Citrus Sinensis ID: 038229

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MAPAALPSRNEPCWGEPKVYARRHSSATTTTTVATSAANYRDTKNNNIPKCNNPPLFQSKPNPNQNKETRAHDPTSNVHFKKTPTPAQPQSLPESDYVTFNLGAYTRRELKDLRKRLVSDLERVRNLGSRIANSDFQATHAYPTTKSQNRGGSKRANPFGNPKAKRAAAGTXSLTSTKNAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQGILGRGKAREMSLEEKMALGRSLEELPQEELGKLLGIVKKRNSGNGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKKAEKDKTEKEPMCSQVAVAVAAPVVIERSKKGDVAAEEEVDIGEEIPVQNYPPVVIERDDASSGTSTSSTDSEDSSSSTSSGSGSSSSSDDDTAQSPFPGA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHcccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHcccccHHHHcccccccccccccccccccHcccHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccc
mapaalpsrnepcwgepkvyarrhssatttttvatsaanyrdtknnnipkcnnpplfqskpnpnqnketrahdptsnvhfkktptpaqpqslpesdyvtfnlGAYTRRELKDLRKRLVSDLERVRNLgsriansdfqathaypttksqnrggskranpfgnpkakraaagtxsltSTKNAMRRCGEILTKLMKdkqgwafntpvDVVSLRLRDYHdiikkpmdlgtvrsklennvykcpqeFAEDVRLTFnnalvynpkghYVYAMAETLSAKFEQMFQKLSKQQQRQGILGRGKAREMSLEEKMALGRSLEELPQEELGKLLGIVkkrnsgngslschgdeiELDIEALDNDTLSQLVRFVDNFKKaekdktekepmcSQVAVAVAAPVvierskkgdvaaeeevdigeeipvqnyppvvierddassgtstsstdsedsssstssgsgsssssdddtaqspfpgA
mapaalpsrnepcwgepkvyarrhssatttttvatsaanyrdtknnnipKCNNPPLFQSKPNPNQNKETRAHDPTSNVHFKKtptpaqpqslpesdyVTFNLGAYTRRELKDLRKRLVSDLERvrnlgsriansdfqathaypttksqnrggskranpfgnpkakraaagtxsltstknAMRRCGEILTKlmkdkqgwafntpvdvvSLRLRDYHDiikkpmdlgtvrSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQGILGRGKAREMSLEEKMAlgrsleelpQEELGKLLGIVKKRNSGNGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKkaekdktekepmcsqvaVAVAAPVVIERSKKGDVAaeeevdigeeipvqnyppvVIERDDAssgtstsstdsedsssstssgsgsssssdddtaqspfpgA
MAPAALPSRNEPCWGEPKVYARRHssatttttvatsaaNYRDTknnnipkcnnppLFQSKPNPNQNKETRAHDPTSNVHFKKTPTPAQPQSLPESDYVTFNLGAYTRRELKDLRKRLVSDLERVRNLGSRIANSDFQATHAYPTTKSQNRGGSKRANPFGNPKAKRAAAGTxSLTSTKNAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQGILGRGKAREMSLEEKMALGRSLEELPQEELGKLLGIVKKRNSGNGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKKAEKDKTEKEPMCSQvavavaapvvIERSKKGDVAAEEEVDIGEEIPVQNYPPVVIERDDAssgtstsstdsedsssstssgsgsssssdddtAQSPFPGA
************************************************************************************************YVTFNLGAYTRRELKDLRKRLVSDLERVR********************************************************RRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKF***********************************************LLGIV*********LSCHGDEIELDIEALDNDTLSQLVRFVDNF*************CSQVAVAVAAPVVIE**************************************************************************
*************************************************************************************************************************************************************************************RRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQR**ILGRGKAR*******************************************DEIELDIEALDNDTLSQLV**************************************************EEI*******************************************************
********RNEPCWGEPKVY************VATSAANYRDTKNNNIPKCNNPPLFQSKPN*****************************LPESDYVTFNLGAYTRRELKDLRKRLVSDLERVRNLGSRIANSDFQATHAYP***********RANPF******************KNAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQM*********************MSLEEKMALGRSLEELPQEELGKLLGIVKKRNSGNGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKK**********MCSQVAVAVAAPVVIERSKKGDVAAEEEVDIGEEIPVQNYPPVVIE*******************************************A
*****************************************************************************************************************************************************************************LTSTKNAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQGILGRGKAREMSLEEKMALGRSLEELPQEELGKLLGIVKKRNSGNGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKKAEKDKTEKEPMCSQVAVA*******************EVDIGEEIPVQNYPPVVIERDDA****************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPAALPSRNEPCWGEPKVYARRHSSATTTTTVATSAANYRDTKNNNIPKCNNPPLFQSKPNPNQNKETRAHDPTSNVHFKKTPTPAQPQSLPESDYVTFNLGAYTxxxxxxxxxxxxxxxxxxxxxGSRIANSDFQATHAYPTTKSQNRGGSKRANPFGNPKAKRAAAGTXSLTSTKNAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQGILGRGKAREMSLEEKMALGRSLEELPQEELGKLLGIVKKRNSGNGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKKAEKDKTEKEPMCSQVAVAVAAPVVIERSKKGDVAAEEEVDIGEEIPVQNYPPVVIERDDASSGTSTSSTDSEDSSSSTSSGSGSSSSSDDDTAQSPFPGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query467 2.2.26 [Sep-21-2011]
Q9LXA7 581 Transcription factor GTE2 yes no 0.417 0.335 0.442 3e-42
Q7Y214 590 Transcription factor GTE7 no no 0.396 0.313 0.405 1e-40
Q9S7T1461 Transcription factor GTE3 no no 0.406 0.412 0.437 7e-40
Q93YS6 688 Transcription factor GTE9 no no 0.721 0.489 0.311 5e-39
Q8H1D7487 Transcription factor GTE5 no no 0.387 0.371 0.427 1e-35
Q9FGW9 1061 Transcription factor GTE1 no no 0.693 0.305 0.293 5e-35
Q93ZB7 620 Transcription factor GTE1 no no 0.646 0.487 0.325 6e-34
Q9LK27 813 Transcription factor GTE8 no no 0.586 0.337 0.316 4e-33
Q9LNC4766 Transcription factor GTE4 no no 0.226 0.138 0.513 1e-28
Q84XV2386 Transcription factor GTE1 no no 0.599 0.725 0.284 2e-24
>sp|Q9LXA7|GTE2_ARATH Transcription factor GTE2 OS=Arabidopsis thaliana GN=GTE2 PE=2 SV=2 Back     alignment and function desciption
 Score =  173 bits (438), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 120/217 (55%), Gaps = 22/217 (10%)

Query: 96  DYVTFNLGAYTRRELKDLRKRLVSDLERVRNLGSRIANSDFQATHAYPTTKSQNRG---- 151
           DYV+F+L  YT  +L++L+KRL S+LE VR L  RI +  F +   Y T      G    
Sbjct: 68  DYVSFDLDGYTSNQLRELKKRLNSELEEVRFLRERIESGTFVSGSVYTTQARSFAGETND 127

Query: 152 ---------------GSKRANPFGN--PKAKR-AAAGTXSLTSTKNAMRRCGEILTKLMK 193
                          G KR+NPF    P  KR  A    S    K+ M  CG+IL KLMK
Sbjct: 128 VGVKKTKTKKKKIGHGQKRSNPFATDEPSLKRHVALDLMSEKVLKSMMTTCGQILVKLMK 187

Query: 194 DKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNA 253
            K  W F  PVDVV L L DYH I+ KPMDLGTV+  LE  +Y+ P +FA DVRLTF NA
Sbjct: 188 HKWSWVFLNPVDVVGLGLHDYHRIVDKPMDLGTVKMNLEKGLYRSPIDFASDVRLTFTNA 247

Query: 254 LVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQGI 290
           + YNPKG  VY MAE L ++F+  F    K+ + Q +
Sbjct: 248 MSYNPKGQDVYLMAEKLLSQFDVWFNPTLKRFEAQEV 284

Arabidopsis thaliana (taxid: 3702)
>sp|Q7Y214|GTE7_ARATH Transcription factor GTE7 OS=Arabidopsis thaliana GN=GTE7 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7T1|GTE3_ARATH Transcription factor GTE3, chloroplastic OS=Arabidopsis thaliana GN=GTE3 PE=1 SV=1 Back     alignment and function description
>sp|Q93YS6|GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana GN=GTE9 PE=1 SV=1 Back     alignment and function description
>sp|Q8H1D7|GTE5_ARATH Transcription factor GTE5, chloroplastic OS=Arabidopsis thaliana GN=GTE5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FGW9|GTE10_ARATH Transcription factor GTE10 OS=Arabidopsis thaliana GN=GTE10 PE=1 SV=2 Back     alignment and function description
>sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK27|GTE8_ARATH Transcription factor GTE8 OS=Arabidopsis thaliana GN=GTE8 PE=2 SV=2 Back     alignment and function description
>sp|Q9LNC4|GTE4_ARATH Transcription factor GTE4 OS=Arabidopsis thaliana GN=GTE4 PE=2 SV=1 Back     alignment and function description
>sp|Q84XV2|GTE1_ARATH Transcription factor GTE1 OS=Arabidopsis thaliana GN=GTE1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
224103835224 global transcription factor group [Popul 0.396 0.825 0.495 2e-49
359496779499 PREDICTED: LOW QUALITY PROTEIN: transcri 0.753 0.705 0.330 2e-49
359475584561 PREDICTED: transcription factor GTE2-lik 0.458 0.381 0.449 7e-49
296088086564 unnamed protein product [Vitis vinifera] 0.451 0.374 0.446 1e-48
356554832529 PREDICTED: uncharacterized protein LOC10 0.520 0.459 0.406 2e-46
224056335474 global transcription factor group [Popul 0.576 0.567 0.386 4e-46
356554838536 PREDICTED: transcription factor GTE11-li 0.573 0.5 0.396 3e-45
356549487531 PREDICTED: uncharacterized protein LOC10 0.385 0.338 0.492 5e-45
326489531510 predicted protein [Hordeum vulgare subsp 0.550 0.503 0.374 5e-45
357127683494 PREDICTED: transcription factor GTE4-lik 0.550 0.520 0.380 6e-45
>gi|224103835|ref|XP_002313212.1| global transcription factor group [Populus trichocarpa] gi|222849620|gb|EEE87167.1| global transcription factor group [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/216 (49%), Positives = 141/216 (65%), Gaps = 31/216 (14%)

Query: 181 MRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQ 240
           M+ C +IL+KLMK K G+ FNTPVDVV L+L DYHDIIK PMDLGTV++ L  N+Y+ P+
Sbjct: 2   MKNCSQILSKLMKQKLGYIFNTPVDVVGLQLHDYHDIIKNPMDLGTVKTNLSKNLYESPR 61

Query: 241 EFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKL-SKQQQRQGI--------- 290
           +FA DVRLTFNNA+ YNPKGH VY +AE    +F+ +++ +  KQQQ  G+         
Sbjct: 62  DFAADVRLTFNNAMKYNPKGHEVYILAEQFLTRFQDLYRPIKEKQQQPTGMNQNPNSVRT 121

Query: 291 -----------LGRGK-------AREMSLEEKMALGRSLEELPQEELGKLLGIVKKRNSG 332
                      L + K        REM+LEEK  LG  L+ LPQE++ +++ I++KR   
Sbjct: 122 PSPMRVPQVKPLKQPKPKAKDPNKREMNLEEKHKLGVGLQSLPQEKMEQVVQIIRKR--- 178

Query: 333 NGSLSCHGDEIELDIEALDNDTLSQLVRFVDNFKKA 368
           NG L   GDEIELDIEA+D +TL +L RFV N+KK 
Sbjct: 179 NGHLRQEGDEIELDIEAVDTETLWELDRFVTNYKKM 214

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359496779|ref|XP_002264867.2| PREDICTED: LOW QUALITY PROTEIN: transcription factor GTE2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475584|ref|XP_003631709.1| PREDICTED: transcription factor GTE2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088086|emb|CBI35445.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554832|ref|XP_003545746.1| PREDICTED: uncharacterized protein LOC100819363 [Glycine max] Back     alignment and taxonomy information
>gi|224056335|ref|XP_002298808.1| global transcription factor group [Populus trichocarpa] gi|222846066|gb|EEE83613.1| global transcription factor group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356554838|ref|XP_003545749.1| PREDICTED: transcription factor GTE11-like [Glycine max] Back     alignment and taxonomy information
>gi|356549487|ref|XP_003543125.1| PREDICTED: uncharacterized protein LOC100802622 [Glycine max] Back     alignment and taxonomy information
>gi|326489531|dbj|BAK01746.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357127683|ref|XP_003565508.1| PREDICTED: transcription factor GTE4-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
TAIR|locus:2155715 590 GTE7 "AT5G65630" [Arabidopsis 0.456 0.361 0.401 2.9e-67
TAIR|locus:2032692461 GTE3 "AT1G73150" [Arabidopsis 0.413 0.418 0.431 5.4e-51
TAIR|locus:2030958487 AT1G17790 "AT1G17790" [Arabido 0.396 0.379 0.424 1.1e-48
TAIR|locus:2038565766 GTE4 "AT1G06230" [Arabidopsis 0.316 0.193 0.423 7e-42
TAIR|locus:2082289 620 BET10 "AT3G01770" [Arabidopsis 0.441 0.332 0.351 1.7e-37
TAIR|locus:2086498 813 GTE8 "AT3G27260" [Arabidopsis 0.338 0.194 0.386 3.6e-35
TAIR|locus:2044722386 IMB1 "AT2G34900" [Arabidopsis 0.445 0.538 0.32 1.6e-29
UNIPROTKB|H9L2H3 859 LOC100859056 "Uncharacterized 0.308 0.167 0.394 1.3e-26
ZFIN|ZDB-GENE-030131-267 1444 brd4 "bromodomain containing 4 0.254 0.082 0.455 6.6e-26
UNIPROTKB|O60885 1362 BRD4 "Bromodomain-containing p 0.304 0.104 0.395 4e-25
TAIR|locus:2155715 GTE7 "AT5G65630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 2.9e-67, Sum P(3) = 2.9e-67
 Identities = 96/239 (40%), Positives = 127/239 (53%)

Query:    73 DPTSNVHFKKTPTPAQPQSLPE-SDYVTFNLGAYTRRELKDLRKRLVSDLERVRNLGSRI 131
             +P  N +F+++ +  Q     E   Y TFNL  YT  +L++L+KR  S+L+++R L  RI
Sbjct:    42 NPNPNPNFERSNSSKQCDDSSEFGSYATFNLAGYTSSQLRELKKRFTSELKQIRILRERI 101

Query:   132 ANSDFQATHAY-----PTTKS---QNRGGSKRANPFGNPKAKRAAAGTXSLT-------- 175
              +  F+    Y     P  +S    N  G K  N  G PK K+       L         
Sbjct:   102 ESGTFETQQGYTIPEVPAVRSAPLNNFTGEK--NDLG-PKKKKQKKNVSGLKRSNQFGPS 158

Query:   176 ---STK---NAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRS 229
                S K     +  C +IL KLMK K  W FNTPVDVV L L DYH ++KKPMDLGTV+ 
Sbjct:   159 DPESEKLLAGMLNTCSQILVKLMKHKWAWVFNTPVDVVGLGLHDYHQVVKKPMDLGTVKL 218

Query:   230 KLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQRQ 288
              L+   Y  P +FA DVRLTF+NA+ YNPKG  VY MA+ L   F+ MF    K+ + Q
Sbjct:   219 NLDKGFYVSPIDFATDVRLTFDNAMTYNPKGQDVYFMADKLLDHFDGMFNPAFKKFEAQ 277
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0009294 "DNA mediated transformation" evidence=RCA;IMP
TAIR|locus:2032692 GTE3 "AT1G73150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030958 AT1G17790 "AT1G17790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038565 GTE4 "AT1G06230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082289 BET10 "AT3G01770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086498 GTE8 "AT3G27260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044722 IMB1 "AT2G34900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H9L2H3 LOC100859056 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-267 brd4 "bromodomain containing 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O60885 BRD4 "Bromodomain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GTE912
global transcription factor group (224 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 7e-53
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 2e-38
cd0436999 cd04369, Bromodomain, Bromodomain 2e-29
smart00297107 smart00297, BROMO, bromo domain 1e-28
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 4e-28
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 2e-26
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-25
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 2e-24
pfam0043984 pfam00439, Bromodomain, Bromodomain 3e-23
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 6e-23
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 1e-22
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 4e-20
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 3e-17
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 6e-16
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 2e-15
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 2e-14
COG5076371 COG5076, COG5076, Transcription factor involved in 6e-14
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 8e-14
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 4e-12
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 1e-11
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 1e-11
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-11
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 2e-11
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 3e-11
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 3e-09
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 4e-09
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 4e-09
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 7e-09
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 2e-08
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 2e-08
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 5e-07
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 1e-06
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 1e-05
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 4e-05
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 7e-05
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 4e-04
cd05491119 cd05491, Bromo_TBP7_like, Bromodomain; TBP7_like s 0.002
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information 
 Score =  172 bits (438), Expect = 7e-53
 Identities = 60/99 (60%), Positives = 71/99 (71%)

Query: 180 AMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCP 239
            M++CG +L KLMK K GW FN PVDVV+L L DY DIIKKPMDLGTV+ KLE   Y  P
Sbjct: 1   VMKQCGTLLRKLMKHKWGWVFNAPVDVVALGLPDYFDIIKKPMDLGTVKKKLEKGEYSSP 60

Query: 240 QEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMF 278
           +EFA DVRLTF NA+ YNP G+ V+ MA+ L   FE  +
Sbjct: 61  EEFAADVRLTFANAMRYNPPGNDVHTMAKELLKIFETRW 99

Might function as a global transcription factor. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 99
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99923 cd05491, Bromo_TBP7_like, Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 467
KOG1474640 consensus Transcription initiation factor TFIID, s 100.0
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.95
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.95
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.95
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.94
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.94
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.94
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.94
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.93
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.93
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.93
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.93
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.93
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.93
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.93
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.93
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.93
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.92
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.92
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.91
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.91
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.91
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.9
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.9
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.9
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.89
smart00297107 BROMO bromo domain. 99.89
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.89
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.89
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.88
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.88
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.86
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.86
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.86
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.85
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.84
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.74
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.7
COG5076371 Transcription factor involved in chromatin remodel 99.68
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.42
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.4
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 99.25
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.0
KOG00081563 consensus Transcription initiation factor TFIID, s 98.91
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.83
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.77
KOG00081563 consensus Transcription initiation factor TFIID, s 98.67
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.61
KOG1472 720 consensus Histone acetyltransferase SAGA/ADA, cata 98.57
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 98.19
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.08
COG5076371 Transcription factor involved in chromatin remodel 96.81
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.69
PF05110 1191 AF-4: AF-4 proto-oncoprotein; InterPro: IPR007797 92.01
KOG06441113 consensus Uncharacterized conserved protein, conta 90.2
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 86.8
PHA03308 1463 transcriptional regulator ICP4; Provisional 86.24
PF05110 1191 AF-4: AF-4 proto-oncoprotein; InterPro: IPR007797 85.31
KOG3116177 consensus Predicted C3H1-type Zn-finger protein [G 82.61
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-40  Score=364.75  Aligned_cols=277  Identities=34%  Similarity=0.565  Sum_probs=211.9

Q ss_pred             CCCcEEEecCCCCHHHHHHHHHHHHHHHHHHHhhhhhhc-ccccccCC---CCCCC----C---------ccC-CCCCCC
Q 038229           94 ESDYVTFNLGAYTRRELKDLRKRLVSDLERVRNLGSRIA-NSDFQATH---AYPTT----K---------SQN-RGGSKR  155 (467)
Q Consensus        94 ~~~~~~f~~s~~s~~er~~Lr~Rl~~eLe~VR~l~~ki~-~~~~~~~~---~~~~~----~---------~~~-~~~~k~  155 (467)
                      ....+.+.+.++++.+++++..||+.+|++||.+.++++ ........   +..+.    .         .++ .....+
T Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~  184 (640)
T KOG1474|consen  105 GPKASKIPLDKDSSSQVRKLSERLKQELQQVRPLTKAVEFSPEPSVVSPVSPASQPFKSKNGVKKVADTCVKSYKSKSER  184 (640)
T ss_pred             ccccccCcCCCCchhhhhhhhhccccccccCCcccccccccccccccCCCCCcccccccccchhhhhccccccccccCcC
Confidence            555667899999999999999999999999999999997 11111111   11110    0         000 000001


Q ss_pred             CCCCCCCccccccCC---------------CCCCcchHHHHHHHHHHHHHHHcCCCCccccCCCccccccCCCcccccCC
Q 038229          156 ANPFGNPKAKRAAAG---------------TXSLTSTKNAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKK  220 (467)
Q Consensus       156 ~~p~~~~~~kr~~~~---------------~~~~~~~~~~~k~c~~IL~~L~~~~~a~~F~~PVd~~~l~~PdY~~iIk~  220 (467)
                      ..+.+. +......+               ......+..++++|..||.+||+|+++|+|+.|||++.||+||||+||+|
T Consensus       185 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~C~~iLk~l~~~k~awpF~~PVD~v~LgLpDY~~IIK~  263 (640)
T KOG1474|consen  185 EPSPGQ-KREGTVAPNSSRESGDSAAEEEAKPKSKLTVELLKQCLSILKRLMKHKHAWPFNEPVDVVKLGLPDYHDIIKH  263 (640)
T ss_pred             CCCccc-cccccccCccccccccccccccccccccccHHHHHHHHHHHHHHHhccCCCCcCCCcCHHhcCCcchhhhcCC
Confidence            111000 00000000               00112567899999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHhhCCCCCCHHHHHHHHHHhhhhhhhcCCCCCHHHHHHHHHHHHHHHHHHHHHHhhh--------------
Q 038229          221 PMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQQQ--------------  286 (467)
Q Consensus       221 PMDL~TIk~KL~~~~Y~s~~eF~~DVrLIf~NA~~YN~~~S~v~~~A~~L~~~Fe~~~~~ie~~~~--------------  286 (467)
                      ||||+||++||.+|.|.++.||++||||||.|||+||++|++||.||..|+++|+.+|..+.....              
T Consensus       264 PMDLgTIK~kL~~~~Y~~~~eF~~DVRL~F~Ncm~YNp~g~dV~~Ma~~L~~~Fe~rw~~~~~~~~~~~~~~~~~~~~~~  343 (640)
T KOG1474|consen  264 PMDLGTIKKKLEKGEYKSAEEFAADVRLTFDNCMTYNPEGSDVYAMAKKLQEVFEERWASMPLEIEESESAVKEEAGMAS  343 (640)
T ss_pred             CccHHHHHhhhcccccCCHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhcccccccccccccccccccc
Confidence            999999999999999999999999999999999999999999999999999999999997432200              


Q ss_pred             ------------h-------hc----c--------------------------------------------------cC-
Q 038229          287 ------------R-------QG----I--------------------------------------------------LG-  292 (467)
Q Consensus       287 ------------r-------~~----~--------------------------------------------------~~-  292 (467)
                                  +       .+    .                                                  .+ 
T Consensus       344 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~e~~~~~~~~~~  423 (640)
T KOG1474|consen  344 SDQIPSNSVEGPRSSSFESRESASEPSSELMSEEERKKLLAELKLLLKDVPPQLIALLQRPVSKPPRKIEEELESDKRPL  423 (640)
T ss_pred             ccccccccccCcccccchhcccccCcccccccHHhhhhhHhhhhcchhhhhHHHHhhhhccccCcccccccccccccccc
Confidence                        0       00    0                                                  00 


Q ss_pred             --------C--------cccccccHHHHHHHHHHhcc-CCHHHHHHHHHHH--HhhcCCCCCCCCCCCeeEEecccCC--
Q 038229          293 --------R--------GKAREMSLEEKMALGRSLEE-LPQEELGKLLGIV--KKRNSGNGSLSCHGDEIELDIEALD--  351 (467)
Q Consensus       293 --------k--------~k~r~mt~eEk~~L~~~i~~-L~~e~l~~Vi~II--~~~~~~~p~~~~~~deIEIDId~L~--  351 (467)
                              +        ..++.||..++..|...+.. +++..+..+++|+  ..+.   +.+.+.+++|++|++.++  
T Consensus       424 ~~~~~~~~~~~~~~~~~~~~r~~t~~~~~~l~~~~~~~~~p~~l~~~~~~~~~~~~~---~~l~~~~~~~~~~~~~vd~~  500 (640)
T KOG1474|consen  424 VTGKLIKEKNKKEKAANENKRDMTAPEKAKLKELLQNLLPPNKLESIVEILKPEKRQ---LDLSQNDDEIELDLDSVDGS  500 (640)
T ss_pred             chhhhhhhhhccccccccccccccccccccchhhccCCCCCccccCcccccchhhhc---ccccccccchhhcccccccc
Confidence                    0        11678999999999999999 4899999999999  4466   777888999999999999  


Q ss_pred             -----------HHHHHHHHHHHHHHHHHhhhccc
Q 038229          352 -----------NDTLSQLVRFVDNFKKAEKDKTE  374 (467)
Q Consensus       352 -----------~~TL~eL~~yV~~~~k~~~k~kr  374 (467)
                                 .+|+|++.+++..+..+..+...
T Consensus       501 ~~~~~~~~~~~~e~~~~~~~~~~~~~~~~s~~~~  534 (640)
T KOG1474|consen  501 QSREPSSNPLEIETIRETLKLSTERELELSKASS  534 (640)
T ss_pred             cccCCCcccchhhhhhccccchhhHHHHHHHHhh
Confidence                       99999999999999877766544

>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>PF05110 AF-4: AF-4 proto-oncoprotein; InterPro: IPR007797 This family consist of family member 1 (proto-oncogene AF4), family member 2 or FMR2 (Fragile X E mental retardation syndrome), family member 3 or LAF4 (lymphoid nuclear protein related to AF4) and family member 4 (protein lilliputian) Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03308 transcriptional regulator ICP4; Provisional Back     alignment and domain information
>PF05110 AF-4: AF-4 proto-oncoprotein; InterPro: IPR007797 This family consist of family member 1 (proto-oncogene AF4), family member 2 or FMR2 (Fragile X E mental retardation syndrome), family member 3 or LAF4 (lymphoid nuclear protein related to AF4) and family member 4 (protein lilliputian) Back     alignment and domain information
>KOG3116 consensus Predicted C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 1e-21
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 2e-21
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 4e-21
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 1e-20
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 4e-20
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 4e-20
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 2e-19
2e7n_A117 Solution Structure Of The Second Bromodomain From H 2e-19
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 3e-19
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 5e-19
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 1e-16
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 1e-16
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-16
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-16
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 4e-16
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 4e-16
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 5e-16
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 6e-15
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 7e-15
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 1e-14
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 1e-14
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 1e-14
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-14
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 8e-14
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 1e-13
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 2e-13
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 2e-13
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 4e-13
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 5e-13
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 8e-11
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 7e-09
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 7e-09
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 8e-09
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 9e-09
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-08
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-08
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 1e-08
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-08
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 5e-08
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-07
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 3e-07
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 3e-07
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 3e-07
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 7e-07
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 2e-06
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 2e-06
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 3e-06
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 3e-06
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 3e-06
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 5e-06
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 7e-06
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 9e-06
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 1e-05
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 1e-05
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 1e-05
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 1e-05
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 2e-05
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 2e-05
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 2e-05
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 2e-05
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 2e-05
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 3e-05
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 3e-05
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 4e-05
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 4e-05
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 4e-05
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 5e-05
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 9e-05
2jns_A90 Solution Structure Of The Bromodomain-Containing Pr 9e-05
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 4e-04
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 6e-04
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 7e-04
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 64/112 (57%), Gaps = 3/112 (2%)
Query: 173 SLTSTKNAMRRCGEILTKLMKDKQG---WAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRS 229
           S+      ++ C  IL +L+  K     W F  PVD  +L L DYHDIIK PMDL TV+ 
Sbjct: 1   SMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKR 60
Query: 230 KLENNVYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKL 281
           K+EN  Y+  QEFA DVRL F+N   YNP  H V AMA  L   FE  + K+
Sbjct: 61  KMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKM 112
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|2JNS|A Chain A, Solution Structure Of The Bromodomain-Containing Protein 4 Et Domain Length = 90 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 8e-49
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 2e-47
3p1f_A119 CREB-binding protein; structural genomics consorti 3e-47
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 1e-45
4alg_A154 Bromodomain-containing protein 2; signaling protei 5e-45
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 1e-44
3fkm_X166 Signaling protein; bromodomain, malaria, structura 6e-44
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 3e-43
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 2e-41
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 4e-41
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-39
3d7c_A112 General control of amino acid synthesis protein 5; 5e-39
3nxb_A116 CAT eye syndrome critical region protein 2; struct 1e-38
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-38
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 6e-38
2d9e_A121 Peregrin; four-helix bundle, transcription activat 2e-37
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-37
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 1e-36
3rcw_A135 Bromodomain-containing protein 1; transcription, s 1e-35
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 1e-35
3uv4_A158 Second bromodomain of human transcription initiat 1e-34
3dai_A130 ATPase family AAA domain-containing protein 2; anc 1e-34
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 5e-34
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 7e-27
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-32
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-26
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-31
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 5e-31
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-30
2grc_A129 Probable global transcription activator SNF2L4; br 8e-30
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-29
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-29
2dat_A123 Possible global transcription activator SNF2L2; br 8e-29
2r0y_A311 Chromatin structure-remodeling complex protein RSC 5e-27
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-18
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 1e-26
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 4e-25
2r10_A361 Chromatin structure-remodeling complex protein RSC 8e-25
2r10_A361 Chromatin structure-remodeling complex protein RSC 2e-17
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 7e-23
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-18
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 6e-15
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
 Score =  162 bits (411), Expect = 8e-49
 Identities = 49/110 (44%), Positives = 62/110 (56%), Gaps = 3/110 (2%)

Query: 178 KNAMRRCGEILTKLMKDKQ---GWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENN 234
              ++ C  IL ++   K     W F  PVDV +L L DY DIIK PMD+ T++SKLE+ 
Sbjct: 8   SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESR 67

Query: 235 VYKCPQEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQ 284
            Y+  QEF  DVRL F+N   YNP  H V AMA  L   FE  F K+  +
Sbjct: 68  EYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE 117
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 90 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.95
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.95
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.95
3d7c_A112 General control of amino acid synthesis protein 5; 99.95
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.95
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.95
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.95
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.95
3p1f_A119 CREB-binding protein; structural genomics consorti 99.95
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.95
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.94
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.94
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.94
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.94
2dat_A123 Possible global transcription activator SNF2L2; br 99.94
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.94
2grc_A129 Probable global transcription activator SNF2L4; br 99.94
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.94
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.94
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.93
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.93
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.92
3uv4_A158 Second bromodomain of human transcription initiat 99.92
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.91
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.91
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.91
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.9
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.89
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.89
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.89
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.89
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.88
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.86
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.84
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.84
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.79
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.78
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.73
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 99.55
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.49
2lm0_A125 AF4/FMR2 family member 1/protein AF-9 chimera; int 95.14
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
Probab=99.95  E-value=2.4e-28  Score=213.05  Aligned_cols=102  Identities=30%  Similarity=0.554  Sum_probs=99.1

Q ss_pred             HHHHHHHHHHHHHHcCCCCccccCCCccccccCCCcccccCCCCCHHHHHHHhhCCCCCCHHHHHHHHHHhhhhhhhcCC
Q 038229          179 NAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNP  258 (467)
Q Consensus       179 ~~~k~c~~IL~~L~~~~~a~~F~~PVd~~~l~~PdY~~iIk~PMDL~TIk~KL~~~~Y~s~~eF~~DVrLIf~NA~~YN~  258 (467)
                      ..++.|..||..|++++.+++|.+||++..  +||||++|++||||+||++||++|.|.++++|.+||+|||.||+.||+
T Consensus        13 ~~~~~c~~il~~l~~~~~s~~F~~pv~~~~--~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~yN~   90 (117)
T 3g0l_A           13 KDLALCSMILTEMETHEDAWPFLLPVNLKL--VPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNE   90 (117)
T ss_dssp             THHHHHHHHHHHHHTSTTCGGGSSCCCTTT--STTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHHhCCCchhhcCcCChhh--cCChHHHcCCCCCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHCC
Confidence            478999999999999999999999999987  999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHH
Q 038229          259 KGHYVYAMAETLSAKFEQMFQKLS  282 (467)
Q Consensus       259 ~~S~v~~~A~~L~~~Fe~~~~~ie  282 (467)
                      +++.++.+|..|++.|++.|+++-
T Consensus        91 ~~s~~~~~A~~L~~~f~~~~~~~~  114 (117)
T 3g0l_A           91 DDSDIGRAGHNMRKYFEKKWTDTF  114 (117)
T ss_dssp             SSSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999874
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2lm0_A AF4/FMR2 family member 1/protein AF-9 chimera; intrinsically disordered, nuclear protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 467
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 4e-31
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 5e-28
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-27
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 4e-26
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 7e-26
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 7e-25
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: CREB-binding protein, CBP
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  113 bits (285), Expect = 4e-31
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 181 MRRCGEILTKLMK-DKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCP 239
            +     L  L + D +   F  PVD   L + DY DI+K PMDL T++ KL+   Y+ P
Sbjct: 8   RQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEP 67

Query: 240 QEFAEDVRLTFNNALVYNPKGHYVYAMAETLSAKFEQMFQKLSKQ 284
            ++ +DV L FNNA +YN K   VY     L+  FEQ    + + 
Sbjct: 68  WQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQS 112
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.94
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.94
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.93
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.93
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.92
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=9.3e-28  Score=202.71  Aligned_cols=100  Identities=23%  Similarity=0.405  Sum_probs=96.5

Q ss_pred             HHHHHHHHHHHHHHcCCCCccccCCCccccccCCCcccccCCCCCHHHHHHHhhCCCCCCHHHHHHHHHHhhhhhhhcCC
Q 038229          179 NAMRRCGEILTKLMKDKQGWAFNTPVDVVSLRLRDYHDIIKKPMDLGTVRSKLENNVYKCPQEFAEDVRLTFNNALVYNP  258 (467)
Q Consensus       179 ~~~k~c~~IL~~L~~~~~a~~F~~PVd~~~l~~PdY~~iIk~PMDL~TIk~KL~~~~Y~s~~eF~~DVrLIf~NA~~YN~  258 (467)
                      +++..|..||..|++|+.+++|..||++..  +||||++|++||||+||++||.+|.|.++.+|.+||+|||.||+.||+
T Consensus         2 ~L~~~l~~il~~l~~~~~s~~F~~pv~~~~--~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~   79 (102)
T d3d7ca1           2 QLYTTLKNLLAQIKSHPSAWPFMEPVKKSE--APDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNP   79 (102)
T ss_dssp             HHHHHHHHHHHHHHHSGGGGGGSSCCCTTT--STTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSC
T ss_pred             hHHHHHHHHHHHHHhCCCCCccCCCCChhh--CcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCC
Confidence            578899999999999999999999999876  999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHH
Q 038229          259 KGHYVYAMAETLSAKFEQMFQK  280 (467)
Q Consensus       259 ~~S~v~~~A~~L~~~Fe~~~~~  280 (467)
                      ++|.++.+|..|++.|++.+++
T Consensus        80 ~~s~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          80 PDSEYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             TTSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHhc
Confidence            9999999999999999998874
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure