Citrus Sinensis ID: 038287


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIMKGY
cccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHccccccc
cccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEEccc
lifkqlppdiftYNFLVKCLCKCRSLTTVYNFVDQMRaslgikpnlvTYTILIDNVCNTKNLREAMRLVSALsdsgfkpdcfvYNTIMKGY
lifkqlppdiFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVsalsdsgfkpdcfvYNTIMKGY
LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIMKGY
****QLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIM***
***KQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIMKGY
LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIMKGY
****QLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIMKGY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDCFVYNTIMKGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q84J71 463 Pentatricopeptide repeat- yes no 0.989 0.194 0.670 3e-32
Q9FFE3 535 Pentatricopeptide repeat- no no 0.912 0.155 0.380 1e-11
Q9FNL2 472 Pentatricopeptide repeat- no no 0.945 0.182 0.370 3e-11
Q9FIX3 747 Pentatricopeptide repeat- no no 0.934 0.113 0.348 4e-11
Q9SI78 485 Pentatricopeptide repeat- no no 0.923 0.173 0.341 4e-11
Q9LSL9 915 Pentatricopeptide repeat- no no 0.912 0.090 0.357 7e-11
Q9FIT7 974 Pentatricopeptide repeat- no no 0.978 0.091 0.333 8e-11
Q6NQ83 619 Pentatricopeptide repeat- no no 0.989 0.145 0.362 1e-10
Q9LSQ2659 Putative pentatricopeptid no no 0.989 0.136 0.274 1e-10
Q9ZVX5 743 Pentatricopeptide repeat- no no 0.923 0.113 0.376 1e-10
>sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 Back     alignment and function desciption
 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%)

Query: 1   LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTK 60
           L  K  PPD +TYNFL+K LCKC+ L  VY FVD+MR    +KP+LV++TILIDNVCN+K
Sbjct: 185 LTEKHSPPDTYTYNFLLKHLCKCKDLHVVYEFVDEMRDDFDVKPDLVSFTILIDNVCNSK 244

Query: 61  NLREAMRLVSALSDSGFKPDCFVYNTIMKGY 91
           NLREAM LVS L ++GFKPDCF+YNTIMKG+
Sbjct: 245 NLREAMYLVSKLGNAGFKPDCFLYNTIMKGF 275





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FFE3|PP388_ARATH Pentatricopeptide repeat-containing protein At5g16420, mitochondrial OS=Arabidopsis thaliana GN=At5g16420 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
255561341 458 pentatricopeptide repeat-containing prot 0.989 0.196 0.736 2e-34
449434442 464 PREDICTED: pentatricopeptide repeat-cont 0.956 0.187 0.761 3e-33
449508786 464 PREDICTED: pentatricopeptide repeat-cont 0.956 0.187 0.761 3e-33
147788269 472 hypothetical protein VITISV_032887 [Viti 0.989 0.190 0.670 9e-32
357512797 501 Pentatricopeptide repeat-containing prot 0.989 0.179 0.703 2e-31
297832386 462 pentatricopeptide repeat-containing prot 0.989 0.194 0.670 8e-31
21553611 463 unknown [Arabidopsis thaliana] 0.989 0.194 0.670 1e-30
18398498 463 pentatricopeptide repeat-containing prot 0.989 0.194 0.670 1e-30
42570815 349 pentatricopeptide repeat-containing prot 0.989 0.257 0.670 2e-30
356523086 456 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.967 0.192 0.7 2e-29
>gi|255561341|ref|XP_002521681.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539072|gb|EEF40668.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/91 (73%), Positives = 78/91 (85%)

Query: 1   LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTK 60
           L  K   PD FTYNFLVKCLCKCR+L+ VY+F+D+MR+S  ++PNLVTYTILIDNVCN+K
Sbjct: 180 LSLKHSKPDSFTYNFLVKCLCKCRALSNVYSFIDEMRSSFDLEPNLVTYTILIDNVCNSK 239

Query: 61  NLREAMRLVSALSDSGFKPDCFVYNTIMKGY 91
           NLREAMRL+  L + GFKPDCFVYNTIMKGY
Sbjct: 240 NLREAMRLLGILRECGFKPDCFVYNTIMKGY 270




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449434442|ref|XP_004135005.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449508786|ref|XP_004163411.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147788269|emb|CAN69960.1| hypothetical protein VITISV_032887 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357512797|ref|XP_003626687.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355520709|gb|AET01163.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297832386|ref|XP_002884075.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329915|gb|EFH60334.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21553611|gb|AAM62704.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18398498|ref|NP_565422.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75146596|sp|Q84J71.1|PP161_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17670 gi|28393395|gb|AAO42121.1| unknown protein [Arabidopsis thaliana] gi|28973597|gb|AAO64123.1| unknown protein [Arabidopsis thaliana] gi|330251570|gb|AEC06664.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42570815|ref|NP_973481.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|330251569|gb|AEC06663.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356523086|ref|XP_003530173.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g17670-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:2827891 463 AT2G17670 [Arabidopsis thalian 0.967 0.190 0.681 1.8e-30
TAIR|locus:2171352 535 AT5G16420 "AT5G16420" [Arabido 0.934 0.158 0.372 1.1e-11
TAIR|locus:2026172 485 NG1 "novel gene 1" [Arabidopsi 0.890 0.167 0.353 1.1e-11
TAIR|locus:2161408 472 AT5G46100 "AT5G46100" [Arabido 0.945 0.182 0.370 3.8e-11
TAIR|locus:2077061 619 AT3G22470 "AT3G22470" [Arabido 0.989 0.145 0.362 7.7e-11
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.934 0.113 0.348 1e-10
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.912 0.090 0.357 1.3e-10
TAIR|locus:2086032659 PPR40 "pentatricopeptide (PPR) 0.989 0.136 0.274 1.4e-10
TAIR|locus:2039415 743 AT2G16880 "AT2G16880" [Arabido 0.923 0.113 0.376 3.5e-10
TAIR|locus:2034760 637 AT1G12300 [Arabidopsis thalian 0.945 0.135 0.298 4.5e-10
TAIR|locus:2827891 AT2G17670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 336 (123.3 bits), Expect = 1.8e-30, P = 1.8e-30
 Identities = 60/88 (68%), Positives = 73/88 (82%)

Query:     4 KQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLR 63
             K  PPD +TYNFL+K LCKC+ L  VY FVD+MR    +KP+LV++TILIDNVCN+KNLR
Sbjct:   188 KHSPPDTYTYNFLLKHLCKCKDLHVVYEFVDEMRDDFDVKPDLVSFTILIDNVCNSKNLR 247

Query:    64 EAMRLVSALSDSGFKPDCFVYNTIMKGY 91
             EAM LVS L ++GFKPDCF+YNTIMKG+
Sbjct:   248 EAMYLVSKLGNAGFKPDCFLYNTIMKGF 275


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
TAIR|locus:2171352 AT5G16420 "AT5G16420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026172 NG1 "novel gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161408 AT5G46100 "AT5G46100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086032 PPR40 "pentatricopeptide (PPR) domain protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039415 AT2G16880 "AT2G16880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00011872001
SubName- Full=Chromosome undetermined scaffold_345, whole genome shotgun sequence; (472 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.002
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.004
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
 Score = 51.3 bits (124), Expect = 1e-10
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 8  PDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCN 58
          PD+ TYN L+   CK   +       ++M+   GIKPN+ TY+ILID +C 
Sbjct: 1  PDVVTYNTLIDGYCKKGKVEEALKLFNEMKKR-GIKPNVYTYSILIDGLCK 50


This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PLN03218 1060 maturation of RBCL 1; Provisional 99.86
PLN03218 1060 maturation of RBCL 1; Provisional 99.86
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.84
PLN03077 857 Protein ECB2; Provisional 99.81
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.81
PF1304150 PPR_2: PPR repeat family 99.8
PLN03077 857 Protein ECB2; Provisional 99.8
PF1304150 PPR_2: PPR repeat family 99.79
PF1285434 PPR_1: PPR repeat 99.5
PF1285434 PPR_1: PPR repeat 99.42
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.19
PF1381234 PPR_3: Pentatricopeptide repeat domain 99.14
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.11
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.07
PF1381234 PPR_3: Pentatricopeptide repeat domain 99.04
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 99.0
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.99
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.89
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.76
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.53
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 98.32
KOG4422 625 consensus Uncharacterized conserved protein [Funct 98.26
PRK11788389 tetratricopeptide repeat protein; Provisional 98.2
PRK11788389 tetratricopeptide repeat protein; Provisional 98.01
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.91
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.86
KOG3941 406 consensus Intermediate in Toll signal transduction 97.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.82
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.78
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.76
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 97.75
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.43
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 97.43
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.22
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.16
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.09
COG3629280 DnrI DNA-binding transcriptional activator of the 96.94
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.92
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.84
PF13762145 MNE1: Mitochondrial splicing apparatus component 96.82
PF1337173 TPR_9: Tetratricopeptide repeat 96.81
PRK15359144 type III secretion system chaperone protein SscB; 96.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.39
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.37
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.2
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.18
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.15
KOG4570 418 consensus Uncharacterized conserved protein [Funct 96.02
KOG2003 840 consensus TPR repeat-containing protein [General f 96.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.88
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.86
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.79
PRK15359144 type III secretion system chaperone protein SscB; 95.74
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.74
PRK11189 296 lipoprotein NlpI; Provisional 95.61
KOG3941 406 consensus Intermediate in Toll signal transduction 95.55
PRK12370 553 invasion protein regulator; Provisional 95.52
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.51
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 95.5
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 95.45
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.41
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.38
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.37
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.22
PF1342844 TPR_14: Tetratricopeptide repeat 95.16
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.09
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.06
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 95.05
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.04
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 95.04
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.97
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 94.91
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 94.59
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.54
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 94.45
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 94.4
PRK14574 822 hmsH outer membrane protein; Provisional 94.26
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 94.25
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 94.22
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.21
PRK12370 553 invasion protein regulator; Provisional 94.1
KOG2003 840 consensus TPR repeat-containing protein [General f 94.09
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.96
PRK10370198 formate-dependent nitrite reductase complex subuni 93.95
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.93
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.91
KOG1129 478 consensus TPR repeat-containing protein [General f 93.91
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 93.81
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 93.8
PF1342844 TPR_14: Tetratricopeptide repeat 93.74
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.6
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 93.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 93.52
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 93.43
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 93.35
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 93.32
CHL00033168 ycf3 photosystem I assembly protein Ycf3 93.22
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.13
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.02
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 93.0
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 92.96
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 92.93
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 92.82
PRK10803263 tol-pal system protein YbgF; Provisional 92.77
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 92.71
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 92.63
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 92.61
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 92.61
KOG1126 638 consensus DNA-binding cell division cycle control 92.56
PF13929292 mRNA_stabil: mRNA stabilisation 92.36
PRK14574 822 hmsH outer membrane protein; Provisional 92.28
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 92.27
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.25
PRK10370198 formate-dependent nitrite reductase complex subuni 92.02
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 92.0
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 91.91
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 91.73
PRK10564303 maltose regulon periplasmic protein; Provisional 91.7
PRK11189 296 lipoprotein NlpI; Provisional 91.63
PF12688120 TPR_5: Tetratrico peptide repeat 91.57
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.5
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 91.47
KOG1915 677 consensus Cell cycle control protein (crooked neck 91.16
PF13512142 TPR_18: Tetratricopeptide repeat 90.89
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 90.81
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 90.44
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 90.29
COG4783484 Putative Zn-dependent protease, contains TPR repea 90.24
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 90.08
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 90.04
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.99
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.61
KOG4567370 consensus GTPase-activating protein [General funct 89.6
KOG2076 895 consensus RNA polymerase III transcription factor 89.27
PF13762145 MNE1: Mitochondrial splicing apparatus component 89.23
KOG2796 366 consensus Uncharacterized conserved protein [Funct 89.12
COG4455 273 ImpE Protein of avirulence locus involved in tempe 88.75
KOG2047 835 consensus mRNA splicing factor [RNA processing and 88.73
PRK10564303 maltose regulon periplasmic protein; Provisional 88.72
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 88.39
KOG0553 304 consensus TPR repeat-containing protein [General f 88.22
COG3629280 DnrI DNA-binding transcriptional activator of the 88.11
COG3898 531 Uncharacterized membrane-bound protein [Function u 88.08
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 87.98
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 87.85
KOG3785557 consensus Uncharacterized conserved protein [Funct 87.66
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 87.41
KOG1128 777 consensus Uncharacterized conserved protein, conta 87.3
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 87.29
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 87.21
PF1343134 TPR_17: Tetratricopeptide repeat 86.93
PRK10803263 tol-pal system protein YbgF; Provisional 86.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 86.92
KOG1129 478 consensus TPR repeat-containing protein [General f 86.89
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 86.55
KOG4570 418 consensus Uncharacterized conserved protein [Funct 86.54
KOG3616 1636 consensus Selective LIM binding factor [Transcript 86.24
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 85.95
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 85.94
KOG1126638 consensus DNA-binding cell division cycle control 85.9
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 85.77
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.77
KOG1070 1710 consensus rRNA processing protein Rrp5 [RNA proces 85.62
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 85.48
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 85.48
KOG0547 606 consensus Translocase of outer mitochondrial membr 85.47
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 85.33
KOG4340 459 consensus Uncharacterized conserved protein [Funct 85.2
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 85.11
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.01
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 84.89
KOG3785557 consensus Uncharacterized conserved protein [Funct 84.68
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.13
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.85
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 83.75
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 83.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 83.6
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 83.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 83.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 83.47
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 83.42
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 83.4
KOG4555175 consensus TPR repeat-containing protein [Function 83.06
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 82.77
PF13170 297 DUF4003: Protein of unknown function (DUF4003) 82.16
COG5108 1117 RPO41 Mitochondrial DNA-directed RNA polymerase [T 81.85
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 81.34
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 80.99
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 80.85
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 80.69
COG4105 254 ComL DNA uptake lipoprotein [General function pred 80.44
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 80.16
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 80.13
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=99.86  E-value=2e-21  Score=130.39  Aligned_cols=89  Identities=20%  Similarity=0.368  Sum_probs=59.0

Q ss_pred             CCCCCCcCHHHHHHHHHHHHhcCChHHHHHHHHHHHhhCCCCccHHhHHHHHHHHHccCCHHHHHHHHHHHHhCCCCcCH
Q 038287            2 IFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPDC   81 (91)
Q Consensus         2 ~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~m~~~g~~p~~   81 (91)
                      +..|+.||..+||++|.+|+++|++++|.++|++|.+. |+.||..+|+.+|++|++.|++++|.++|++|.+.|+.||.
T Consensus       464 ~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~-Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~  542 (1060)
T PLN03218        464 QEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNA-GVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDR  542 (1060)
T ss_pred             HHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHc-CCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCH
Confidence            34556666666666666666666666666666666654 66666666666666666666666666666666666666666


Q ss_pred             HhHhhhhhcC
Q 038287           82 FVYNTIMKGY   91 (91)
Q Consensus        82 ~~~~~ll~~~   91 (91)
                      .||++||++|
T Consensus       543 vTYnsLI~a~  552 (1060)
T PLN03218        543 VVFNALISAC  552 (1060)
T ss_pred             HHHHHHHHHH
Confidence            6666666654



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4567 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG5108 RPO41 Mitochondrial DNA-directed RNA polymerase [Transcription] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-08
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 48.3 bits (113), Expect = 3e-08
 Identities = 11/89 (12%), Positives = 34/89 (38%), Gaps = 2/89 (2%)

Query: 4   KQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCN-TKNL 62
           K+    +  YN ++    +  +   +   +  ++ + G+ P+L++Y   +  +    ++ 
Sbjct: 159 KRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDA-GLTPDLLSYAAALQCMGRQDQDA 217

Query: 63  REAMRLVSALSDSGFKPDCFVYNTIMKGY 91
               R +  +S  G K        ++   
Sbjct: 218 GTIERCLEQMSQEGLKLQALFTAVLLSEE 246


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.93
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.89
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.89
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.7
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 98.7
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.73
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.72
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.69
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.66
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.64
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.63
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.59
3k9i_A117 BH0479 protein; putative protein binding protein, 97.57
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 97.57
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.56
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.54
2gw1_A 514 Mitochondrial precursor proteins import receptor; 97.45
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.43
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 97.42
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.42
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 97.41
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 97.4
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.38
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.35
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.33
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.33
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.33
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 97.32
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.32
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.31
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.3
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.28
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.27
2gw1_A 514 Mitochondrial precursor proteins import receptor; 97.27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.27
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.25
3mkr_A 291 Coatomer subunit epsilon; tetratricopeptide repeat 97.23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.2
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.19
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.13
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.11
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.1
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 97.09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.03
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.01
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.0
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.0
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.0
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 97.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.99
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.98
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.98
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.98
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.96
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.95
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.93
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.92
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 96.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.86
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.85
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.79
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.76
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.72
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 96.71
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.7
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 96.7
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.67
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.66
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.65
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.63
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.62
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.62
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.61
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.61
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.61
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.55
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.54
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.52
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 96.5
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 96.5
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.49
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.48
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.48
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 96.46
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.42
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.39
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 96.36
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 96.35
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.33
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.31
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.3
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.26
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.19
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.18
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 96.12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.11
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.03
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.01
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.93
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.9
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 95.83
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.79
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.77
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.76
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.66
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.58
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 95.58
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.55
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.55
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 95.55
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.52
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.41
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.34
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.33
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.32
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.3
3u3w_A293 Transcriptional activator PLCR protein; ternary co 95.25
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.21
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 95.21
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 95.17
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.03
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 95.0
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 94.98
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.96
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 94.89
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 94.88
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 94.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 94.85
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.84
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 94.81
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 94.71
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.58
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 94.5
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.43
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 94.43
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 94.38
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 94.36
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 94.21
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 94.13
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 94.11
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 94.04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 94.01
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.94
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.93
3k9i_A117 BH0479 protein; putative protein binding protein, 93.82
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 93.79
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 93.78
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 93.74
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 93.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 93.35
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 93.21
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 93.13
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 92.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 92.95
3u3w_A293 Transcriptional activator PLCR protein; ternary co 92.67
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.59
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.57
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 92.56
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 92.34
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 92.16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 92.15
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.08
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 90.89
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 90.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 90.74
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 90.34
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 89.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 89.39
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.96
1pc2_A152 Mitochondria fission protein; unknown function; NM 88.85
2b7e_A59 PRE-mRNA processing protein PRP40; structural prot 88.35
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 88.13
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 88.01
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 87.7
2dod_A82 Transcription elongation regulator 1; FF domain, s 87.28
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 87.01
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 86.38
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.07
3rjv_A 212 Putative SEL1 repeat protein; alpha-alpha superhel 85.78
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 85.62
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 85.24
4g1t_A472 Interferon-induced protein with tetratricopeptide 84.78
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 83.46
1uzc_A71 Hypothetical protein FLJ21157; nuclear protein, st 83.38
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 82.34
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 81.6
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.05
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.93  E-value=1.4e-25  Score=140.74  Aligned_cols=90  Identities=19%  Similarity=0.298  Sum_probs=84.5

Q ss_pred             CCCCCCCcCHHHHHHHHHHHHhcCChHHHHHHHHHHHhhCCCCccHHhHHHHHHHHHccCCHHHHHHHHHHHHhCCCCcC
Q 038287            1 LIFKQLPPDIFTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKPNLVTYTILIDNVCNTKNLREAMRLVSALSDSGFKPD   80 (91)
Q Consensus         1 m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~m~~~g~~p~   80 (91)
                      |+.+|+.||..|||++|.+|++.|++++|.++|++|.+. |+.||..||+++|.+|++.|++++|.++|++|.+.|+.||
T Consensus        96 M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~-g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd  174 (501)
T 4g26_A           96 MIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAF-GIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPE  174 (501)
T ss_dssp             HHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHT-TCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCC
T ss_pred             HHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHc-CCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCC
Confidence            456789999999999999999999999999999999887 9999999999999999999999999999999999999999


Q ss_pred             HHhHhhhhhcC
Q 038287           81 CFVYNTIMKGY   91 (91)
Q Consensus        81 ~~~~~~ll~~~   91 (91)
                      ..||++||++|
T Consensus       175 ~~ty~~Li~~~  185 (501)
T 4g26_A          175 EPELAALLKVS  185 (501)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            99999999875



>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2b7e_A PRE-mRNA processing protein PRP40; structural protein; NMR {Saccharomyces cerevisiae} SCOP: a.159.2.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2dod_A Transcription elongation regulator 1; FF domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.159.2.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.19
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.4
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.34
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.07
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.07
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 97.05
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.94
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.9
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.86
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.83
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.83
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.65
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.61
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.52
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.44
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 96.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.78
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.75
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.64
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.61
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.5
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 95.25
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 94.74
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 94.34
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.17
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.79
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 92.98
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 92.0
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.97
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 91.66
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 90.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 90.78
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 90.58
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 89.6
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 86.79
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 85.87
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.73
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 84.34
d1u9pa136 Arc repressor {Salmonella bacteriophage P22 [TaxId 81.76
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 81.44
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 81.25
d1fkma2 188 Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccha 81.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 80.32
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: BTAD-like
domain: Probable regulatory protein EmbR, middle domain
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=98.19  E-value=2e-05  Score=42.27  Aligned_cols=70  Identities=13%  Similarity=0.170  Sum_probs=61.1

Q ss_pred             HHHHHHHHHHHhcCChHHHHHHHHHHHhhCCCCc-cHHhHHHHHHHHHccCCHHHHHHHHHHHHh-----CCCCcCHHh
Q 038287           11 FTYNFLVKCLCKCRSLTTVYNFVDQMRASLGIKP-NLVTYTILIDNVCNTKNLREAMRLVSALSD-----SGFKPDCFV   83 (91)
Q Consensus        11 ~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~-~~~~~~~~~~~~~~~~~~~~a~~~~~~m~~-----~g~~p~~~~   83 (91)
                      ..+..+...+.+.|++++|...++.....   .| +...|..++.++.+.|+..+|.+.|++...     .|+.|+..+
T Consensus        68 ~a~~~la~~~~~~g~~~~Al~~~~~al~~---~P~~e~~~~~l~~al~~~Gr~~eAl~~y~~~~~~L~~eLG~~P~~~l  143 (179)
T d2ff4a2          68 LAHTAKAEAEIACGRASAVIAELEALTFE---HPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTL  143 (179)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHH---STTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHSCCCCHHH
T ss_pred             HHHHHHHHHHHHCCCchHHHHHHHHHHHh---CCccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhCCCcCHHH
Confidence            45677889999999999999999999864   56 688899999999999999999999999853     599998765



>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9pa1 a.43.1.1 (A:72-107) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure