Citrus Sinensis ID: 038192

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760----
MTGNLPSSLQRPLAAPIVVHVSRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNELDALSDSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
ccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccEEEcccHHHHHHHHHHHHHHHHcccccHHccccccccccEEEEEccccccccccccccccccccEEEEccccccEEEEEccccccccHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHcccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccEEEEEEcccccHHHHHccccccccccEEEEEEEcccccccccccEEEEEEcccccccccccccccEEEEEEEccHHHHHHHcccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc
cccccHHHHHHHcccccccccccccHHHHHHcccccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccccccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcHHHHcccccccccccEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHccccHHccccHHHHHHcccccccccEEEEEEcHHHHEccccEEEccccEEEEEEcccccccccccccccccccccHHHccccccccEEEEccccccccccHEccccccHHHHHHHHccHHccHccccccHHEHHcccccccccEEEEEcccHHHHHHHHHHHHHHHHccccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEEcccccccccEEEEEEcHHHHHHHHcccccccccccEEEEEcHHHHHHHcccccccHHHcccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mtgnlpsslqrplaapivvhvsrpnevennrkdlpiVMMEQEIMEAVndnsaviicgetgcgkttqvpqflfeagfgsnrcssrsgrigvtqpRRVAVLATAKRVAFELGLHLgkevgfqvrhdkkigdscsikfMTDGILLRELKALYEKQQQLLrsgqciepkdrvfpLKLILMSATLRVEDfisggrlfrnppiievptrqfpvtvhfSKRTEIVDYIGQAYKKVMSIHkrlpqggiLVFVTGQREVEYLCSKLRKASKQLLVNsskenkgnqvvadsepnatkdiNMKEINEAFeiqgysteqqtdrfssydedqfdiddneldalsdseteseteilgedeklveqkcpmdgddpvdvlkenwslgsLKLAFEVLsgknasgpssqmklstpaipeqctelpptptpeqcpelsspdvekmgdnkragvgalcvlplyamlpaAAQLRVFEDVKEGERLVVVSTnvaetsltipgikyvVDTGREKVkkynsangiesYEIQWISKASAAQRagragrtapghcyrlYSSAvfnnilpdfscaeiskvpVDGVVLLMKSmnidkvsnfpfptppevTALVEAERCLKALEALDSNGRLTALGKAmahypmsprhSRMLLTLIQTMKVKSYARANLVLGYGVAAAAAlsvsnpfvlqlegtqtnsndseleerdnaldsedpmcrQEKLGKRKLKEVAKLshakfsnptsDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
mtgnlpsslqrplaapivvhvsrpnevennrkdLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFgsnrcssrsgrigvtqprrVAVLATAKRVAFELGLhlgkevgfqvrhdkkigdscsIKFMTDGILLRELKALYEKQQQLlrsgqciepkdRVFPLKLILMSATLRVEDFISggrlfrnppiievptrqfpvtvhfsKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASKQLlvnsskenkgnqvvadsepnatkdiNMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNEldalsdseteseteilgedeklveqKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVvstnvaetsltipgikyvvdTGREKVKKYnsangiesyeIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEgtqtnsndseleerdnaldsedpmcRQEKLGKRKLKEvaklshakfsnptsdVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
MTGNLPSSLQRPLAAPIVVHVSRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNELDALSDSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWISKasaaqragragrtapgHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARanlvlgygvaaaaalsvsnPFVLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
****************IVVH*************LPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLR******************************************************************************************************VDVLKENWSLGSLKLAFEVL***************************************************AGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQL**************************************************TSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLF***
*****************************NRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRK***********************************************************************************************************************************QMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWI***************APGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEG************************************VAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLF***
*********QRPLAAPIVVHVSRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNELDAL***********LGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGK*************PAIPEQCTE**************SPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWISK*************APGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
*****PSSL************SRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDED*************DSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWISKASAA******GRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLE**********************PMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGNLPSSLQRPLAAPIVVHVSRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNELDALSDSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query764 2.2.26 [Sep-21-2011]
Q04217 1267 Probable ATP-dependent RN yes no 0.405 0.244 0.447 2e-70
Q9HDY4 1183 Putative ATP-dependent RN yes no 0.409 0.264 0.404 2e-66
Q8IY37 1157 Probable ATP-dependent RN yes no 0.311 0.205 0.481 3e-60
O46072 1192 Probable ATP-dependent RN yes no 0.307 0.197 0.460 1e-57
P34305 1148 Putative ATP-dependent RN yes no 0.344 0.229 0.399 9e-52
Q54F05 1160 ATP-dependent RNA helicas no no 0.369 0.243 0.352 2e-46
Q38953 1168 Probable pre-mRNA-splicin no no 0.370 0.242 0.348 5e-45
O42643 1168 Pre-mRNA-splicing factor no no 0.362 0.237 0.333 5e-44
P24384 1145 Pre-mRNA-splicing factor no no 0.387 0.258 0.325 6e-44
Q9P774 1173 Pre-mRNA-splicing factor no no 0.370 0.241 0.330 7e-42
>sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 Back     alignment and function desciption
 Score =  267 bits (682), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 150/335 (44%), Positives = 209/335 (62%), Gaps = 25/335 (7%)

Query: 437  LCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYN 496
            L VLPLY++LP   Q+RVF+   +G RL +V+TNVAETSLTIPG++YVVD+GR K +KYN
Sbjct: 729  LYVLPLYSLLPTKEQMRVFQKPPQGSRLCIVATNVAETSLTIPGVRYVVDSGRSKERKYN 788

Query: 497  SANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVD 556
             +NG++S+E+ W+SKASA QR+GRAGRT PGHCYRLYSSAVF +    FS  EI ++PV+
Sbjct: 789  ESNGVQSFEVGWVSKASANQRSGRAGRTGPGHCYRLYSSAVFEHDFEQFSKPEILRMPVE 848

Query: 557  GVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMS 616
             +VL MKSM I  + NFPFPTPP+  AL +A + L+ L ALD+   +T  GK M+ +P+S
Sbjct: 849  SIVLQMKSMAIHNIINFPFPTPPDRVALSKAIQLLQYLGALDNKEMITEDGKKMSLFPLS 908

Query: 617  PRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLE-GTQTNSN----- 670
            PR S+MLL           +     L Y VA  +ALSV +PF+ + E G    S      
Sbjct: 909  PRFSKMLLV----------SDEKACLPYIVAIVSALSVGDPFINEFELGINEISRKPNPD 958

Query: 671  ---DSELEERDNALDSEDPMCRQEKLGK--RKLKEVAKLSHAKFSNPTSDVLTVAYALQC 725
               D ++ E D +    DP  ++E   K  +   + +KL   KFS+    +L+V  A+  
Sbjct: 959  ENLDDKIREHDESTPGMDPELKKELRSKFYKSRSQFSKLD--KFSD-VFRLLSVVSAMDY 1015

Query: 726  FELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLL 760
                +  + F  +  L  K MEE+ KLRKQL++++
Sbjct: 1016 VPKEQKEI-FMKKNFLRGKLMEEIVKLRKQLMYII 1049
Probable ATP-binding RNA helicase. Required for 18S rRNA synthesis. May play a role in restructuring of the pre-rRNA.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 Back     alignment and function description
>sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 Back     alignment and function description
>sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 Back     alignment and function description
>sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description
>sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 Back     alignment and function description
>sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query764
225437451 1414 PREDICTED: probable ATP-dependent RNA he 0.982 0.531 0.679 0.0
224068382 1130 predicted protein [Populus trichocarpa] 0.958 0.647 0.654 0.0
449505370 1333 PREDICTED: LOW QUALITY PROTEIN: probable 0.952 0.546 0.641 0.0
449436765 1333 PREDICTED: probable ATP-dependent RNA he 0.952 0.546 0.641 0.0
357469581 1331 Pre-mRNA-splicing factor ATP-dependent R 0.960 0.551 0.592 0.0
356506353 1380 PREDICTED: probable ATP-dependent RNA he 0.962 0.532 0.587 0.0
356495193 1403 PREDICTED: probable ATP-dependent RNA he 0.946 0.515 0.583 0.0
15217524 1237 putative RNA helicase [Arabidopsis thali 0.928 0.573 0.573 0.0
12322573 1191 helicase, putative [Arabidopsis thaliana 0.921 0.591 0.573 0.0
297851770 1245 helicase domain-containing protein [Arab 0.928 0.569 0.569 0.0
>gi|225437451|ref|XP_002268905.1| PREDICTED: probable ATP-dependent RNA helicase DHX37-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/804 (67%), Positives = 634/804 (78%), Gaps = 53/804 (6%)

Query: 2    TGNLPSSLQRPLAAPIVVHVSRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGC 61
            T NLP    +P+  P VVHVSRP EVENNRKDLPIVMMEQEIMEA+ND++AVIICGETGC
Sbjct: 326  TSNLPDCSLQPITTPTVVHVSRPTEVENNRKDLPIVMMEQEIMEAINDHTAVIICGETGC 385

Query: 62   GKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAKRVAFELGLHLGKEVGFQV 121
            GKTTQVPQFL+EAGFGS + S +SG IGVTQPRRVAVLATAKRVAFELGL LGKEVGFQV
Sbjct: 386  GKTTQVPQFLYEAGFGSKQASVQSGIIGVTQPRRVAVLATAKRVAFELGLSLGKEVGFQV 445

Query: 122  RHDKKIGDSCSIKFMTDGILLRELK----------------------------------- 146
            RHDK IGDSCSIKFMTDGILLRE++                                   
Sbjct: 446  RHDKMIGDSCSIKFMTDGILLREVQNDFSLRRYSVIILDEAHERSLNTDILIGMLSRVIQ 505

Query: 147  ---ALYEKQQQLLRSGQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRNPP-IIEVPT 202
                LYE+QQQ++ SG  I P+  V  LKL+LMSATLRVEDFISG RLF  PP +IEVP+
Sbjct: 506  VRQKLYEEQQQMMLSGVRISPESMVPQLKLVLMSATLRVEDFISGRRLFHTPPPVIEVPS 565

Query: 203  RQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLCSKLRKASK 262
            RQFPVT+HFSKRTEIVDYIGQAYKK++SIHK+LPQGGILVFVTGQREVEYLC KLRKAS+
Sbjct: 566  RQFPVTIHFSKRTEIVDYIGQAYKKILSIHKKLPQGGILVFVTGQREVEYLCQKLRKASR 625

Query: 263  QLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDI 322
            +L++NSSK+N GN+V A SE N+   I+++EINEAFEIQG S  QQTDRFS YDED  D+
Sbjct: 626  ELMLNSSKQNIGNEVTAVSEMNSVGGIDIEEINEAFEIQGNSANQQTDRFSIYDEDHGDL 685

Query: 323  DDNELDALSDSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSG 382
            D+++ D+  DSETESE E+LG+D   ++ K   D  + VD+L E+ SL SLK AF+ L+G
Sbjct: 686  DEDDSDSSYDSETESEWEVLGDDGNPLDLKTSEDDGNLVDILGEDRSLASLKAAFDALAG 745

Query: 383  KNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKR-AGVGALCVLP 441
            K A   +S+ +   P             TP +C + S+P++ K  D +     GALCVLP
Sbjct: 746  KTAINHNSKGEEVVPD------------TPGRCSDQSNPNMGKKRDGENDLSAGALCVLP 793

Query: 442  LYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKKYNSANGI 501
            LYAMLPAAAQLRVFE++KEGERLVVV+TNVAETSLTIPGIKYVVDTGREKVK Y+ +NG+
Sbjct: 794  LYAMLPAAAQLRVFEEIKEGERLVVVATNVAETSLTIPGIKYVVDTGREKVKNYDHSNGM 853

Query: 502  ESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLL 561
            E+YE+QWISKASAAQRAGRAGRT PGHCYRLYSSAVFNNILPDFS AEI KVPV+GV+LL
Sbjct: 854  ETYEVQWISKASAAQRAGRAGRTGPGHCYRLYSSAVFNNILPDFSMAEILKVPVEGVILL 913

Query: 562  MKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSR 621
            MKSM+IDKV+NFPFPTPP+  AL EAERCLKALEAL+S GRLT LGKAMAHYPMSPRHSR
Sbjct: 914  MKSMDIDKVANFPFPTPPDAIALAEAERCLKALEALNSKGRLTPLGKAMAHYPMSPRHSR 973

Query: 622  MLLTLIQTM-KVKSYARANLVLGYGVAAAAALSVSNPFVLQLEGTQTNSNDSELEERDNA 680
            MLLT+IQ M K K YARANLVLGY VAAAAALS+ NPFV+Q EG  T ++  +  E+ N 
Sbjct: 974  MLLTVIQIMRKAKGYARANLVLGYAVAAAAALSLPNPFVMQFEGNHTRNDGLDQVEKANT 1033

Query: 681  LDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYA 740
              +++ + +Q+KL K+KLKE AK+S AKFSNP+SD LTVAYALQCFELS SPVEFCNE  
Sbjct: 1034 PVTDEIVDKQDKLKKKKLKETAKVSRAKFSNPSSDALTVAYALQCFELSGSPVEFCNENV 1093

Query: 741  LHLKTMEEMSKLRKQLLHLLFNQN 764
            +HLKT+EEMSKLRKQLL L+FNQ+
Sbjct: 1094 MHLKTLEEMSKLRKQLLQLVFNQS 1117

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224068382|ref|XP_002302733.1| predicted protein [Populus trichocarpa] gi|222844459|gb|EEE82006.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449505370|ref|XP_004162448.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DHX37-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449436765|ref|XP_004136163.1| PREDICTED: probable ATP-dependent RNA helicase DHX37-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357469581|ref|XP_003605075.1| Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [Medicago truncatula] gi|355506130|gb|AES87272.1| Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356506353|ref|XP_003521949.1| PREDICTED: probable ATP-dependent RNA helicase DHR1-like [Glycine max] Back     alignment and taxonomy information
>gi|356495193|ref|XP_003516464.1| PREDICTED: probable ATP-dependent RNA helicase DHX37-like [Glycine max] Back     alignment and taxonomy information
>gi|15217524|ref|NP_174605.1| putative RNA helicase [Arabidopsis thaliana] gi|12322388|gb|AAG51220.1|AC051630_17 RNA helicase, putative; 27866-23496 [Arabidopsis thaliana] gi|332193467|gb|AEE31588.1| putative RNA helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12322573|gb|AAG51287.1|AC027035_10 helicase, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297851770|ref|XP_002893766.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297339608|gb|EFH70025.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query764
TAIR|locus:2007003 1237 FAS4 "FASCIATED STEM 4" [Arabi 0.416 0.257 0.583 7.8e-206
DICTYBASE|DDB_G0287351 1461 dhx37 "DEAD/DEAH box helicase" 0.815 0.426 0.361 1.4e-131
SGD|S000004735 1267 ECM16 "Essential DEAH-box ATP- 0.417 0.251 0.383 3.1e-112
CGD|CAL0004556 1263 orf19.2090 [Candida albicans ( 0.263 0.159 0.504 2.6e-109
POMBASE|SPAPB1A10.06c 1183 SPAPB1A10.06c "ATP-dependent R 0.407 0.262 0.363 1.7e-100
RGD|1306837 1150 Dhx37 "DEAH (Asp-Glu-Ala-His) 0.416 0.276 0.420 2.5e-96
WB|WBGene00015525 1148 rha-2 [Caenorhabditis elegans 0.401 0.267 0.379 5e-85
UNIPROTKB|E1C9C2 1145 DHX37 "Uncharacterized protein 0.455 0.303 0.358 2.1e-83
UNIPROTKB|E1BNQ2 1155 DHX37 "Uncharacterized protein 0.426 0.282 0.390 3e-82
UNIPROTKB|F5H3Y4 962 DHX37 "Probable ATP-dependent 0.421 0.334 0.385 5.3e-82
TAIR|locus:2007003 FAS4 "FASCIATED STEM 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 919 (328.6 bits), Expect = 7.8e-206, Sum P(3) = 7.8e-206
 Identities = 192/329 (58%), Positives = 229/329 (69%)

Query:   435 GALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVKK 494
             G L VLPLYAML  AAQLRVFE+V++ ERLVVV+TNVAETSLTIPGIKYVVDTGR KVK 
Sbjct:   645 GKLRVLPLYAMLSPAAQLRVFEEVEKEERLVVVATNVAETSLTIPGIKYVVDTGRVKVKN 704

Query:   495 YNSANGIESYEIQWISKXXXXXXXXXXXXXXXXHCYRLYSSAVFNNILPDFSCAEISKVP 554
             Y+S  G+ESYE+ WIS+                HCYRLYSSAVF+NI  + S  EI KVP
Sbjct:   705 YDSKTGMESYEVDWISQASASQRAGRAGRTGPGHCYRLYSSAVFSNIFEESSLPEIMKVP 764

Query:   555 VDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYP 614
             VDGV+LLMKSMNI KV NFPFPTPPE +A+ EAERCLKALEALDSNG LT LGKAM+HYP
Sbjct:   765 VDGVILLMKSMNIPKVENFPFPTPPEPSAIREAERCLKALEALDSNGGLTPLGKAMSHYP 824

Query:   615 MSPRHSRMLLTLIQTMK-VKSYARXXXXXXXXXXXXXXXXXXXPFVLQLEGTQTNSNDSE 673
             MSPRHSRMLLT+IQ +K  ++Y+R                   P +++ EG + N    E
Sbjct:   825 MSPRHSRMLLTVIQMLKETRNYSRANLILGYAVAAVAALSLPNPLIMEFEGEKKN----E 880

Query:   674 LEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPV 733
              ++ D  +  ED      K  K+  KE  K +  +FSNP+SD LTVAYAL  FE+S++ +
Sbjct:   881 SKDADKTVKQED------KQRKKDRKEKIKAARDRFSNPSSDALTVAYALHSFEVSENGM 934

Query:   734 EFCNEYALHLKTMEEMSKLRKQLLHLLFN 762
              FC    LHLKTM+EMSKL+ QLL L+FN
Sbjct:   935 GFCEANGLHLKTMDEMSKLKDQLLRLVFN 963
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
DICTYBASE|DDB_G0287351 dhx37 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000004735 ECM16 "Essential DEAH-box ATP-dependent RNA helicase specific to U3 snoRNP" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0004556 orf19.2090 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
POMBASE|SPAPB1A10.06c SPAPB1A10.06c "ATP-dependent RNA helicase Dhr1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1306837 Dhx37 "DEAH (Asp-Glu-Ala-His) box polypeptide 37" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00015525 rha-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9C2 DHX37 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNQ2 DHX37 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F5H3Y4 DHX37 "Probable ATP-dependent RNA helicase DHX37" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00021794
hypothetical protein (1130 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.X.2964.1
hypothetical protein (516 aa)
   •• • 0.465
eugene3.00640202
hypothetical protein (1181 aa)
   •• • 0.445

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 8e-76
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-66
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 3e-43
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 5e-42
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-40
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-37
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 6e-37
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-35
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 8e-20
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 3e-15
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-14
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-14
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-13
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-12
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 1e-12
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-12
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-08
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 3e-07
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 0.004
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  261 bits (670), Expect = 8e-76
 Identities = 118/337 (35%), Positives = 159/337 (47%), Gaps = 48/337 (14%)

Query: 434 VGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGREKVK 493
              L +LPLY  L A  Q+RVFE    G+R VV++TN+AETSLTIPGI+YV+D+G  K K
Sbjct: 285 GDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLAKEK 344

Query: 494 KYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKV 553
           +Y+   G+   E + ISKASA QRAGRAGRT PG CYRLYS   F    P+F+  EI + 
Sbjct: 345 RYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDFLA-FPEFTLPEILRT 403

Query: 554 PVDGVVLLMKSMNID-KVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAH 612
            + G+VL +KS+ I   ++ FPF  PP   A+  A   L+ L ALD +G+LT LGK M+ 
Sbjct: 404 DLSGLVLQLKSLGIGQDIAPFPFLDPPPEAAIQAALTLLQELGALDDSGKLTPLGKQMSL 463

Query: 613 YPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEGTQTNSNDS 672
            P+ PR +RMLLT          A     LG     A+ LS  +            S D 
Sbjct: 464 LPLDPRLARMLLT----------APEGGCLGEAATIASMLSEQD-------RESDFSRDV 506

Query: 673 ELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPT---SDVLTVAYAL-QCFEL 728
           +L                    +++      L   K  N      D L +  A       
Sbjct: 507 KL--------------------RKQRTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIAR 546

Query: 729 SKSPVEF-----CNEYALHLKTMEEMSKLRKQLLHLL 760
            ++  E+     C       K +     +   LL   
Sbjct: 547 KRAKGEYLRANGCRAMLFPTKALSRAPWIIAALLVQT 583

Length = 845
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 764
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.97
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.97
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.97
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.97
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.97
PTZ00110545 helicase; Provisional 99.96
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.96
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.96
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.96
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.96
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 99.96
PRK02362737 ski2-like helicase; Provisional 99.96
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.96
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.95
PTZ00424401 helicase 45; Provisional 99.95
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.95
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.95
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.95
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.95
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.94
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.94
PRK00254720 ski2-like helicase; Provisional 99.94
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.93
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.92
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.92
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.92
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.92
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.91
KOG0347731 consensus RNA helicase [RNA processing and modific 99.91
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.91
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.91
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.91
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.9
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.9
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.9
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.89
PRK106891147 transcription-repair coupling factor; Provisional 99.89
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.89
PRK13767 876 ATP-dependent helicase; Provisional 99.89
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.89
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.87
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.84
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.83
KOG0327397 consensus Translation initiation factor 4F, helica 99.83
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.82
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.82
KOG0334997 consensus RNA helicase [RNA processing and modific 99.81
KOG4284 980 consensus DEAD box protein [Transcription] 99.78
PRK09401 1176 reverse gyrase; Reviewed 99.78
KOG0346569 consensus RNA helicase [RNA processing and modific 99.77
PHA02558501 uvsW UvsW helicase; Provisional 99.73
PRK14701 1638 reverse gyrase; Provisional 99.73
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.72
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.72
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.72
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.7
COG1204 766 Superfamily II helicase [General function predicti 99.7
PRK13766773 Hef nuclease; Provisional 99.69
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.69
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.66
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.66
PRK09694878 helicase Cas3; Provisional 99.65
COG1205851 Distinct helicase family with a unique C-terminal 99.65
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.62
PRK05580679 primosome assembly protein PriA; Validated 99.62
KOG0354746 consensus DEAD-box like helicase [General function 99.61
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.61
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.6
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.59
COG1202830 Superfamily II helicase, archaea-specific [General 99.56
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.55
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.54
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.53
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.52
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.51
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.43
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.35
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.35
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.32
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.27
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.24
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.23
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.22
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.16
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.16
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.13
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.13
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.12
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.12
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.12
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.06
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.06
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.01
smart0049082 HELICc helicase superfamily c-terminal domain. 98.99
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.98
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.9
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.87
smart00487201 DEXDc DEAD-like helicases superfamily. 98.86
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 98.81
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 98.77
PRK05298652 excinuclease ABC subunit B; Provisional 98.74
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 98.72
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 98.61
PRK04914 956 ATP-dependent helicase HepA; Validated 98.52
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.35
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.31
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.31
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.26
KOG0353695 consensus ATP-dependent DNA helicase [General func 98.25
PRK12326764 preprotein translocase subunit SecA; Reviewed 98.03
COG4096875 HsdR Type I site-specific restriction-modification 98.0
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.89
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.79
PF1324576 AAA_19: Part of AAA domain 97.78
COG1198730 PriA Primosomal protein N' (replication factor Y) 97.63
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 97.6
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 97.53
CHL00122870 secA preprotein translocase subunit SecA; Validate 97.23
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 97.16
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 96.84
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.59
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.42
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 96.34
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 96.33
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 96.23
COG0556663 UvrB Helicase subunit of the DNA excision repair c 96.2
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.08
TIGR00376637 DNA helicase, putative. The gene product may repre 95.9
PF05729166 NACHT: NACHT domain 95.87
PRK10536262 hypothetical protein; Provisional 95.86
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.81
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 95.76
KOG1803649 consensus DNA helicase [Replication, recombination 95.75
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.51
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 95.46
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.43
PRK14974336 cell division protein FtsY; Provisional 95.08
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.07
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.07
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 95.02
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 94.95
PRK10416318 signal recognition particle-docking protein FtsY; 94.83
PRK10875615 recD exonuclease V subunit alpha; Provisional 94.82
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.69
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.4
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 94.26
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.09
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 94.04
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 93.98
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 93.95
PRK13833323 conjugal transfer protein TrbB; Provisional 93.79
PF1355562 AAA_29: P-loop containing region of AAA domain 93.53
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.49
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.13
PF02399824 Herpes_ori_bp: Origin of replication binding prote 93.13
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.94
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 92.92
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 92.76
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 92.56
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.52
COG3910233 Predicted ATPase [General function prediction only 92.51
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.47
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 92.35
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 92.21
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 92.21
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.11
smart00489289 DEXDc3 DEAD-like helicases superfamily. 92.09
smart00488289 DEXDc2 DEAD-like helicases superfamily. 92.09
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.94
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.94
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 91.69
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.56
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 91.53
PRK13851344 type IV secretion system protein VirB11; Provision 91.51
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 91.5
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 91.31
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 91.26
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 91.19
cd01124187 KaiC KaiC is a circadian clock protein primarily f 91.19
smart00382148 AAA ATPases associated with a variety of cellular 91.1
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 90.85
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 90.78
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 90.7
COG1126240 GlnQ ABC-type polar amino acid transport system, A 90.69
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 90.67
PRK10867433 signal recognition particle protein; Provisional 90.62
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 90.48
cd03115173 SRP The signal recognition particle (SRP) mediates 90.42
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 90.23
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.15
PRK00771437 signal recognition particle protein Srp54; Provisi 89.9
PF12846304 AAA_10: AAA-like domain 89.62
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 89.43
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 89.41
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 89.38
COG1136226 SalX ABC-type antimicrobial peptide transport syst 89.32
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 89.27
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 89.23
PF13173128 AAA_14: AAA domain 89.17
TIGR00959428 ffh signal recognition particle protein. This mode 89.08
TIGR00064272 ftsY signal recognition particle-docking protein F 89.06
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 88.98
PF00005137 ABC_tran: ABC transporter This structure is on hol 88.79
TIGR02533486 type_II_gspE general secretory pathway protein E. 88.73
PRK13764602 ATPase; Provisional 88.7
PRK10436462 hypothetical protein; Provisional 88.65
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 88.63
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 88.56
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 88.56
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 88.55
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 88.48
PRK11054684 helD DNA helicase IV; Provisional 88.4
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.33
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.26
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 88.15
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 88.03
PHA03311828 helicase-primase subunit BBLF4; Provisional 87.94
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 87.9
PRK08233182 hypothetical protein; Provisional 87.88
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 87.78
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 87.69
PRK08533230 flagellar accessory protein FlaH; Reviewed 87.52
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 87.47
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 87.44
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 87.42
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 87.32
PRK05973237 replicative DNA helicase; Provisional 87.3
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 87.26
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 87.15
PRK04296190 thymidine kinase; Provisional 87.06
PRK00300205 gmk guanylate kinase; Provisional 87.05
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 86.86
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 86.69
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 86.64
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 86.62
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 86.44
PRK13889988 conjugal transfer relaxase TraA; Provisional 86.28
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 86.03
COG1117253 PstB ABC-type phosphate transport system, ATPase c 86.02
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 85.9
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 85.9
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 85.83
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 85.7
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 85.64
PF00004132 AAA: ATPase family associated with various cellula 85.62
COG4525259 TauB ABC-type taurine transport system, ATPase com 85.56
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 85.51
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 85.49
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 85.47
PRK04328249 hypothetical protein; Provisional 85.44
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 85.41
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 85.37
PRK05541176 adenylylsulfate kinase; Provisional 85.37
TIGR00235207 udk uridine kinase. Model contains a number of lon 85.35
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 85.31
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 85.3
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 85.28
PHA02244383 ATPase-like protein 85.17
COG3973747 Superfamily I DNA and RNA helicases [General funct 85.16
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 84.76
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 84.73
PRK07667193 uridine kinase; Provisional 84.7
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 84.38
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 84.24
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 84.13
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 84.08
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 84.04
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 84.04
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 84.02
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 83.73
PRK14530215 adenylate kinase; Provisional 83.7
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 83.69
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 83.69
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 83.66
COG0802149 Predicted ATPase or kinase [General function predi 83.63
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 83.62
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 83.61
TIGR02237209 recomb_radB DNA repair and recombination protein R 83.58
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 83.56
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 83.54
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 83.53
cd01394218 radB RadB. The archaeal protein radB shares simila 83.5
cd03269210 ABC_putative_ATPase This subfamily is involved in 83.49
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 83.42
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 83.27
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 83.18
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 83.17
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 83.15
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 83.14
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 83.08
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 83.07
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 83.06
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 83.03
PRK14527191 adenylate kinase; Provisional 82.98
PRK07261171 topology modulation protein; Provisional 82.88
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 82.77
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 82.77
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 82.75
PRK14531183 adenylate kinase; Provisional 82.67
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 82.64
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 82.63
PRK11773721 uvrD DNA-dependent helicase II; Provisional 82.62
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 82.53
PRK08356195 hypothetical protein; Provisional 82.53
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 82.51
PRK06762166 hypothetical protein; Provisional 82.42
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 82.41
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 82.41
PRK00698205 tmk thymidylate kinase; Validated 82.38
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 82.33
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 82.31
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 82.29
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 82.18
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 82.17
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 82.16
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 82.09
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 82.09
PRK01184184 hypothetical protein; Provisional 82.06
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 82.05
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 82.01
cd03246173 ABCC_Protease_Secretion This family represents the 81.96
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 81.93
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 81.93
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 81.92
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 81.83
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 81.82
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 81.77
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 81.75
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 81.73
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 81.7
PRK05480209 uridine/cytidine kinase; Provisional 81.7
PRK14242253 phosphate transporter ATP-binding protein; Provisi 81.66
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 81.62
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 81.61
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 81.59
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 81.59
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 81.59
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 81.52
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 81.47
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 81.46
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 81.36
PRK06547172 hypothetical protein; Provisional 81.35
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 81.34
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 81.3
PRK12402337 replication factor C small subunit 2; Reviewed 81.21
PRK10908222 cell division protein FtsE; Provisional 81.13
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 81.07
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 81.04
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 80.96
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 80.91
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 80.9
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 80.85
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 80.81
TIGR02759566 TraD_Ftype type IV conjugative transfer system cou 80.79
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 80.76
PLN02165334 adenylate isopentenyltransferase 80.74
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 80.74
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 80.74
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 80.65
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 80.61
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 80.6
PRK04841 903 transcriptional regulator MalT; Provisional 80.55
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 80.51
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 80.51
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 80.48
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 80.43
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 80.42
PRK14738206 gmk guanylate kinase; Provisional 80.36
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 80.33
PRK08118167 topology modulation protein; Reviewed 80.32
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 80.26
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 80.25
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 80.22
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 80.18
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 80.17
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 80.12
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 80.08
PRK10646153 ADP-binding protein; Provisional 80.07
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 80.07
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-136  Score=1131.73  Aligned_cols=522  Identities=43%  Similarity=0.671  Sum_probs=485.2

Q ss_pred             CChhHHHhhhcCCCchhhHHHHHHHHHcCCeEEEEecCCCCccccHHHHHHHhccCCCCCCCCCceEEEecccHHHHHHH
Q 038192           22 SRPNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLAT  101 (764)
Q Consensus        22 ~~~~~~~~~R~~LPi~~~~~~Il~~l~~~~vviI~GeTGSGKTTqvPq~Lle~~~~~~~~~~~~~~Ii~tQPRRiaAisv  101 (764)
                      .....++++|+.|||++++++|++++++|||+||.|||||||||||||||+|++|...      ++|.||||||+||++|
T Consensus        38 ~~~~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~------g~I~~TQPRRVAavsl  111 (674)
T KOG0922|consen   38 STNLSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASS------GKIACTQPRRVAAVSL  111 (674)
T ss_pred             ccccCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccC------CcEEeecCchHHHHHH
Confidence            4456799999999999999999999999999999999999999999999999999865      4799999999999999


Q ss_pred             HHHHHHHhCCCCCCEeeEEeccCcccCCCceEEEEchHHHHHHHHH----------HHHHHHH-----HHhhccccCCcc
Q 038192          102 AKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKA----------LYEKQQQ-----LLRSGQCIEPKD  166 (764)
Q Consensus       102 A~RVa~E~g~~lG~~VGY~ir~e~~~s~~t~I~f~T~GiLLr~l~~----------i~de~~~-----~l~~~~~~~~~~  166 (764)
                      |+|||+|+|+.+|+.|||+||||+++++.|+|+|+|+|+|||++..          ++||+|+     +++.|+++.+.+
T Consensus       112 A~RVAeE~~~~lG~~VGY~IRFed~ts~~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~  191 (674)
T KOG0922|consen  112 AKRVAEEMGCQLGEEVGYTIRFEDSTSKDTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILK  191 (674)
T ss_pred             HHHHHHHhCCCcCceeeeEEEecccCCCceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999953          5688763     678888888888


Q ss_pred             CCCCceEEEeecccchhhhccccCCCCCCCeeeeCCcccceeEEecCCCchhhHHHHHHHHHHHHhhcCCCCCeEEecCC
Q 038192          167 RVFPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTG  246 (764)
Q Consensus       167 ~~~~lKlILMSATl~~~~f~~~~~~f~~~~vi~i~gr~~pV~~~y~~~~~~~d~l~~~~~~v~~i~~~~~~g~ilvF~~g  246 (764)
                      ++++||||+||||+|+++|+   .||++||++.||||+|||+++|++... .||+.+++..+++||.++++||||||+||
T Consensus       192 ~R~~LklIimSATlda~kfS---~yF~~a~i~~i~GR~fPVei~y~~~p~-~dYv~a~~~tv~~Ih~~E~~GDILvFLtG  267 (674)
T KOG0922|consen  192 KRPDLKLIIMSATLDAEKFS---EYFNNAPILTIPGRTFPVEILYLKEPT-ADYVDAALITVIQIHLTEPPGDILVFLTG  267 (674)
T ss_pred             cCCCceEEEEeeeecHHHHH---HHhcCCceEeecCCCCceeEEeccCCc-hhhHHHHHHHHHHHHccCCCCCEEEEeCC
Confidence            99999999999999999999   699999999999999999999999776 89999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhhhhccccccCCccccCCCCCccccchhHHhHHHHHhhcCcccccccccCCCCCcccccCccc
Q 038192          247 QREVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNE  326 (764)
Q Consensus       247 ~~~ie~l~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~  326 (764)
                      ++|||.+|+.|++..+..                                                              
T Consensus       268 qeEIe~~~~~l~e~~~~~--------------------------------------------------------------  285 (674)
T KOG0922|consen  268 QEEIEAACELLRERAKSL--------------------------------------------------------------  285 (674)
T ss_pred             HHHHHHHHHHHHHHhhhc--------------------------------------------------------------
Confidence            999999999997632100                                                              


Q ss_pred             cccccCccchhhhhhccchhhhhhhcCCCCCCCCcccccccchhhhhHHHHHHhhcCCCCCCCccccCCCCCCCCcCCCC
Q 038192          327 LDALSDSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTEL  406 (764)
Q Consensus       327 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ilvfl~g~~~i~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  406 (764)
                                                                                               ++     
T Consensus       286 -------------------------------------------------------------------------~~-----  287 (674)
T KOG0922|consen  286 -------------------------------------------------------------------------PE-----  287 (674)
T ss_pred             -------------------------------------------------------------------------cc-----
Confidence                                                                                     00     


Q ss_pred             CCCCCCCCCCCCCCCccccccCcccCCCCCeEEEecCCCCCHHHHHhhhccCCCCceEEEEecCcccccCCCCCeEEEEe
Q 038192          407 PPTPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVD  486 (764)
Q Consensus       407 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~pLHs~l~~~eQ~~vf~~~~~g~rKVIlsTNIAEtSITIpdV~~VID  486 (764)
                                                +.+. .++|+||.|+.++|.+||.+.|+|.|||||||||||||||||+|+||||
T Consensus       288 --------------------------~~~~-~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVD  340 (674)
T KOG0922|consen  288 --------------------------DCPE-LILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVD  340 (674)
T ss_pred             --------------------------cCcc-eeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEc
Confidence                                      1122 7999999999999999999999999999999999999999999999999


Q ss_pred             CCcccceeeccCCCccccceeeccHHhHHHhccccCCCCCCEEEEccCHHHhcccCCCCCCCcccccChhhHHHHHHHcC
Q 038192          487 TGREKVKKYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMKSMN  566 (764)
Q Consensus       487 ~G~~K~~~yd~~~~~~~l~~~~iSkasa~QR~GRAGR~~~G~cyrLys~~~~~~~l~~~~~PEI~r~~L~~~~L~lk~l~  566 (764)
                      +|++|++.|||.+++++|..+|||||+|+||+|||||++||+||||||+.+|+ .|++.+.|||+|++|..++|++|++|
T Consensus       341 sG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGRAGRt~pGkcyRLYte~~~~-~~~~~~~PEI~R~~Ls~~vL~Lkalg  419 (674)
T KOG0922|consen  341 SGFVKQKKYNPRTGLDSLIVVPISKASANQRAGRAGRTGPGKCYRLYTESAYD-KMPLQTVPEIQRVNLSSAVLQLKALG  419 (674)
T ss_pred             CCceEEEeeccccCccceeEEechHHHHhhhcccCCCCCCceEEEeeeHHHHh-hcccCCCCceeeechHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999995 59999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHcccccCCCCccH-HHHHHhcCCCChHHHHHHHHHHhhhhhhhhhhhccchhhh
Q 038192          567 IDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTA-LGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYG  645 (764)
Q Consensus       567 ~~~~~~f~~~~pP~~~~i~~ai~~L~~lgAld~~~~LT~-LG~~la~LPvdp~lgkmLl~~~~~~~~~~~~~~~~~l~~~  645 (764)
                      ++++..|+|+|||+++++..|++.|+.+||||++|.||. +|+.|+.||++|.++|||+.+..+          +|+..+
T Consensus       420 i~d~l~F~f~d~P~~~~l~~AL~~L~~lgald~~g~lt~p~G~~ma~~Pl~p~lsk~ll~s~~~----------gc~~e~  489 (674)
T KOG0922|consen  420 INDPLRFPFIDPPPPEALEEALEELYSLGALDDRGKLTSPLGRQMAELPLEPHLSKMLLKSSEL----------GCSEEI  489 (674)
T ss_pred             CCCcccCCCCCCCChHHHHHHHHHHHhcCcccCcCCcCchHHhhhhhcCCCcchhhhhhhcccc----------CCcchh
Confidence            999999999999999999999999999999999999998 999999999999999999987542          588889


Q ss_pred             HHhhhcccCCcceeeccccccCCCCCchhhhhcccCCCCChhhHHHHhhhhhHHHHHHHHHhhcCCCCCcHHHHHHHHHH
Q 038192          646 VAAAAALSVSNPFVLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQC  725 (764)
Q Consensus       646 ~~iaA~ls~~~~F~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~f~~~~sD~lt~ln~~~~  725 (764)
                      ++|||+||++++|..|.+..                                 .+.++..|++|.++.|||+|+||+|..
T Consensus       490 l~i~a~Lsv~~~f~~p~~~~---------------------------------~~~a~~~~~kf~~~eGDh~tlL~vy~~  536 (674)
T KOG0922|consen  490 LTIAAMLSVQSVFSRPKDKK---------------------------------AEDADRKRAKFANPEGDHLTLLNVYES  536 (674)
T ss_pred             hhheeeeeccceecCccchh---------------------------------hhhhhHHHHhhcCcccCHHHHHHHHHH
Confidence            99999999999999875321                                 124677899999999999999999999


Q ss_pred             HHhcCCcHHHHHHhcCCHHHHHHHHHHHHHHHHHHHhcC
Q 038192          726 FELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN  764 (764)
Q Consensus       726 ~~~~~~~~~~C~~~~l~~~~l~~i~~ir~QL~~~l~~~g  764 (764)
                      |..++...+||++||+|++.|+.+.++|+||.+++..++
T Consensus       537 ~~~~~~~~~wC~en~i~~r~l~~a~~ir~QL~~i~~~~~  575 (674)
T KOG0922|consen  537 WKENGTSKKWCKENFINARSLKRAKDIRKQLRRILDKFG  575 (674)
T ss_pred             HHhcCChhhHHHHhcccHHHHHHHHHHHHHHHHHHHHcC
Confidence            999999999999999999999999999999999997654

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-33
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-27
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-33
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-27
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-22
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/251 (34%), Positives = 137/251 (54%), Gaps = 25/251 (9%)
Query: 31  RKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQF-LFEAGFGSNRCSSRSGRIG 89
           R++LP+     E ++   +N  ++  GETG GKTTQ+PQF LF+           + ++ 
Sbjct: 90  RRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFD-----EMPHLENTQVA 144
Query: 90  VTQPRRVAVLATAKRVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELK--- 146
            TQPRRVA ++ A+RVA E+ + LG+EVG+ +R + K  +   +K+MTDG+LLRE     
Sbjct: 145 CTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDH 204
Query: 147 --------ALYEKQQQLLRS----GQCIEPKDRVFPLKLILMSATLRVEDFISGGRLFRN 194
                    L E  ++ L +    G   +   R   LK+I+MSATL  E F    R F +
Sbjct: 205 DLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKF---QRYFND 261
Query: 195 PPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQREVEYLC 254
            P++ VP R +PV ++++   +  DY+  A + V+ IH     G IL+F+TG+ E+E   
Sbjct: 262 APLLAVPGRTYPVELYYTPEFQ-RDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAV 320
Query: 255 SKLRKASKQLL 265
            K+     QL+
Sbjct: 321 RKISLEGDQLV 331
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 2e-84
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 6e-62
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-53
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-34
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 6e-27
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 6e-33
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-23
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 6e-33
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-27
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 6e-31
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-27
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-28
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-26
1yks_A440 Genome polyprotein [contains: flavivirin protease 5e-27
1yks_A440 Genome polyprotein [contains: flavivirin protease 5e-25
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-26
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 4e-24
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 3e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  283 bits (726), Expect = 2e-84
 Identities = 108/347 (31%), Positives = 154/347 (44%), Gaps = 65/347 (18%)

Query: 429 NKRAGVGALCVLPLYAMLPAAAQLRVFEDVKEGE-----RLVVVSTNVAETSLTIPGIKY 483
            +  G G L V PLY  LP   Q R+FE   E       R VV+STN+AETSLTI GI Y
Sbjct: 331 VREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVY 390

Query: 484 VVDTGREKVKKYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILP 543
           VVD G  K K YN    +ES  +  ISKASA QRAGRAGRT PG C+RLY+   F   L 
Sbjct: 391 VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELI 450

Query: 544 DFSCAEISKVPVDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRL 603
           + S  EI +  +   VL +K + ID + +F F  PP    ++ A   L  L  LD  G L
Sbjct: 451 EQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNL 510

Query: 604 TALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAA-----AAALSVSNPF 658
           T LG+  + +P+ P  + ML+   +               +  +       A LSV N F
Sbjct: 511 TPLGRLASQFPLDPMLAVMLIGSFE---------------FQCSQEILTIVAMLSVPNVF 555

Query: 659 VLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLT 718
           +                          P   +++         A  +   F++P  D +T
Sbjct: 556 I-------------------------RPTKDKKR---------ADDAKNIFAHPDGDHIT 581

Query: 719 V-----AYALQCFELSKSPVEFCNEYALHLKTMEEMSKLRKQLLHLL 760
           +     A+            ++C ++ L+ +++     +R QL  L+
Sbjct: 582 LLNVYHAFKSDEAY-EYGIHKWCRDHYLNYRSLSAADNIRSQLERLM 627
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query764
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.97
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.97
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.97
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.97
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.97
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.97
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.97
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.96
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.96
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.96
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.96
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.96
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.95
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.95
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.95
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.95
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.95
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.95
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.95
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.95
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.95
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.95
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.95
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.94
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.94
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.92
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.92
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.92
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.92
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.91
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.91
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.91
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.91
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.9
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.9
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.89
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.88
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.87
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.87
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.87
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.86
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.86
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.83
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.81
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.77
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.75
3h1t_A590 Type I site-specific restriction-modification syst 99.73
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.56
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.53
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.53
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.53
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.52
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.52
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.51
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.49
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.49
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.48
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.47
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.47
3bor_A237 Human initiation factor 4A-II; translation initiat 99.46
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.45
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.45
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.45
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.44
3jux_A822 Protein translocase subunit SECA; protein transloc 99.44
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.43
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.43
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.42
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.42
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.42
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.42
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.4
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.38
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.34
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.02
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.17
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.14
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.01
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.86
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.58
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.53
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.51
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.83
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.13
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 96.65
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.69
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 95.35
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 94.8
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 94.72
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.29
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.1
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.02
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 93.12
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.95
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 92.9
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.71
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.63
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 90.55
2eyu_A261 Twitching motility protein PILT; pilus retraction 90.14
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 90.06
2oap_1511 GSPE-2, type II secretion system protein; hexameri 89.98
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.86
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.76
3co5_A143 Putative two-component system transcriptional RES 89.66
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 89.65
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 89.07
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 89.05
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 88.96
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 88.88
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 88.7
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.65
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.5
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 88.44
1vma_A306 Cell division protein FTSY; TM0570, structural gen 88.42
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.4
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.35
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 88.23
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.19
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 88.11
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 87.76
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 87.7
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.53
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 87.53
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 87.41
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 87.37
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 87.37
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 87.13
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 87.04
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 86.88
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 86.8
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 86.68
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 86.6
3vaa_A199 Shikimate kinase, SK; structural genomics, center 86.59
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 86.25
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 86.09
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 86.03
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 85.71
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 85.54
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 85.5
2kjq_A149 DNAA-related protein; solution structure, NESG, st 85.45
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 85.42
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 85.36
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 85.32
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 85.22
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 85.12
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 85.11
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 85.08
1kag_A173 SKI, shikimate kinase I; transferase, structural g 85.05
2chg_A226 Replication factor C small subunit; DNA-binding pr 85.04
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 85.02
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 84.91
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 84.85
2ewv_A372 Twitching motility protein PILT; pilus retraction 84.76
4a74_A231 DNA repair and recombination protein RADA; hydrola 84.73
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 84.72
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.57
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 84.49
1p9r_A418 General secretion pathway protein E; bacterial typ 84.41
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 84.26
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 84.24
3kta_A182 Chromosome segregation protein SMC; structural mai 84.02
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 83.93
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 83.87
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 83.86
1sgw_A214 Putative ABC transporter; structural genomics, P p 83.81
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 83.79
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 83.75
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.74
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 83.67
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 83.61
2cvh_A220 DNA repair and recombination protein RADB; filamen 83.53
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 83.5
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 83.49
1g6h_A257 High-affinity branched-chain amino acid transport 83.39
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 83.32
1b0u_A262 Histidine permease; ABC transporter, transport pro 83.25
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 83.2
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 83.17
1ji0_A240 ABC transporter; ATP binding protein, structural g 83.03
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 82.98
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 82.95
2ghi_A260 Transport protein; multidrug resistance protein, M 82.95
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 82.83
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 82.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 82.8
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 82.78
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 82.76
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 82.75
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 82.66
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 82.63
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 82.61
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 82.59
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 82.58
2vli_A183 Antibiotic resistance protein; transferase, tunica 82.55
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 82.55
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 82.46
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 82.43
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 82.39
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 82.36
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 82.34
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 82.16
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 82.12
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 82.01
3bos_A242 Putative DNA replication factor; P-loop containing 82.01
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 82.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 81.96
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 81.95
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 81.89
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 81.89
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 81.82
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 81.82
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 81.76
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 81.58
2og2_A359 Putative signal recognition particle receptor; nuc 81.47
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 81.23
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 81.22
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 81.16
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 81.15
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 81.12
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 80.9
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 80.84
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 80.84
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 80.82
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 80.82
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 80.68
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 80.62
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 80.61
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 80.54
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 80.54
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 80.49
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 80.49
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 80.42
3tlx_A243 Adenylate kinase 2; structural genomics, structura 80.36
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 80.35
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 80.31
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 80.3
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 80.28
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 80.19
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 80.18
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 80.17
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 80.17
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 80.04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=3.8e-90  Score=827.35  Aligned_cols=525  Identities=36%  Similarity=0.585  Sum_probs=467.6

Q ss_pred             hhHHHhhhcCCCchhhHHHHHHHHHcCCeEEEEecCCCCccccHHHHHHHhccCCCCCCCCCceEEEecccHHHHHHHHH
Q 038192           24 PNEVENNRKDLPIVMMEQEIMEAVNDNSAVIICGETGCGKTTQVPQFLFEAGFGSNRCSSRSGRIGVTQPRRVAVLATAK  103 (764)
Q Consensus        24 ~~~~~~~R~~LPi~~~~~~Il~~l~~~~vviI~GeTGSGKTTqvPq~Lle~~~~~~~~~~~~~~Ii~tQPRRiaAisvA~  103 (764)
                      ..++.+.|..||++.++++|+.++.++++++|+|+|||||||++|+++++..+..+.    ..+|+|++|||++|.++++
T Consensus        83 ~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~----g~~ilvl~P~r~La~q~~~  158 (773)
T 2xau_A           83 YVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLE----NTQVACTQPRRVAAMSVAQ  158 (773)
T ss_dssp             HHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGG----TCEEEEEESCHHHHHHHHH
T ss_pred             HHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCC----CceEEecCchHHHHHHHHH
Confidence            467788889999999999999999999999999999999999999999987654321    1579999999999999999


Q ss_pred             HHHHHhCCCCCCEeeEEeccCcccCCCceEEEEchHHHHHHHHH----------HHHHHHH-HHh----hccccCCccCC
Q 038192          104 RVAFELGLHLGKEVGFQVRHDKKIGDSCSIKFMTDGILLRELKA----------LYEKQQQ-LLR----SGQCIEPKDRV  168 (764)
Q Consensus       104 RVa~E~g~~lG~~VGY~ir~e~~~s~~t~I~f~T~GiLLr~l~~----------i~de~~~-~l~----~~~~~~~~~~~  168 (764)
                      +++++++..+|..|||++++++..+.+++|+|+|+|+|++.+..          |+||+|. ++.    .+++..+...+
T Consensus       159 ~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~  238 (773)
T 2xau_A          159 RVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRR  238 (773)
T ss_dssp             HHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhC
Confidence            99999999999999999999999889999999999999998854          5688884 444    23333333445


Q ss_pred             CCceEEEeecccchhhhccccCCCCCCCeeeeCCcccceeEEecCCCchhhHHHHHHHHHHHHhhcCCCCCeEEecCCHH
Q 038192          169 FPLKLILMSATLRVEDFISGGRLFRNPPIIEVPTRQFPVTVHFSKRTEIVDYIGQAYKKVMSIHKRLPQGGILVFVTGQR  248 (764)
Q Consensus       169 ~~lKlILMSATl~~~~f~~~~~~f~~~~vi~i~gr~~pV~~~y~~~~~~~d~l~~~~~~v~~i~~~~~~g~ilvF~~g~~  248 (764)
                      +++++|+||||++.+.|.   +||++++++.++|+.|||+++|..... .+++......+.+++...++|++|||++++.
T Consensus       239 ~~~~iIl~SAT~~~~~l~---~~~~~~~vi~v~gr~~pv~~~~~~~~~-~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~  314 (773)
T 2xau_A          239 PDLKIIIMSATLDAEKFQ---RYFNDAPLLAVPGRTYPVELYYTPEFQ-RDYLDSAIRTVLQIHATEEAGDILLFLTGED  314 (773)
T ss_dssp             TTCEEEEEESCSCCHHHH---HHTTSCCEEECCCCCCCEEEECCSSCC-SCHHHHHHHHHHHHHHHSCSCEEEEECSCHH
T ss_pred             CCceEEEEeccccHHHHH---HHhcCCCcccccCcccceEEEEecCCc-hhHHHHHHHHHHHHHHhcCCCCEEEECCCHH
Confidence            789999999999999998   699999999999999999999987765 7888888888888888878999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhhccccccCCccccCCCCCccccchhHHhHHHHHhhcCcccccccccCCCCCcccccCccccc
Q 038192          249 EVEYLCSKLRKASKQLLVNSSKENKGNQVVADSEPNATKDINMKEINEAFEIQGYSTEQQTDRFSSYDEDQFDIDDNELD  328 (764)
Q Consensus       249 ~ie~l~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~  328 (764)
                      +++.++..|.+......                                                               
T Consensus       315 ~i~~l~~~L~~~~~~l~---------------------------------------------------------------  331 (773)
T 2xau_A          315 EIEDAVRKISLEGDQLV---------------------------------------------------------------  331 (773)
T ss_dssp             HHHHHHHHHHHHHHHHH---------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHhhc---------------------------------------------------------------
Confidence            99999988865221100                                                               


Q ss_pred             cccCccchhhhhhccchhhhhhhcCCCCCCCCcccccccchhhhhHHHHHHhhcCCCCCCCccccCCCCCCCCcCCCCCC
Q 038192          329 ALSDSETESETEILGEDEKLVEQKCPMDGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPP  408 (764)
Q Consensus       329 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ilvfl~g~~~i~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  408 (764)
                                                                       ...                            
T Consensus       332 -------------------------------------------------~~~----------------------------  334 (773)
T 2xau_A          332 -------------------------------------------------REE----------------------------  334 (773)
T ss_dssp             -------------------------------------------------HHH----------------------------
T ss_pred             -------------------------------------------------ccc----------------------------
Confidence                                                             000                            


Q ss_pred             CCCCCCCCCCCCCccccccCcccCCCCCeEEEecCCCCCHHHHHhhhccCC-----CCceEEEEecCcccccCCCCCeEE
Q 038192          409 TPTPEQCPELSSPDVEKMGDNKRAGVGALCVLPLYAMLPAAAQLRVFEDVK-----EGERLVVVSTNVAETSLTIPGIKY  483 (764)
Q Consensus       409 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~pLHs~l~~~eQ~~vf~~~~-----~g~rKVIlsTNIAEtSITIpdV~~  483 (764)
                                              ...++.+.++||+|++++|.++|+.++     +|.+||||||||||+|||||+|+|
T Consensus       335 ------------------------~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~  390 (773)
T 2xau_A          335 ------------------------GCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVY  390 (773)
T ss_dssp             ------------------------CCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEE
T ss_pred             ------------------------cCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEE
Confidence                                    113578999999999999999999999     999999999999999999999999


Q ss_pred             EEeCCcccceeeccCCCccccceeeccHHhHHHhccccCCCCCCEEEEccCHHHhcccCCCCCCCcccccChhhHHHHHH
Q 038192          484 VVDTGREKVKKYNSANGIESYEIQWISKASAAQRAGRAGRTAPGHCYRLYSSAVFNNILPDFSCAEISKVPVDGVVLLMK  563 (764)
Q Consensus       484 VID~G~~K~~~yd~~~~~~~l~~~~iSkasa~QR~GRAGR~~~G~cyrLys~~~~~~~l~~~~~PEI~r~~L~~~~L~lk  563 (764)
                      |||+|++|++.||+.++++.|.+.|+|+++|.||+|||||.++|.||+||++..|...|++++.|||+|.+|++++|++|
T Consensus       391 VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~  470 (773)
T 2xau_A          391 VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELK  470 (773)
T ss_dssp             EEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHH
T ss_pred             EEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999996568999999999999999999999


Q ss_pred             HcCCCCCCCCCCCCCCCHHHHHHHHHHHHHcccccCCCCccHHHHHHhcCCCChHHHHHHHHHHhhhhhhhhhhhccchh
Q 038192          564 SMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLG  643 (764)
Q Consensus       564 ~l~~~~~~~f~~~~pP~~~~i~~ai~~L~~lgAld~~~~LT~LG~~la~LPvdp~lgkmLl~~~~~~~~~~~~~~~~~l~  643 (764)
                      .+|++++..|+|++||+.+++..|++.|..+||||.+|+||++|+.|+.||+||++||||+.|..+          .|+.
T Consensus       471 ~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~~~~~~----------~c~~  540 (773)
T 2xau_A          471 KLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEF----------QCSQ  540 (773)
T ss_dssp             HTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHHHGGGG----------TCHH
T ss_pred             HcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHHhhccc----------Cchh
Confidence            999999999999999999999999999999999999999999999999999999999999988542          5888


Q ss_pred             hhHHhhhcccCCcceeeccccccCCCCCchhhhhcccCCCCChhhHHHHhhhhhHHHHHHHHHhhcCCCCCcHHHHHHHH
Q 038192          644 YGVAAAAALSVSNPFVLQLEGTQTNSNDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYAL  723 (764)
Q Consensus       644 ~~~~iaA~ls~~~~F~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~f~~~~sD~lt~ln~~  723 (764)
                      ++++|||+||+++||+.|.+.                                  +++++.++++|.++.|||++++|+|
T Consensus       541 ~~l~i~a~ls~~~~f~~~~~~----------------------------------~~~~~~~~~~f~~~~~D~~~~l~~~  586 (773)
T 2xau_A          541 EILTIVAMLSVPNVFIRPTKD----------------------------------KKRADDAKNIFAHPDGDHITLLNVY  586 (773)
T ss_dssp             HHHHHHHHHTSCCCBCCCTTC----------------------------------HHHHHHHHHTTCCTTBHHHHHHHHH
T ss_pred             HHHHHHHhcccCCcccCChHH----------------------------------HHHHHHHHHhccCCCCcHHHHHHHH
Confidence            999999999999999987432                                  1456778899999999999999999


Q ss_pred             HHHHhcC---Cc-HHHHHHhcCCHHHHHHHHHHHHHHHHHHHhcC
Q 038192          724 QCFELSK---SP-VEFCNEYALHLKTMEEMSKLRKQLLHLLFNQN  764 (764)
Q Consensus       724 ~~~~~~~---~~-~~~C~~~~l~~~~l~~i~~ir~QL~~~l~~~g  764 (764)
                      ++|....   .. .+||++||||+++|+++.++|.||.++|.+.|
T Consensus       587 ~~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~~~~~~  631 (773)
T 2xau_A          587 HAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYN  631 (773)
T ss_dssp             HHHTSHHHHHHCHHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHhccccchHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhcC
Confidence            9996543   33 78999999999999999999999999998654
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 764
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 6e-31
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-17
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 8e-16
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-11
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 3e-06
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 8e-04
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 0.002
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  121 bits (304), Expect = 6e-31
 Identities = 27/188 (14%), Positives = 57/188 (30%), Gaps = 8/188 (4%)

Query: 439 VLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGRE-KVKKYNS 497
           V+ L           + +     +   +++T++AE    +  ++ V+D     K    + 
Sbjct: 63  VVVLNRKTFEREYPTIKQK----KPDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDE 117

Query: 498 ANGIESYEIQWISKASAAQRAGRAGRTAPG-HCYRLYSSAVFNNILPDFSCAEISKVPVD 556
              +       IS +SAAQR GR GR          YS     N      C   + + +D
Sbjct: 118 GRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYYYSEPTSENNAH-HVCWLEASMLLD 176

Query: 557 GVVLLMKSMNIDKVSNFPFPTPPEVTALVEAERCLKALEALDSNGRLTALGKAMAHYPMS 616
            + +    +                   +  ++     E + +      L   +A   + 
Sbjct: 177 NMEVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLK 236

Query: 617 PRHSRMLL 624
               +   
Sbjct: 237 TNDRKWCF 244
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query764
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.95
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.62
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.6
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.55
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.55
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.54
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.54
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.53
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.53
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.51
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.5
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.47
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.45
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.42
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.42
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.42
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.35
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.34
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.34
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.32
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.31
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.27
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.25
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.21
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.18
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.15
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.12
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.11
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.04
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.76
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 98.67
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.67
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.65
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.32
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.17
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.97
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.67
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.37
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.15
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.98
d1okkd2207 GTPase domain of the signal recognition particle r 96.7
d1vmaa2213 GTPase domain of the signal recognition particle r 96.55
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.34
d2qy9a2211 GTPase domain of the signal recognition particle r 96.22
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.96
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.48
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.37
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 95.13
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.94
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.03
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.0
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.71
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 92.98
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.65
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.15
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.1
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.04
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.04
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 90.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 90.67
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.37
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.33
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 89.77
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.77
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 89.47
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.44
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 89.36
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.17
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 89.17
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 88.72
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 88.69
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.66
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.66
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 88.61
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.53
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.25
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 88.24
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 88.19
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.11
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.05
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.89
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.88
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.75
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.35
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.79
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.78
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 86.77
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 86.49
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 86.45
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 86.42
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 86.3
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 86.28
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 86.1
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 85.95
d2hyda1255 Putative multidrug export ATP-binding/permease pro 85.91
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.89
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 85.8
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 85.52
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 85.3
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 85.23
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 84.77
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 84.65
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 84.6
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.58
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 84.45
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.25
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 84.17
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 83.89
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 83.85
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 83.66
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 83.57
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 83.09
d1g2912240 Maltose transport protein MalK, N-terminal domain 82.84
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 82.81
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 82.69
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 82.63
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 82.52
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 82.32
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 82.06
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 81.85
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 81.81
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 81.58
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 81.34
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 81.29
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.12
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 80.88
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 80.87
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 80.76
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 80.63
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=99.96  E-value=4.7e-33  Score=293.18  Aligned_cols=258  Identities=13%  Similarity=0.018  Sum_probs=190.3

Q ss_pred             CCCCCcccccccchhhhhHHHHHHhhcCCCCCCCccccCCCCCCCCcCCCCCCCCCCCCCCCCCCCccccccCcccCCCC
Q 038192          356 DGDDPVDVLKENWSLGSLKLAFEVLSGKNASGPSSQMKLSTPAIPEQCTELPPTPTPEQCPELSSPDVEKMGDNKRAGVG  435 (764)
Q Consensus       356 ~~~~ilvfl~g~~~i~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  435 (764)
                      .+|.+++|+|+..++..+...+...                                                       
T Consensus        35 ~~g~~~~F~~s~~~~~~~a~~L~~~-------------------------------------------------------   59 (299)
T d1yksa2          35 DKRPTAWFLPSIRAANVMAASLRKA-------------------------------------------------------   59 (299)
T ss_dssp             CCSCEEEECSCHHHHHHHHHHHHHT-------------------------------------------------------
T ss_pred             cCCCEEEEeCCHHHHHHHHHHHHhc-------------------------------------------------------
Confidence            4789999999999999888776542                                                       


Q ss_pred             CeEEEecCCCCCHHHHHhhhccCCCCceEEEEecCcccccCCCCCeEEEEeCCcc-cceeeccCCCccccceeeccHHhH
Q 038192          436 ALCVLPLYAMLPAAAQLRVFEDVKEGERLVVVSTNVAETSLTIPGIKYVVDTGRE-KVKKYNSANGIESYEIQWISKASA  514 (764)
Q Consensus       436 ~~~i~pLHs~l~~~eQ~~vf~~~~~g~rKVIlsTNIAEtSITIpdV~~VID~G~~-K~~~yd~~~~~~~l~~~~iSkasa  514 (764)
                      ++.|++|||.++.+++.++    ++|.++|||||||||+|||| ||+||||||+. |...||+.+++..+...|||+|++
T Consensus        60 g~~V~~l~~~~~~~e~~~~----~~~~~~~~~~t~~~~~~~~~-~~~~vid~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (299)
T d1yksa2          60 GKSVVVLNRKTFEREYPTI----KQKKPDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSA  134 (299)
T ss_dssp             TCCEEECCSSSCC------------CCCSEEEESSSTTCCTTC-CCSEEEECCEEEEEEEETTTTEEEEEEEEECCHHHH
T ss_pred             CCeEEEEcCcCcHhHHhhh----hcCCcCEEEEechhhhceec-CceEEEecCceeceeeecCCCCeeEEeeeecCHHHH
Confidence            3568999999999998765    46789999999999999999 69999999994 889999999999999999999999


Q ss_pred             HHhccccCCCCCC-EEEEccCHHHhcccCCCCCCCcccccC----hhhHHHHHHHcCCCCCCCCCCCCCCCHHHHHHHHH
Q 038192          515 AQRAGRAGRTAPG-HCYRLYSSAVFNNILPDFSCAEISKVP----VDGVVLLMKSMNIDKVSNFPFPTPPEVTALVEAER  589 (764)
Q Consensus       515 ~QR~GRAGR~~~G-~cyrLys~~~~~~~l~~~~~PEI~r~~----L~~~~L~lk~l~~~~~~~f~~~~pP~~~~i~~ai~  589 (764)
                      .||+|||||+.+| .||.+|+...     .+...+++.+..    |.++.+.++.+|......|+|+++|+.+....+..
T Consensus       135 ~qr~gr~gr~~~~~~~~~~y~~~~-----~~d~~~~~~~te~~i~l~~i~l~~~~~g~~~~~e~~~~~~p~g~~~L~~~~  209 (299)
T d1yksa2         135 AQRRGRIGRNPNRDGDSYYYSEPT-----SENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQ  209 (299)
T ss_dssp             HHHHTTSSCCTTCCCEEEEECSCC-----CCCCTTBHHHHHHHHHHTTSCCGGGCCCCCSTTHHHHSSSCTTTTCCCHHH
T ss_pred             HHhcccccccCCCceEEEEeCCCC-----CCcccchhhhhhHHHHhhCcccccccccccchhhhccccCCCchhhhhHhH
Confidence            9999999999653 4666776532     233445554444    34444567777877777888889888887778899


Q ss_pred             HHHHcccccCCCCccHHHHHHhcCCCChHHHHHHHHHHhhhhhhhhhhhccchhhhHHhhhcccCCcceeeccccccCCC
Q 038192          590 CLKALEALDSNGRLTALGKAMAHYPMSPRHSRMLLTLIQTMKVKSYARANLVLGYGVAAAAALSVSNPFVLQLEGTQTNS  669 (764)
Q Consensus       590 ~L~~lgAld~~~~LT~LG~~la~LPvdp~lgkmLl~~~~~~~~~~~~~~~~~l~~~~~iaA~ls~~~~F~~p~~~~~~~~  669 (764)
                      .|..+|||+..+-+|+||+.++.+++.+...+++                                  |..|.+....  
T Consensus       210 ~l~~l~aL~~~d~p~~La~~va~~~~~~~~~~~~----------------------------------f~~P~e~~i~--  253 (299)
T d1yksa2         210 RKVFRELVRNCDLPVWLSWQVAKAGLKTNDRKWC----------------------------------FEGPEEHEIL--  253 (299)
T ss_dssp             HHHHHHHHHTTCCCHHHHHHHHHTTCCTTCCGGG----------------------------------SCSCGGGCCB--
T ss_pred             HHHHHHHHhhcCCCcchHHHHHhcccccccccce----------------------------------eECchhchhh--
Confidence            9999999998888888998888887766554442                                  2222211000  


Q ss_pred             CCchhhhhcccCCCCChhhHHHHhhhhhHHHHHHHHHhhcCCCCCcHHHHHHHHHHHHhcCCcHHHHHHhcCCHHHHH
Q 038192          670 NDSELEERDNALDSEDPMCRQEKLGKRKLKEVAKLSHAKFSNPTSDVLTVAYALQCFELSKSPVEFCNEYALHLKTME  747 (764)
Q Consensus       670 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~f~~~~sD~lt~ln~~~~~~~~~~~~~~C~~~~l~~~~l~  747 (764)
                                                     +.+.....|..+.|||+++++.|  |.....+..||.+||+.+..|+
T Consensus       254 -------------------------------~~~~~~~~f~~~~Gd~~~L~~r~--~D~R~~sd~~~l~nFiq~a~~r  298 (299)
T d1yksa2         254 -------------------------------NDSGETVKCRAPGGAKKPLRPRW--CDERVSSDQSALSEFIKFAEGR  298 (299)
T ss_dssp             -------------------------------CTTSCBCEEECTTSCEEECCCSS--EEGGGSSSHHHHHHHHHHHTTT
T ss_pred             -------------------------------hhhccccceeCCCcceeeeeeeE--ecccccCcHHHHHHHHHHHhcC
Confidence                                           00001235668889999998876  2222345689999999998775
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure