; structural genomics, protein structu 91.51
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 91.48
3m33_A226 Uncharacterized protein; structural genomics, PSI- 91.43
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 91.0
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 90.62
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 90.37
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 90.26
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 90.12
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 89.97
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 89.67
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 89.29
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 89.15
1vlm_A219 SAM-dependent methyltransferase; possible histamin 88.57
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 88.47
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 88.32
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 87.59
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 87.46
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 87.16
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 87.15
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 86.91
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 86.66
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 86.59
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 86.45
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 86.36
1ne2_A200 Hypothetical protein TA1320; structural genomics, 85.97
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 85.56
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 84.29
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 84.28
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 84.21
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 83.92
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 83.42
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 83.16
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 82.72
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 82.48
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 82.35
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 82.07
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 81.86
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 81.74
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 81.45
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 81.16
1yb2_A275 Hypothetical protein TA0852; structural genomics, 81.0
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 80.46
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
Probab=96.07  E-value=0.0068  Score=43.36  Aligned_cols=93  Identities=12%  Similarity=0.068  Sum_probs=62.2

Q ss_pred             hhhccCCCchhhhhhhhcccc-cccccccccCCchhhHHHHHHHH-h---------cceeeeeecCcccccCCceeEEEe
Q 038126           45 VRTGRDPETCSVVCKLLKEED-NEAWGVEPFDSDDADANRMSLVR-K---------GIVQATDIKFPLAFRAKSFSLAIV  113 (169)
Q Consensus        45 ~aLHvGPdTC~VVskLLkEe~-tEAWGVEPyd~edad~~CksLVr-K---------GiVRvADIkfpLPYR~KSFSlViV  113 (169)
                      +.|.+|-.+......|.+... .+..|||+.+  ++-..++...+ .         =-+..+|+ .-+|....+|.+|+.
T Consensus        32 ~vLDiGcG~G~~~~~l~~~~~~~~v~gvD~s~--~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~-~~~~~~~~~fD~V~~  108 (219)
T 3jwg_A           32 KVIDLGCGEGNLLSLLLKDKSFEQITGVDVSY--SVLERAKDRLKIDRLPEMQRKRISLFQSSL-VYRDKRFSGYDAATV  108 (219)
T ss_dssp             EEEEETCTTCHHHHHHHTSTTCCEEEEEESCH--HHHHHHHHHHTGGGSCHHHHTTEEEEECCS-SSCCGGGTTCSEEEE
T ss_pred             EEEEecCCCCHHHHHHHhcCCCCEEEEEECCH--HHHHHHHHHHHhhccccccCcceEEEeCcc-cccccccCCCCEEEE
Confidence            348889999888887776543 6888998753  22233333222 1         23445677 346777789999999


Q ss_pred             cccccccCC----CCchhhhhcccC-ceEEEe
Q 038126          114 SDAVDYLSP----KTLPELARVSAD-GVVIFA  140 (169)
Q Consensus       114 SDalDyLsp----kTLPeLaRvsad-glVif~  140 (169)
                      ++.+.|+.+    +.|-++.|+-.. |++|++
T Consensus       109 ~~~l~~~~~~~~~~~l~~~~~~LkpgG~~i~~  140 (219)
T 3jwg_A          109 IEVIEHLDENRLQAFEKVLFEFTRPQTVIVST  140 (219)
T ss_dssp             ESCGGGCCHHHHHHHHHHHHTTTCCSEEEEEE
T ss_pred             HHHHHhCCHHHHHHHHHHHHHhhCCCEEEEEc
Confidence            999999974    567778887654 544443
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 95.3
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 95.13
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 94.75
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.68
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 93.25
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 93.23
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 92.73
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 92.12
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 91.65
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 86.77
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 86.17
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 84.96
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 84.48
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 83.21
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 82.29
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 81.72
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: Putative sarcosine dimethylglycine methyltransferase
species: Red algae (Galdieria sulphuraria) [TaxId: 130081]

Probab=95.30  E-value=0.0066  Score=44.49  Aligned_cols=94  Identities=13%  Similarity=0.044  Sum_probs=65.8

Q ss_pred             hccCCCchhhhhhhhcccccccccccccC--CchhhHHHHHHHHhcc--eeeeeecCcccccCCceeEEEecccccccCC
Q 038126           47 TGRDPETCSVVCKLLKEEDNEAWGVEPFD--SDDADANRMSLVRKGI--VQATDIKFPLAFRAKSFSLAIVSDAVDYLSP  122 (169)
Q Consensus        47 LHvGPdTC~VVskLLkEe~tEAWGVEPyd--~edad~~CksLVrKGi--VRvADIkfpLPYR~KSFSlViVSDalDyLsp  122 (169)
                      |-||-.+-.....|.++-..+..||++.+  ++-+..+++..--...  +..+|+ .-||+...||.+|+..+++.|+..
T Consensus        72 LDiGcG~G~~~~~la~~~~~~v~gvD~s~~~i~~a~~~~~~~gl~~~v~~~~~d~-~~l~~~~~sfD~V~~~~~l~h~~d  150 (282)
T d2o57a1          72 LDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSF-LEIPCEDNSYDFIWSQDAFLHSPD  150 (282)
T ss_dssp             EEETCTTSHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHHHTCTTTEEEEECCT-TSCSSCTTCEEEEEEESCGGGCSC
T ss_pred             EEeCCCCcHHHhhhhccCCcEEEEEeccchhhhhhhccccccccccccccccccc-ccccccccccchhhccchhhhccC
Confidence            77788877776666665566888988765  3445555554311111  445665 347888899999999999999975


Q ss_pred             --CCchhhhhcc-cCceEEEec
Q 038126          123 --KTLPELARVS-ADGVVIFAG  141 (169)
Q Consensus       123 --kTLPeLaRvs-adglVif~G  141 (169)
                        +.|-++.|+- .+|.++++.
T Consensus       151 ~~~~l~~~~~~LkpgG~l~~~~  172 (282)
T d2o57a1         151 KLKVFQECARVLKPRGVMAITD  172 (282)
T ss_dssp             HHHHHHHHHHHEEEEEEEEEEE
T ss_pred             HHHHHHHHHHhcCCCcEEEEEE
Confidence              8888999965 456777764
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure