Citrus Sinensis ID: 038499


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61
MKLKQFKARSKSTSSCKKTCSSEFENEQPHHHSESFGAQDMGSVPKSISSSEKKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLPEFPPQHRLPEDVDPSCLHFRI
cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEEccccccccHHHHHHcccEEEEEEccccccccHHHHHHHHHHHccccccEEEEEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccccccccccccccccEEEEccccccccccccEEEEEEcHHHccccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccEEEEEEEccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccEEEEc
cccHHccccccccccccccccccccccccccccHHccHHHHHcccccHHHHHHHcHHHHHHEcccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcHHccccHHHHHHHHHccccccEEEEEcccccccccccHccccEEEEEEccccccEcHHHHHHHHcccccccccEEEEEEEEHcccccccHHHHHHHHHHHcccEEEEEcccccccccccHHcccccHHHEEEEccccccccccccEEEEcHHHHHHHHcccccccccHHHHHEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHcccHHHHHHHHHHHHcccccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHcccHHcEccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccEccccccccEEEEEc
mklkqfkarskstssckktcssefeneqphhhsesfgaqdmgsvpksisSSEKKLTWLQSQIigknaefdspfgkrrltyadhtasgrSLRYIENYIINnvlpfygnthtcdsyvgqhtTNMVHEASNYIKKclgggqedamifCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLrdeerwvvfvgphehhsnLLSWRQSLAEVVEigldddglLDIEALRSKLELykdakrpilgsfsacsnvtgiysDTRSIARLLHQYggfacfdfaasgpyveidvrsgqtdgydAIFLSthkflggpgspgILLMTKALyqlgsfppstcgggtvnyvngfnekdtLYLEdieeresggtpQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERllpnqnikilgntSTKRQAILSFNIHSstinsslgentktetdkplhgpfVATLLNDLFGiqarggcacagpyghhlldldeAQSYQIRSAIQKgyvgvkpgwtrisfpyymsneefEFTLEALEFIAIYGqrflplynfniktgtWCFMTAFEELIIGkqnshklhakqatvpaeDEYAIYLENARHIAsllpefppqhrlpedvdpsclhfri
mklkqfkarskstssckktCSSEFENEQPHHHSESFGAQDMGSVPKSISSSEKKLTWLQSQIigknaefdspfgkRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELykdakrpilgsfsacsnvtgIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQkgyvgvkpGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLPEfppqhrlpedvdpsclhfri
MKLKQFKARskstssckktcssEFENEQPHHHSESFGAQDMGSVPKSISSSEKKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIgldddglldIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNeefeftlealefIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLPEFPPQHRLPEDVDPSCLHFRI
******************************************************LTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHS******************LHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLP*********************
*************************************************SSEKKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAF***************************IYLENARHIASLLP*********EDVDPSCLHFRI
****************************************************KKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLPEFPPQHRLPEDVDPSCLHFRI
****************************PHHHSESFGAQDMGSVPKSISSSEKKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSS*************TDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLPEFPPQHRLPEDVDPSCLHFRI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLKQFKARSKSTSSCKKTCSSEFENEQPHHHSESFGAQDMGSVPKSISSSEKKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTWCFMTAFEELIIGKQNSHKLHAKQATVPAEDEYAIYLENARHIASLLPEFPPQHRLPEDVDPSCLHFRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query609 2.2.26 [Sep-21-2011]
P99177413 Probable cysteine desulfu yes no 0.574 0.847 0.256 3e-24
P63518413 Probable cysteine desulfu yes no 0.574 0.847 0.256 3e-24
Q8NXH0413 Probable cysteine desulfu yes no 0.574 0.847 0.256 4e-24
Q6GB11413 Probable cysteine desulfu yes no 0.574 0.847 0.256 4e-24
Q6GIH2413 Probable cysteine desulfu yes no 0.574 0.847 0.256 4e-24
Q5HHH0413 Probable cysteine desulfu yes no 0.574 0.847 0.256 4e-24
Q8CTA4413 Probable cysteine desulfu yes no 0.563 0.830 0.250 7e-23
Q5HQQ0413 Probable cysteine desulfu yes no 0.563 0.830 0.250 7e-23
Q9K7A0406 Probable cysteine desulfu yes no 0.571 0.857 0.258 3e-19
Q9XAD5418 Probable cysteine desulfu yes no 0.619 0.901 0.227 1e-17
>sp|P99177|CSD_STAAN Probable cysteine desulfurase OS=Staphylococcus aureus (strain N315) GN=csd PE=1 SV=1 Back     alignment and function desciption
 Score =  114 bits (284), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 103/402 (25%), Positives = 174/402 (43%), Gaps = 52/402 (12%)

Query: 69  FDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASN 128
            D     +RL Y D TA+ ++   + N + +    +  N H     +G   T+    A  
Sbjct: 18  LDQKVNGKRLAYLDSTATSQTPMQVLNVLEDYYKRYNSNVHRGVHTLGSLATDGYENARE 77

Query: 129 YIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGP 188
            +++ +     + +IF   GTTA+I  +    G A               EE   + V  
Sbjct: 78  TVRRFINAKYFEEIIFT-RGTTASINLVAHSYGDA-------------NVEEGDEIVVTE 123

Query: 189 HEHHSNLLSWRQ----SLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSN 244
            EHH+N++ W+Q      A +  I +  DG L+IE ++  +    + K  I+ + +  SN
Sbjct: 124 MEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTI----NDKTKIV-AIAHISN 178

Query: 245 VTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPG 304
           V G  +D ++IA + HQ+G     D A + P++++D++    D Y     S HK L GP 
Sbjct: 179 VLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADFYS---FSGHKML-GPT 234

Query: 305 SPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIR 364
             G+L   + L Q     P   GG  +++V+ ++        D+  +   GTP + Q I 
Sbjct: 235 GIGVLFGKRELLQ--KMEPIEFGGDMIDFVSKYDAT----WADLPTKFEAGTPLIAQAIG 288

Query: 365 AALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTI 424
            A A    E IG + I K E+     A E++   + I+I G    +R  +++FN+     
Sbjct: 289 LAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNL----- 343

Query: 425 NSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGP 466
                        + +H   VAT + D  G+  R G  CA P
Sbjct: 344 -------------QDVHPHDVATAV-DTEGVAVRAGHHCAQP 371




Catalyzes the removal of elemental sulfur and selenium atoms from L-cysteine, L-cystine, L-selenocysteine, and L-selenocystine to produce L-alanine.
Staphylococcus aureus (strain N315) (taxid: 158879)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 7
>sp|P63518|CSD_STAAM Probable cysteine desulfurase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=csd PE=1 SV=1 Back     alignment and function description
>sp|Q8NXH0|CSD_STAAW Probable cysteine desulfurase OS=Staphylococcus aureus (strain MW2) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q6GB11|CSD_STAAS Probable cysteine desulfurase OS=Staphylococcus aureus (strain MSSA476) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q6GIH2|CSD_STAAR Probable cysteine desulfurase OS=Staphylococcus aureus (strain MRSA252) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q5HHH0|CSD_STAAC Probable cysteine desulfurase OS=Staphylococcus aureus (strain COL) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q8CTA4|CSD_STAES Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q5HQQ0|CSD_STAEQ Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q9K7A0|CSD_BACHD Probable cysteine desulfurase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=csd PE=3 SV=2 Back     alignment and function description
>sp|Q9XAD5|CSD_STRCO Probable cysteine desulfurase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=csd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query609
255552410633 cysteine desulfurylase, putative [Ricinu 0.977 0.939 0.705 0.0
359477024636 PREDICTED: probable cysteine desulfurase 0.942 0.902 0.694 0.0
225431495658 PREDICTED: uncharacterized protein LOC10 0.945 0.875 0.660 0.0
449461845644 PREDICTED: probable cysteine desulfurase 0.947 0.895 0.672 0.0
449530392644 PREDICTED: uncharacterized protein LOC10 0.947 0.895 0.670 0.0
296088558670 unnamed protein product [Vitis vinifera] 0.899 0.817 0.681 0.0
357519937635 hypothetical protein MTR_8g093550 [Medic 0.975 0.935 0.646 0.0
224095928488 predicted protein [Populus trichocarpa] 0.801 1.0 0.780 0.0
356511174609 PREDICTED: probable cysteine desulfurase 0.924 0.924 0.670 0.0
356511172637 PREDICTED: probable cysteine desulfurase 0.983 0.940 0.660 0.0
>gi|255552410|ref|XP_002517249.1| cysteine desulfurylase, putative [Ricinus communis] gi|223543620|gb|EEF45149.1| cysteine desulfurylase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/611 (70%), Positives = 507/611 (82%), Gaps = 16/611 (2%)

Query: 10  SKSTSSCKKTCSSEFENEQPHHHSESFGAQDMGSVPKSISSSEKKLTWLQSQIIGKNAEF 69
           S+ST+S + T SS   ++  +  SESF   D+G VPKSISS E++L WL+SQIIG + EF
Sbjct: 28  SRSTNSTR-TVSSALSSDLCNR-SESFRTLDIG-VPKSISS-ERRLAWLRSQIIGDDVEF 83

Query: 70  DSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNY 129
           +SPFGKRRLTYADHTASGRSL YIEN+IINNVLPFYGNTHTCDSYVG  TT MVHEA+ Y
Sbjct: 84  ESPFGKRRLTYADHTASGRSLHYIENFIINNVLPFYGNTHTCDSYVGHRTTKMVHEATQY 143

Query: 130 IKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPH 189
           IK+ LGGG+EDA+IFCGSGTTAAIKRLQEVMGIAVPSI+R+++IKCL +EERWVVFVGP+
Sbjct: 144 IKRSLGGGEEDAIIFCGSGTTAAIKRLQEVMGIAVPSIMRDRIIKCLSNEERWVVFVGPY 203

Query: 190 EHHSNLLSWRQSLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIY 249
           EHHSNLLSWRQSLAEVVEIGL+D GL+DIEAL   L+ Y+ A RPILGSFSA SNVTGI+
Sbjct: 204 EHHSNLLSWRQSLAEVVEIGLNDSGLIDIEALEKLLDSYRKANRPILGSFSASSNVTGIF 263

Query: 250 SDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGIL 309
           S TR +A+LLH+YGGF CFDFAASGPYVEID+R G+ DGYDAIFLS HKFLGGPGSPGIL
Sbjct: 264 SKTRGLAQLLHRYGGFVCFDFAASGPYVEIDMRYGEVDGYDAIFLSPHKFLGGPGSPGIL 323

Query: 310 LMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAF 369
           LM+KALYQL   PPSTCGGGTV YVNGFN+KDTLYL+DIEERE+GGTPQ+IQ IRAALAF
Sbjct: 324 LMSKALYQLKYSPPSTCGGGTVCYVNGFNDKDTLYLDDIEERENGGTPQIIQTIRAALAF 383

Query: 370 WVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLG 429
           WVKEYIG+ VI++QE+ YI +ALER+  N+NI ILGNTS +RQAILSF I+S+T +SS  
Sbjct: 384 WVKEYIGYNVIEEQEKNYISKALERVKSNKNIWILGNTSAERQAILSFLIYSTTNSSSSS 443

Query: 430 ENTK--------TETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQ 481
              +         + DKPLHG FVA+LLNDLFGIQ+RGGCACAGPYGH LLD+ EA S  
Sbjct: 444 SKDESSSSSKTGNKRDKPLHGAFVASLLNDLFGIQSRGGCACAGPYGHVLLDISEANSLA 503

Query: 482 IRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYNFNIKTGTW 541
           +RSAI +GY+G KPGWTRISFPYYMSN+EFEF + A+EF+AIYGQRFLPLY FN KTGTW
Sbjct: 504 LRSAIHQGYMGAKPGWTRISFPYYMSNQEFEFIMAAVEFVAIYGQRFLPLYGFNFKTGTW 563

Query: 542 CF-MTAFEELIIGKQNSHKLHAKQATVPAE--DEYAIYLENARHIASLLPEFPPQHRLPE 598
            F   AF++L++GK+N        A V  E  ++YA YLE A+HIA+LLP+FP   +LPE
Sbjct: 564 YFKKKAFKDLLVGKENKCNTFP-MAAVGGEIINKYASYLEIAKHIANLLPKFPSSRKLPE 622

Query: 599 DVDPSCLHFRI 609
           D+D + L+FR+
Sbjct: 623 DLDYNLLYFRV 633




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359477024|ref|XP_002274757.2| PREDICTED: probable cysteine desulfurase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225431495|ref|XP_002274844.1| PREDICTED: uncharacterized protein LOC100265977 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449461845|ref|XP_004148652.1| PREDICTED: probable cysteine desulfurase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449530392|ref|XP_004172179.1| PREDICTED: uncharacterized protein LOC101232076 [Cucumis sativus] Back     alignment and taxonomy information
>gi|296088558|emb|CBI37549.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357519937|ref|XP_003630257.1| hypothetical protein MTR_8g093550 [Medicago truncatula] gi|355524279|gb|AET04733.1| hypothetical protein MTR_8g093550 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224095928|ref|XP_002310507.1| predicted protein [Populus trichocarpa] gi|222853410|gb|EEE90957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511174|ref|XP_003524304.1| PREDICTED: probable cysteine desulfurase-like [Glycine max] Back     alignment and taxonomy information
>gi|356511172|ref|XP_003524303.1| PREDICTED: probable cysteine desulfurase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query609
UNIPROTKB|Q5LNM5471 SPO3178 "Uncharacterized prote 0.413 0.535 0.388 1.2e-75
TIGR_CMR|SPO_3178471 SPO_3178 "conserved hypothetic 0.413 0.535 0.388 1.2e-75
DICTYBASE|DDB_G0290035 1165 DDB_G0290035 [Dictyostelium di 0.747 0.390 0.366 1.3e-71
TIGR_CMR|CJE_0882422 CJE_0882 "aminotransferase, pu 0.541 0.781 0.372 2.9e-62
WB|WBGene00022195 957 Y71H2B.5 [Caenorhabditis elega 0.807 0.514 0.303 1.1e-52
TIGR_CMR|BA_5215406 BA_5215 "cysteine desulfurase 0.522 0.783 0.253 2.3e-13
UNIPROTKB|P63516417 csd "Probable cysteine desulfu 0.454 0.664 0.254 1.4e-11
TIGR_CMR|CBU_1357405 CBU_1357 "selenocysteine lyase 0.361 0.543 0.300 5.9e-09
UNIPROTKB|Q9KPQ7404 csd "Probable cysteine desulfu 0.441 0.665 0.256 1.3e-08
TIGR_CMR|VC_2309404 VC_2309 "aminotransferase, cla 0.441 0.665 0.256 1.3e-08
UNIPROTKB|Q5LNM5 SPO3178 "Uncharacterized protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
 Score = 465 (168.7 bits), Expect = 1.2e-75, Sum P(2) = 1.2e-75
 Identities = 104/268 (38%), Positives = 155/268 (57%)

Query:    46 KSISSSEKKLTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFY 105
             +++  ++ +   L   +IG+        G   L YAD+ ASGR+LR +E Y+   VLPFY
Sbjct:     7 RNVIEADVRAGRLADGLIGEKIMIPGLNGDVPLVYADYVASGRALRQVEQYVSEYVLPFY 66

Query:   106 GNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVP 165
              N+HT  SY G + T +   A   I + +G  ++DA+IF GSG TA + RL  ++GIA  
Sbjct:    67 ANSHTEASYCGAYITGLRRAARAEIARLVGAAEDDAVIFAGSGATAGLNRLVSLLGIAQA 126

Query:   166 SILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQSLAEVVEIXXXXXXXXXIEALRSKL 225
             +              R VVF+GP+EHHSN+L WR+S A+VVEI         +  L++ L
Sbjct:   127 A--------------RPVVFIGPYEHHSNILPWRESGAKVVEIPEAPEGGPDLVVLQTAL 172

Query:   226 ELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQ 285
               +  +   ++G+FSA SNVTGI +DT  + RLL  +G  + +D+A  GPY+ ID+  G 
Sbjct:   173 RAHAGSDL-MIGAFSAASNVTGIITDTVPVTRLLKAHGALSIWDYAGGGPYLPIDMGEGG 231

Query:   286 TDGYDAIFLSTHKFLGGPGSPGILLMTK 313
                 DAI +S HKF GGPG+ G+L++ +
Sbjct:   232 LRK-DAIVVSPHKFPGGPGASGVLVVNR 258


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|SPO_3178 SPO_3178 "conserved hypothetical protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290035 DDB_G0290035 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0882 CJE_0882 "aminotransferase, putative" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
WB|WBGene00022195 Y71H2B.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5215 BA_5215 "cysteine desulfurase SufS" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P63516 csd "Probable cysteine desulfurase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1357 CBU_1357 "selenocysteine lyase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPQ7 csd "Probable cysteine desulfurase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2309 VC_2309 "aminotransferase, class V" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.7LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034824001
SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (623 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query609
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 2e-72
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 5e-40
TIGR01979403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 4e-31
cd06453373 cd06453, SufS_like, Cysteine desulfurase (SufS)-li 2e-30
TIGR01977376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase fa 8e-17
PLN02855424 PLN02855, PLN02855, Bifunctional selenocysteine ly 9e-16
PRK09295406 PRK09295, PRK09295, bifunctional cysteine desulfur 5e-15
TIGR03392398 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, cat 2e-12
PRK10874401 PRK10874, PRK10874, cysteine sulfinate desulfinase 3e-12
COG1104386 COG1104, NifS, Cysteine sulfinate desulfinase/cyst 7e-09
TIGR01976397 TIGR01976, am_tr_V_VC1184, cysteine desulfurase fa 3e-07
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 3e-07
PRK04366481 PRK04366, PRK04366, glycine dehydrogenase subunit 8e-06
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 6e-05
COG3844407 COG3844, COG3844, Kynureninase [Amino acid transpo 7e-05
COG1003496 COG1003, GcvP, Glycine cleavage system protein P ( 1e-04
TIGR04343370 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthe 5e-04
TIGR03402379 TIGR03402, FeS_nifS, cysteine desulfurase NifS 6e-04
PLN02651364 PLN02651, PLN02651, cysteine desulfurase 0.002
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase 0.002
TIGR01814406 TIGR01814, kynureninase, kynureninase 0.003
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  237 bits (608), Expect = 2e-72
 Identities = 125/453 (27%), Positives = 189/453 (41%), Gaps = 72/453 (15%)

Query: 74  GKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKC 133
             + L Y D+ A+ +  + + + +      +  N H     + +  T++   A   + + 
Sbjct: 19  VGKPLVYLDNAATSQKPQAVLDAVAEYYRRYNANVHRGAHTLAEEATDLYEAAREAVARF 78

Query: 134 LGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHS 193
           L     D ++F   GTT A+  +   +G ++             DE    + V   EHHS
Sbjct: 79  LNADSSDEIVF-TRGTTEALNLVARGLGRSLK----------PGDE----IVVSDLEHHS 123

Query: 194 NLLSWRQSL----AEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIY 249
           N++ W++      A+V  I LDDDGLLD++AL   +       +  L + S  SNVTG  
Sbjct: 124 NIVPWQELAKRTGAKVRVIPLDDDGLLDLDALEKLIT-----PKTKLVALSHVSNVTGTV 178

Query: 250 SDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGIL 309
           +  + IA L H++G     D A +  ++ IDV   Q  G D +  S HK+L GP   G+L
Sbjct: 179 NPVKEIAELAHEHGALVLVDAAQAAGHLPIDV---QELGCDFLAFSGHKWLLGPTGIGVL 235

Query: 310 LMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAF 369
            + K L  L    P   GGG + YV   +  + + L ++  R   GTP +   I  A A 
Sbjct: 236 YVRKEL--LEELEPFLGGGGMIEYV---SRDEGVTLAELPLRFEAGTPNIAGAIGLAAAL 290

Query: 370 WVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLG 429
                IG E I+  E    E  LE L     ++I G     R  I+SFN+          
Sbjct: 291 DYLLEIGMEAIEAHERELTEYLLEGLSELPGVEIYGPPDADRGGIVSFNV---------- 340

Query: 430 ENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKG 489
                   K +H   VATLL++  GI  R G  CA P  H LL +D              
Sbjct: 341 --------KGIHPHDVATLLDEK-GIAVRAGHHCAQPL-HRLLGVDAT------------ 378

Query: 490 YVGVKPGWTRISFPYYMSNEEFEFTLEALEFIA 522
                    R S   Y + E+ +  LEAL+   
Sbjct: 379 --------IRASLHLYNTEEDVDRLLEALKKAL 403


Length = 405

>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|215460 PLN02855, PLN02855, Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>gnl|CDD|181766 PRK09295, PRK09295, bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>gnl|CDD|132433 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>gnl|CDD|182799 PRK10874, PRK10874, cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>gnl|CDD|224029 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233664 TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|235292 PRK04366, PRK04366, glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|226363 COG3844, COG3844, Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223935 COG1003, GcvP, Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234554 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthesis PLP-dependent enzyme EgtE Back     alignment and domain information
>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS Back     alignment and domain information
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
>gnl|CDD|223153 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130873 TIGR01814, kynureninase, kynureninase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 609
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 100.0
PLN02724 805 Molybdenum cofactor sulfurase 100.0
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 100.0
PLN02651364 cysteine desulfurase 100.0
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 100.0
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 100.0
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 100.0
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 100.0
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 100.0
PRK14012404 cysteine desulfurase; Provisional 100.0
PRK02948381 cysteine desulfurase; Provisional 100.0
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 100.0
TIGR01814406 kynureninase kynureninase. This model describes ky 100.0
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 100.0
PLN02409401 serine--glyoxylate aminotransaminase 100.0
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 100.0
PRK03080378 phosphoserine aminotransferase; Provisional 100.0
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 100.0
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 100.0
PTZ00094452 serine hydroxymethyltransferase; Provisional 100.0
PRK02769380 histidine decarboxylase; Provisional 100.0
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 100.0
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.97
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.97
PLN03032374 serine decarboxylase; Provisional 99.97
PRK13520371 L-tyrosine decarboxylase; Provisional 99.97
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.97
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.97
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.97
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.97
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.96
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.96
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.96
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.96
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.96
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.96
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.96
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.96
PLN02880490 tyrosine decarboxylase 99.95
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.95
PLN02414993 glycine dehydrogenase (decarboxylating) 99.95
PLN02590539 probable tyrosine decarboxylase 99.95
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.95
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.95
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.95
PRK05957389 aspartate aminotransferase; Provisional 99.94
PRK06207405 aspartate aminotransferase; Provisional 99.94
PLN02263470 serine decarboxylase 99.94
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.94
PRK06108382 aspartate aminotransferase; Provisional 99.94
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.94
PRK07179407 hypothetical protein; Provisional 99.94
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.94
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.93
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.93
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.93
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.93
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.93
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.93
PRK06225380 aspartate aminotransferase; Provisional 99.93
PRK07681399 aspartate aminotransferase; Provisional 99.93
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.93
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.93
PRK08960387 hypothetical protein; Provisional 99.93
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.93
PRK09105370 putative aminotransferase; Provisional 99.93
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.93
PLN02483489 serine palmitoyltransferase 99.93
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.93
PRK08361391 aspartate aminotransferase; Provisional 99.93
PRK13392410 5-aminolevulinate synthase; Provisional 99.93
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.92
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.92
PRK07324373 transaminase; Validated 99.92
PRK07908349 hypothetical protein; Provisional 99.92
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.92
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.92
PRK05764393 aspartate aminotransferase; Provisional 99.92
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.92
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.92
PRK05942394 aspartate aminotransferase; Provisional 99.92
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.92
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.92
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.92
PLN00175413 aminotransferase family protein; Provisional 99.92
PRK08363398 alanine aminotransferase; Validated 99.92
PRK07682378 hypothetical protein; Validated 99.92
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.92
PRK05367954 glycine dehydrogenase; Provisional 99.92
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.92
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.92
PLN02721353 threonine aldolase 99.92
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.92
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.91
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.91
PRK08912387 hypothetical protein; Provisional 99.91
PLN02187462 rooty/superroot1 99.91
PRK06290410 aspartate aminotransferase; Provisional 99.91
PRK13393406 5-aminolevulinate synthase; Provisional 99.91
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.91
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.91
PRK09064407 5-aminolevulinate synthase; Validated 99.91
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.91
PTZ00377481 alanine aminotransferase; Provisional 99.91
PTZ00433412 tyrosine aminotransferase; Provisional 99.91
PRK08068389 transaminase; Reviewed 99.91
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.91
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.91
PRK12566954 glycine dehydrogenase; Provisional 99.91
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.91
PRK08064390 cystathionine beta-lyase; Provisional 99.91
PRK12414384 putative aminotransferase; Provisional 99.91
PRK06348384 aspartate aminotransferase; Provisional 99.91
PRK07683387 aminotransferase A; Validated 99.91
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.91
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.91
PLN03226475 serine hydroxymethyltransferase; Provisional 99.91
PRK09265404 aminotransferase AlaT; Validated 99.91
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.91
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.91
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.91
PRK07337388 aminotransferase; Validated 99.9
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.9
PRK13580493 serine hydroxymethyltransferase; Provisional 99.9
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.9
PRK07568397 aspartate aminotransferase; Provisional 99.9
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.9
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.9
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.9
PRK07777387 aminotransferase; Validated 99.9
PRK07309391 aromatic amino acid aminotransferase; Validated 99.9
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.9
PRK07392360 threonine-phosphate decarboxylase; Validated 99.9
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.9
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.9
PRK06107402 aspartate aminotransferase; Provisional 99.9
PLN02822481 serine palmitoyltransferase 99.9
PRK03321352 putative aminotransferase; Provisional 99.9
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.9
PRK06767386 methionine gamma-lyase; Provisional 99.9
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.9
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.9
PRK09082386 methionine aminotransferase; Validated 99.9
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.9
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.89
PRK07550386 hypothetical protein; Provisional 99.89
PRK08861388 cystathionine gamma-synthase; Provisional 99.89
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.89
PRK09148405 aminotransferase; Validated 99.89
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.89
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.89
PRK06836394 aspartate aminotransferase; Provisional 99.89
PRK08636403 aspartate aminotransferase; Provisional 99.89
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.89
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.89
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.89
PRK05367 954 glycine dehydrogenase; Provisional 99.89
PLN02656409 tyrosine transaminase 99.89
PLN02452365 phosphoserine transaminase 99.89
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.89
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.89
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.89
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.89
PRK05968389 hypothetical protein; Provisional 99.89
PRK08776405 cystathionine gamma-synthase; Provisional 99.88
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.88
PRK05839374 hypothetical protein; Provisional 99.88
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.88
PLN02271586 serine hydroxymethyltransferase 99.88
PRK08249398 cystathionine gamma-synthase; Provisional 99.88
PRK08045386 cystathionine gamma-synthase; Provisional 99.88
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.88
PRK08175395 aminotransferase; Validated 99.88
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.88
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.88
PRK06460376 hypothetical protein; Provisional 99.88
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.88
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.88
PRK07811388 cystathionine gamma-synthase; Provisional 99.88
PLN02509464 cystathionine beta-lyase 99.88
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.88
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.88
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.87
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.87
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.87
PRK06234400 methionine gamma-lyase; Provisional 99.87
PRK07503403 methionine gamma-lyase; Provisional 99.87
PRK08574385 cystathionine gamma-synthase; Provisional 99.87
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.87
PRK06855433 aminotransferase; Validated 99.87
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.87
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.87
PRK07671377 cystathionine beta-lyase; Provisional 99.86
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.86
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.86
PRK08114395 cystathionine beta-lyase; Provisional 99.86
PLN02231534 alanine transaminase 99.86
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.86
PLN02955476 8-amino-7-oxononanoate synthase 99.86
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.86
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.86
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.86
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.86
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
PRK07505402 hypothetical protein; Provisional 99.85
PRK09028394 cystathionine beta-lyase; Provisional 99.85
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.85
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.85
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.85
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.85
PLN026721082 methionine S-methyltransferase 99.85
PLN02242418 methionine gamma-lyase 99.85
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.85
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.85
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.85
PRK07582366 cystathionine gamma-lyase; Validated 99.85
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.85
PRK05939397 hypothetical protein; Provisional 99.85
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.85
PRK04311464 selenocysteine synthase; Provisional 99.85
PRK07269364 cystathionine gamma-synthase; Reviewed 99.85
PRK08247366 cystathionine gamma-synthase; Reviewed 99.85
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.84
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.84
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.84
PRK12462364 phosphoserine aminotransferase; Provisional 99.84
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.84
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.83
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.83
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.83
PRK08354311 putative aminotransferase; Provisional 99.83
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.82
PRK07050394 cystathionine beta-lyase; Provisional 99.82
PRK10534333 L-threonine aldolase; Provisional 99.82
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.82
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.81
PRK07049427 methionine gamma-lyase; Validated 99.81
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.81
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.81
PRK09275527 aspartate aminotransferase; Provisional 99.81
PRK05967395 cystathionine beta-lyase; Provisional 99.81
KOG0629510 consensus Glutamate decarboxylase and related prot 99.8
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.8
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.8
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.8
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.8
PRK06434384 cystathionine gamma-lyase; Validated 99.8
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.8
PTZ00376404 aspartate aminotransferase; Provisional 99.8
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 99.79
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.79
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.79
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.79
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.79
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.79
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.78
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.78
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.78
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.78
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.78
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.77
PRK02627396 acetylornithine aminotransferase; Provisional 99.76
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.76
PRK08637388 hypothetical protein; Provisional 99.75
PLN02397423 aspartate transaminase 99.75
PRK04260375 acetylornithine aminotransferase; Provisional 99.75
PLN02368407 alanine transaminase 99.74
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.74
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.73
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.73
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.72
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.72
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.71
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.71
PLN02624474 ornithine-delta-aminotransferase 99.7
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.7
PRK15029755 arginine decarboxylase; Provisional 99.69
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.69
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.69
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.68
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 99.67
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.67
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.66
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.66
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.66
PLN00144382 acetylornithine transaminase 99.66
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 99.63
PRK13578720 ornithine decarboxylase; Provisional 99.63
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.63
PRK15400714 lysine decarboxylase CadA; Provisional 99.63
PRK15399713 lysine decarboxylase LdcC; Provisional 99.63
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 99.63
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.62
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.61
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.61
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.61
PRK13237460 tyrosine phenol-lyase; Provisional 99.61
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.6
PRK06541460 hypothetical protein; Provisional 99.6
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.59
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.59
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.58
PRK09792421 4-aminobutyrate transaminase; Provisional 99.58
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.58
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.58
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.57
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.57
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.57
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.56
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.55
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.54
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.54
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.54
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.54
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.53
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.51
PRK12403460 putative aminotransferase; Provisional 99.51
PRK07678451 aminotransferase; Validated 99.51
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.5
PRK06062451 hypothetical protein; Provisional 99.5
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.5
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 99.5
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 99.49
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.48
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.48
PRK07482461 hypothetical protein; Provisional 99.47
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.46
PRK06105460 aminotransferase; Provisional 99.45
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.45
PRK07036466 hypothetical protein; Provisional 99.45
PRK05965459 hypothetical protein; Provisional 99.45
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.45
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.45
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.44
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.44
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.44
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.44
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.44
PRK06149972 hypothetical protein; Provisional 99.44
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.44
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.44
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.43
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 99.43
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.43
PRK07481449 hypothetical protein; Provisional 99.42
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.42
COG1982557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.42
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.42
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.42
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.41
PRK07480456 putative aminotransferase; Validated 99.41
PRK07483443 hypothetical protein; Provisional 99.4
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 99.39
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.39
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.38
PRK06917447 hypothetical protein; Provisional 99.37
PRK07046453 aminotransferase; Validated 99.37
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.36
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.35
PRK061481013 hypothetical protein; Provisional 99.33
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.32
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.3
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.28
PRK08297443 L-lysine aminotransferase; Provisional 99.26
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.25
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.24
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 99.21
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.18
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.18
PRK12566 954 glycine dehydrogenase; Provisional 99.18
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.18
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 99.18
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 99.14
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.1
KOG1401433 consensus Acetylornithine aminotransferase [Amino 99.09
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 99.02
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 98.92
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 98.53
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 98.4
KOG2142 728 consensus Molybdenum cofactor sulfurase [Coenzyme 98.36
COG4100416 Cystathionine beta-lyase family protein involved i 98.32
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 97.73
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 97.68
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 97.44
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 97.13
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 96.69
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 94.81
KOG0630 838 consensus Predicted pyridoxal-dependent decarboxyl 94.6
KOG3843432 consensus Predicted serine hydroxymethyltransferas 94.08
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3.4e-60  Score=503.11  Aligned_cols=395  Identities=31%  Similarity=0.473  Sum_probs=355.2

Q ss_pred             HHHHhhccCCCccccCCCCCCceEEecCCCCCCChHHHHHHHHHhhcCCccCCCCCCchhhHHHHHHHHHHHHHHHHHhC
Q 038499           56 TWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLG  135 (609)
Q Consensus        56 ~~~r~~~~g~~~~~~~p~g~~~~vyld~~a~g~~~~~v~~ai~~~~~~~~~n~~~~~~~~~~~~~~~~~e~r~~ia~~~g  135 (609)
                      +.+|++||.....+     .++++|||++++++.|..|++++.+++..+++|.|.+.+..+...++.++++|+.+|+++|
T Consensus         6 ~~~r~~fp~l~~~~-----~~~~vylD~aa~~~~p~~V~~a~~~~~~~~~an~~r~~~~~~~~~t~~~e~aRe~va~~~~   80 (405)
T COG0520           6 AAVRADFPALKREV-----GKPLVYLDNAATSQKPQAVLDAVAEYYRRYNANVHRGAHTLAEEATDLYEAAREAVARFLN   80 (405)
T ss_pred             HHHHhhCHHHhhcc-----CCCeEEecCcccccCCHHHHHHHHHHHHhhcCCcCcccchHHHHHHHHHHHHHHHHHHHhC
Confidence            56888898665333     3468999999999999999999999999999999998888888999999999999999999


Q ss_pred             CCCCCcEEEeCChHHHHHHHHHHHhcccchhhHHHHHHhhhcCCCceEEEECCCCccchHHHHHH----cCceEEEEecC
Q 038499          136 GGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQ----SLAEVVEIGLD  211 (609)
Q Consensus       136 ~~~~~~vift~sGttaal~~l~~~l~~~~~~~~~~~~~~~l~~gd~~~Vlv~~~~h~s~~~~~~~----~G~~vv~v~~~  211 (609)
                      +++.++|+|| .|||.+|+.++..++..            +++||  +|++++.|||+|..+|++    .|++++++|++
T Consensus        81 a~~~~eIvft-~~tT~aln~va~~l~~~------------~~~gd--eIv~s~~EH~sn~~pw~~~~~~~Ga~v~~i~~~  145 (405)
T COG0520          81 ADSSDEIVFT-RGTTEALNLVARGLGRS------------LKPGD--EIVVSDLEHHSNIVPWQELAKRTGAKVRVIPLD  145 (405)
T ss_pred             CCCCCeEEEe-CChhHHHHHHHHHhhhh------------hcCCC--EEEEccCcchhhHHHHHHHHHhcCcEEEEEecC
Confidence            9974489999 89999999999987521            47888  799999999999999975    48999999999


Q ss_pred             CCCCCCHHHHHHHHhhhccCCCceEEEEecccCccccccCHHHHHHHHHHhCCeEEEeccccCCcccccCCCCCCCCccE
Q 038499          212 DDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDA  291 (609)
Q Consensus       212 ~~g~ld~e~L~~al~~~~~~~~~~lv~~s~~sn~TG~~~dl~~I~~la~~~g~~vivD~A~~~~~~~id~~~~~~~~~D~  291 (609)
                      ++|.+++++++..++     ++||+|++++++|.||.+.|+++|+++||++|++++||++|++|+.++|+..+   ++|+
T Consensus       146 ~~g~~~~~~~~~~i~-----~~Tklvais~vSn~tG~~~pv~~I~~la~~~ga~v~VDaaq~~~h~~idv~~l---~~Df  217 (405)
T COG0520         146 DDGLLDLDALEKLIT-----PKTKLVALSHVSNVTGTVNPVKEIAELAHEHGALVLVDAAQAAGHLPIDVQEL---GCDF  217 (405)
T ss_pred             CCCCcCHHHHHHhcC-----CCceEEEEECccccccccchHHHHHHHHHHcCCEEEEECccccCccCCCchhc---CCCE
Confidence            999999999999888     79999999999999999999999999999999999999999999999999987   9999


Q ss_pred             EEEcCCCCCCCCCCcEEEEEechhhccCCCCCCccCCCceEeecccccccccccccccccccCCChhHHHHHHHHHHHHH
Q 038499          292 IFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWV  371 (609)
Q Consensus       292 v~~S~hK~lggp~g~G~L~~~~~~~~l~~~~p~~~ggg~v~~~~~~~~~~~~~~~~~~~r~~~gtp~i~~~~~aal~~~~  371 (609)
                      +++|+|||++||.|+|+|++++++  ++.+.|...||+++.+++.   .....+...+.+++.|||++.+.++.+.++..
T Consensus       218 ~afsgHKwl~gP~GiGvLy~r~~~--l~~l~P~~~gg~~~~~~~~---~~~~~~~~~p~rfe~gTpn~~~~i~l~aAl~~  292 (405)
T COG0520         218 LAFSGHKWLLGPTGIGVLYVRKEL--LEELEPFLGGGGMIEYVSR---DEGVTLAELPLRFEAGTPNIAGAIGLAAALDY  292 (405)
T ss_pred             EEEcccccccCCCceEEEEEchHH--HhhcCCcccCCCceeeecc---cccccccCcchhhccCCchHHHHHhHHHHHHH
Confidence            999999999999999999999999  7889999999999888753   23456667789999999999999876555555


Q ss_pred             HHhcCHHHHHHHHHHHHHHHHHHhCCCCceEEeCCCCCCCcceEEEEeccCCCCCcCCCCCCCCCCCCCChHHHHHHHhh
Q 038499          372 KEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLND  451 (609)
Q Consensus       372 ~~~~g~~~i~~~~~~l~~~~~~~L~~~p~i~v~~~~~~~r~~~~~f~~~~~~~~~~~~~~~~~~~~~~l~~~~v~~~L~~  451 (609)
                      .+.+|++.|.++++++.+++.+.|+++|+++++++.+..+.++++|.+..                  +++.++++.|.+
T Consensus       293 ~~~ig~~~i~~~e~~L~~~~~~~L~~~~~v~i~g~~~~~r~~~vsF~v~~------------------~~~~dv~~~L~~  354 (405)
T COG0520         293 LLEIGMEAIEAHERELTEYLLEGLSELPGVEIYGPPDADRGGIVSFNVKG------------------IHPHDVATLLDE  354 (405)
T ss_pred             HHHHhHHHHHHHHHHHHHHHHHHHhcCCCeEEecCCcccCceEEEEEeCC------------------CCHHHHHHHHHh
Confidence            58899999999999999999999999999999998655799999999987                  689999999976


Q ss_pred             hcCcEeccCcccCChhhhhhcCCChhHHHHHHHHHhhCCCCCCCcEEEEecCCCCCHHHHHHHHHHHHHHHH
Q 038499          452 LFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAI  523 (609)
Q Consensus       452 ~~GI~v~~G~~ca~p~~~~ll~i~~~~~~~~~~~~~~~~~~~~~g~iRls~~~~~t~eeid~ll~al~~v~~  523 (609)
                      + ||.+|.|++|+.|+ +..+++.                    +.+|+|+++|||+||||+++++|+++.+
T Consensus       355 ~-gI~vr~g~~ca~p~-~~~~~~~--------------------~~iR~S~~~YNt~edid~l~~aL~~~~~  404 (405)
T COG0520         355 K-GIAVRAGHHCAQPL-HRLLGVD--------------------ATIRASLHLYNTEEDVDRLLEALKKALA  404 (405)
T ss_pred             C-CeEEEeccccccHH-HHhcCCC--------------------CceEEEEeecCCHHHHHHHHHHHHHHhh
Confidence            4 89999999999887 6666654                    6699999999999999999999998865



>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>KOG2142 consensus Molybdenum cofactor sulfurase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG0630 consensus Predicted pyridoxal-dependent decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query609
1jf9_A408 Crystal Structure Of Selenocysteine Lyase Length = 1e-08
1c0n_A406 Csdb Protein, Nifs Homologue Length = 406 1e-08
1i29_A406 Crystal Structure Of Csdb Complexed With L-Propargy 1e-08
1kmj_A406 E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE 8e-08
1t3i_A420 Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE De 3e-06
>pdb|1JF9|A Chain A, Crystal Structure Of Selenocysteine Lyase Length = 408 Back     alignment and structure

Iteration: 1

Score = 58.5 bits (140), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 73/284 (25%), Positives = 116/284 (40%), Gaps = 33/284 (11%) Query: 184 VFVGPHEHHSNLLSWRQSLAEV-VEIXXXXXXXXXIEALRSKLELYKDAKRPILGSFSAC 242 + + EHH+N++ W+ A V E+ L + L+ + R L + + Sbjct: 118 IIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEKTR--LLAITHV 175 Query: 243 SNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGG 302 SNV G + + L HQ+G D A + + +DV++ D Y S HK L G Sbjct: 176 SNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFY---VFSGHK-LYG 231 Query: 303 PGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQM 362 P GIL + +AL Q PP GG + V+ +E T R GTP + Sbjct: 232 PTGIGILYVKEALLQ--EMPPWEGGGSMIATVS-LSEGTT--WTKAPWRFEAGTPNTGGI 286 Query: 363 IRAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSS 422 I A +G I + E+ + AL +L ++ + G R +++FN Sbjct: 287 IGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYG--PQNRLGVIAFN---- 340 Query: 423 TINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGP 466 LG++ H V + L++ +GI R G CA P Sbjct: 341 -----LGKH---------HAYDVGSFLDN-YGIAVRTGHHCAMP 369
>pdb|1C0N|A Chain A, Csdb Protein, Nifs Homologue Length = 406 Back     alignment and structure
>pdb|1I29|A Chain A, Crystal Structure Of Csdb Complexed With L-Propargylglycine Length = 406 Back     alignment and structure
>pdb|1KMJ|A Chain A, E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE PERSULFIDE Intermediate (Residue Css). Length = 406 Back     alignment and structure
>pdb|1T3I|A Chain A, Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE Desulfurase From Synechocystis Pcc 6803 Length = 420 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query609
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 2e-26
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 4e-26
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 1e-25
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 1e-20
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 2e-19
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 3e-05
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 1e-04
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-04
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 3e-04
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 4e-04
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 9e-04
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Length = 406 Back     alignment and structure
 Score =  110 bits (278), Expect = 2e-26
 Identities = 87/339 (25%), Positives = 133/339 (39%), Gaps = 70/339 (20%)

Query: 190 EHHSNLLSWRQSLAE-----VVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSN 244
           EHH+N++ W Q L       +  I L+ DG L +E L +        ++  L + +  SN
Sbjct: 122 EHHANIVPW-QMLCARVGAELRVIPLNPDGTLQLETLPTLF-----DEKTRLLAITHVSN 175

Query: 245 VTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFL--STHKFLGG 302
           V G  +    +  L HQ+G     D A +  +  +DV++      D  F   S HK  G 
Sbjct: 176 VLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQA-----LDCDFYVFSGHKLYGP 230

Query: 303 PGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQM 362
            G  GIL + +AL  L   PP   GG  +  V   +E  T +      R   GTP    +
Sbjct: 231 TGI-GILYVKEAL--LQEMPPWEGGGSMIATV-SLSEGTT-W-TKAPWRFEAGTPNTGGI 284

Query: 363 I--RAALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIH 420
           I   AAL  +V   +G   I + E+  +  AL +L    ++ + G     R  +++FN+ 
Sbjct: 285 IGLGAALE-YVSA-LGLNNIAEYEQNLMHYALSQLESVPDLTLYG--PQNRLGVIAFNL- 339

Query: 421 SSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSY 480
                               H   V + L D +GI  R G  CA P    L+        
Sbjct: 340 -----------------GKHHAYDVGSFL-DNYGIAVRTGHHCAMP----LMA------- 370

Query: 481 QIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALE 519
                    Y  V P   R S   Y ++EE +  +  L+
Sbjct: 371 ---------YYNV-PAMCRASLAMYNTHEEVDRLVTGLQ 399


>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Length = 406 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Length = 416 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Length = 384 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Length = 474 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Length = 382 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query609
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 100.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 100.0
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 100.0
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 100.0
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 100.0
3qm2_A386 Phosphoserine aminotransferase; structural genomic 100.0
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 100.0
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 100.0
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 100.0
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 100.0
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 100.0
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 100.0
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 100.0
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 100.0
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 100.0
1iug_A352 Putative aspartate aminotransferase; wild type, py 100.0
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 100.0
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 100.0
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 100.0
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 100.0
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 100.0
3f0h_A376 Aminotransferase; RER070207000802, structural geno 100.0
2yrr_A353 Aminotransferase, class V; structural genomics, NP 100.0
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 100.0
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 100.0
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 100.0
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.98
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.98
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.98
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.97
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.97
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.97
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.97
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.97
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.97
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.97
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.97
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.97
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.97
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.97
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.97
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.96
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.96
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.96
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.96
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.96
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.96
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.96
1svv_A359 Threonine aldolase; structural genomics, structura 99.96
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.96
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.96
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.96
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.96
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.96
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.96
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.96
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.96
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.96
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.96
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.95
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.95
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.95
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.95
2fnu_A375 Aminotransferase; protein-product complex, structu 99.95
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.95
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.95
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.95
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.95
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.95
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.95
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.95
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.95
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.95
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.95
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.95
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.95
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.95
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.95
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.95
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.95
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.95
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.95
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.95
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.95
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.95
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.94
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.94
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.94
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.94
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.94
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.94
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.94
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.94
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.94
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.94
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.94
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.94
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.94
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.94
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.94
3ele_A398 Amino transferase; RER070207001803, structural gen 99.94
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.94
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.94
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.94
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.94
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.94
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.94
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.94
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.94
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.94
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.94
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.94
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.94
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.94
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.94
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.93
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.93
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.93
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.93
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.93
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.93
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.93
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.93
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.93
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.93
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.93
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.93
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.93
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.93
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.93
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.93
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.92
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.92
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.92
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.92
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.92
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.92
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.92
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.92
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.92
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.92
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.92
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.92
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.92
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.92
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.92
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.92
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.92
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.91
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.91
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.91
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.91
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.91
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.91
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.91
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.91
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.91
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.91
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.91
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.9
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.9
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.9
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.9
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.89
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.89
3rq1_A418 Aminotransferase class I and II; structural genomi 99.89
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.89
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.89
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.89
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.89
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.89
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.81
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.88
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.88
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.88
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.88
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.88
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.88
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.88
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.87
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.87
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.87
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.87
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.87
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.87
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.87
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.87
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.86
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.86
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.86
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.86
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.86
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.85
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.85
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.84
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.84
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.84
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.83
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.83
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.83
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.83
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.82
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.82
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.82
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.82
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.82
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.81
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.81
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.81
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.81
3hmu_A472 Aminotransferase, class III; structural genomics, 99.8
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.8
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.8
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.8
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.79
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.78
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.78
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.78
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.78
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.78
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.76
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.75
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.73
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.71
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.66
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.62
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.61
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.37
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.48
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.36
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
Probab=100.00  E-value=6.6e-39  Score=338.68  Aligned_cols=372  Identities=23%  Similarity=0.288  Sum_probs=289.1

Q ss_pred             eEEecCCCCCCChHHHHHHHHHhhcCCccCCCCCCchhhHHHHHHHHHHHHHHHHHhCCCCCCcEEEeCChHHHHHHHHH
Q 038499           78 LTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCLGGGQEDAMIFCGSGTTAAIKRLQ  157 (609)
Q Consensus        78 ~vyld~~a~g~~~~~v~~ai~~~~~~~~~n~~~~~~~~~~~~~~~~~e~r~~ia~~~g~~~~~~vift~sGttaal~~l~  157 (609)
                      +||+|++++++.++.+.+++.+.+...++|++.. +..+......++++++++++++|++++ +|+++ +|+++++..++
T Consensus         1 ~iyld~~~~~~~~~~v~~a~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~la~~~~~~~~-~i~~~-~g~~~a~~~~~   77 (382)
T 4hvk_A            1 MAYFDYTSAKPVDERILEAMLPYMTESFGNPSSV-HSYGFKAREAVQEAREKVAKLVNGGGG-TVVFT-SGATEANNLAI   77 (382)
T ss_dssp             -CBCBTTTCCCCCHHHHHHHHHHHHTSCCCTTCS-SHHHHHHHHHHHHHHHHHHHHTTCTTE-EEEEE-SSHHHHHHHHH
T ss_pred             CEeecCCCcCCCCHHHHHHHHHHHHhhcCCCccc-chHHHHHHHHHHHHHHHHHHHcCCCcC-eEEEE-CCchHHHHHHH
Confidence            4799999999999999999999998888888873 556777889999999999999999876 89998 77787888888


Q ss_pred             HHhcccchhhHHHHHHhhhcCCCceEEEECCCCccchHHHHHH---cCceEEEEecCCCCCCCHHHHHHHHhhhccCCCc
Q 038499          158 EVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQ---SLAEVVEIGLDDDGLLDIEALRSKLELYKDAKRP  234 (609)
Q Consensus       158 ~~l~~~~~~~~~~~~~~~l~~gd~~~Vlv~~~~h~s~~~~~~~---~G~~vv~v~~~~~g~ld~e~L~~al~~~~~~~~~  234 (609)
                      .++...           ..++||  .|+++..+|+++...+..   .|++++.++.++++.+|+++|+++++     +++
T Consensus        78 ~~~~~~-----------~~~~gd--~vi~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~~d~~~l~~~i~-----~~~  139 (382)
T 4hvk_A           78 IGYAMR-----------NARKGK--HILVSAVEHMSVINPAKFLQKQGFEVEYIPVGKYGEVDVSFIDQKLR-----DDT  139 (382)
T ss_dssp             HHHHHH-----------HGGGCC--EEEEETTCCHHHHHHHHHHHHTTCEEEEECBCTTSCBCHHHHHHHCC-----TTE
T ss_pred             HHhhhh-----------hcCCCC--EEEECCCCcHHHHHHHHHHHhcCCEEEEeccCCCCCcCHHHHHHHhc-----cCc
Confidence            776310           016888  799999999999877655   59999999999889999999999998     689


Q ss_pred             eEEEEecccCccccccCHHHHHHHHHHhCCeEEEeccccCCcccccCCCCCCCCccEEEEcCCCCCCCCCCcEEEEEech
Q 038499          235 ILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPGSPGILLMTKA  314 (609)
Q Consensus       235 ~lv~~s~~sn~TG~~~dl~~I~~la~~~g~~vivD~A~~~~~~~id~~~~~~~~~D~v~~S~hK~lggp~g~G~L~~~~~  314 (609)
                      +++++++++||||.+.|+++|.++|++||+ +|+|++++.+..++++...   ++|++++|+||++| |.|+|+++++++
T Consensus       140 ~~v~~~~~~nptG~~~~~~~i~~l~~~~~~-li~D~a~~~~~~~~~~~~~---~~d~~~~s~~K~~g-~~g~g~~~~~~~  214 (382)
T 4hvk_A          140 ILVSVQHANNEIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEVDVEKI---GADMLTISSNDIYG-PKGVGALWIRKE  214 (382)
T ss_dssp             EEEECCSBCTTTCBBCCHHHHHHHHSSSSE-EEEECTTTBTTBCCCHHHH---TCSEEEEESGGGTS-CTTCEEEEEETT
T ss_pred             eEEEEECCCCCceeeCCHHHHHHHHHHcCE-EEEEhHHhcCCCCCCchhc---CCCEEEEeHHHhcC-CCceEEEEEcCc
Confidence            999999999999999999999999999999 9999999988777766543   67999999999865 777999999987


Q ss_pred             hhccCCCCCCccCCCceEeecccccccccccccccccccCCChhHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHH
Q 038499          315 LYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFWVKEYIGHEVIKKQEETYIERALER  394 (609)
Q Consensus       315 ~~~l~~~~p~~~ggg~v~~~~~~~~~~~~~~~~~~~r~~~gtp~i~~~~~aal~~~~~~~~g~~~i~~~~~~l~~~~~~~  394 (609)
                      .    .+.+...+++.                  ..+...++++......+..++... ..+.+.+.++.+++++++.+.
T Consensus       215 ~----~~~~~~~~~~~------------------~~~~~~~~~~~~~~~~~~~al~~~-~~~~~~~~~~~~~~~~~l~~~  271 (382)
T 4hvk_A          215 A----KLQPVILGGGQ------------------ENGLRSGSENVPSIVGFGKAAEIT-AMEWREEAERLRRLRDRIIDN  271 (382)
T ss_dssp             C----CCCCSSCSSCT------------------GGGTSCSCCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
T ss_pred             c----CcCcccccCCC------------------cCccccCCcCHHHHHHHHHHHHHH-HhhHHHHHHHHHHHHHHHHHH
Confidence            6    34455554443                  345567777766654433222211 236788889999999999999


Q ss_pred             hCCCCceEEeCCCCCCCcc-eEEEEeccCCCCCcCCCCCCCCCCCCCChHHHHHHHhhhcCcEeccCcccCChh---hhh
Q 038499          395 LLPNQNIKILGNTSTKRQA-ILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPY---GHH  470 (609)
Q Consensus       395 L~~~p~i~v~~~~~~~r~~-~~~f~~~~~~~~~~~~~~~~~~~~~~l~~~~v~~~L~~~~GI~v~~G~~ca~p~---~~~  470 (609)
                      |+++|++++..+. ..+.+ +++|.+..                  .+...+.+.|.+ .||.+++|..|..+.   .+.
T Consensus       272 L~~~~~~~~~~~~-~~~~~~~~~~~~~~------------------~~~~~~~~~l~~-~gi~v~~g~~~~~~~~~~~~~  331 (382)
T 4hvk_A          272 VLKIEESYLNGHP-EKRLPNNVNVRFSY------------------IEGESIVLSLDM-AGIQASTGSACSSKTLQPSHV  331 (382)
T ss_dssp             HTTSTTEEECSCS-SSBCTTEEEEEETT------------------CCHHHHHHHHHH-TTCBCBCC--------CCCHH
T ss_pred             HhcCCCeEEeCCc-cccCCCEEEEEECC------------------CCHHHHHHHHHH-CCEEEeeCCccCCCCCcchHH
Confidence            9999999998764 23444 66666644                  367888998865 599999999887532   111


Q ss_pred             --hcCCChhHHHHHHHHHhhCCCCCCCcEEEEecCCCCCHHHHHHHHHHHHHHHHhcccccCCCc
Q 038499          471 --LLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIYGQRFLPLYN  533 (609)
Q Consensus       471 --ll~i~~~~~~~~~~~~~~~~~~~~~g~iRls~~~~~t~eeid~ll~al~~v~~~~~~~~p~y~  533 (609)
                        .+++++..               .++++||++++++|++|+++++++|++++++..++.|+|.
T Consensus       332 ~~~~g~~~~~---------------~~~~iRl~~~~~~t~e~i~~~~~~l~~~~~~~~~~~~~~~  381 (382)
T 4hvk_A          332 LMACGLKHEE---------------AHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSPLYR  381 (382)
T ss_dssp             HHHTTCCHHH---------------HHTEEEEECCTTCCHHHHHHHHHHHHHHHHHHHHTCC---
T ss_pred             HHHcCCChhh---------------cCCeEEEEcCCCCCHHHHHHHHHHHHHHHHHHHhhccccc
Confidence              12222211               1489999999999999999999999999998888777664



>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 609
d1jf9a_405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 5e-38
d1t3ia_408 c.67.1.3 (A:) Probable cysteine desulfurase SufS { 9e-31
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 7e-29
d1eg5a_376 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 7e-17
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 2e-09
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 1e-08
d1qz9a_404 c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescen 3e-07
d1c4ka2462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 9e-07
d1h0ca_388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 7e-06
d1vjoa_377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 8e-05
d2ch1a1388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 7e-04
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: NifS-like protein/selenocysteine lyase
species: Escherichia coli [TaxId: 562]
 Score =  143 bits (361), Expect = 5e-38
 Identities = 85/458 (18%), Positives = 142/458 (31%), Gaps = 74/458 (16%)

Query: 69  FDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASN 128
                    L Y D  AS +    + +         Y   H     +    T  +     
Sbjct: 14  LSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHTLSAQATEKMENVRK 73

Query: 129 YIKKCLGGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGP 188
                +     + ++F    T                                  + +  
Sbjct: 74  RASLFINARSAEELVFVRGTTEGINLVA--------------NSWGNSNVRAGDNIIISQ 119

Query: 189 HEHHSNLLSWRQSL----AEVVEIGLDDDGLLDIEALRSKLELYKDAKRPILGSFSACSN 244
            EHH+N++ W+       AE+  I L+ DG L +E L +  +     ++  L + +  SN
Sbjct: 120 MEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFD-----EKTRLLAITHVSN 174

Query: 245 VTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYDAIFLSTHKFLGGPG 304
           V G  +    +  L HQ+G     D A +  +  +DV   Q    D    S HK  G  G
Sbjct: 175 VLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDV---QALDCDFYVFSGHKLYGPTG 231

Query: 305 SPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIR 364
              + +    L +    PP   GG  +  V   +  +         R   GTP    +I 
Sbjct: 232 IGILYVKEALLQE---MPPWEGGGSMIATV---SLSEGTTWTKAPWRFEAGTPNTGGIIG 285

Query: 365 AALAFWVKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTI 424
              A      +G   I + E+  +  AL +L    ++ + G     R  +++FN+     
Sbjct: 286 LGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYG--PQNRLGVIAFNL----- 338

Query: 425 NSSLGENTKTETDKPLHGPFVATLLNDLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRS 484
                           H   V + L D +GI  R G  CA P   +              
Sbjct: 339 -------------GKHHAYDVGSFL-DNYGIAVRTGHHCAMPLMAYY------------- 371

Query: 485 AIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIA 522
                     P   R S   Y ++EE +  +  L+ I 
Sbjct: 372 --------NVPAMCRASLAMYNTHEEVDRLVTGLQRIH 401


>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Length = 404 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query609
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.98
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.97
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.97
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.97
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.97
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.97
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.96
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.94
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.93
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.93
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.93
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.93
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.92
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.92
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.91
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.91
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.91
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.91
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.91
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.91
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.91
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.91
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.91
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.91
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.9
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.9
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.9
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.9
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.89
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.89
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.89
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.89
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.88
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.88
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.88
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.88
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.88
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.86
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.84
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.83
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.82
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.81
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.81
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.8
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.79
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.79
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.78
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.77
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.77
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.75
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.75
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.75
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.74
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.74
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.73
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.73
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.72
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.71
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.7
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.69
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.69
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.68
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.68
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.68
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.68
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.66
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.65
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.65
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.63
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.62
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.62
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.61
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.6
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.6
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.54
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.54
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.43
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.41
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.33
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: NifS-like protein/selenocysteine lyase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.5e-50  Score=432.07  Aligned_cols=396  Identities=24%  Similarity=0.328  Sum_probs=334.5

Q ss_pred             HHHHHhhccCCCccccCCCCCCceEEecCCCCCCChHHHHHHHHHhhcCCccCCCCCCchhhHHHHHHHHHHHHHHHHHh
Q 038499           55 LTWLQSQIIGKNAEFDSPFGKRRLTYADHTASGRSLRYIENYIINNVLPFYGNTHTCDSYVGQHTTNMVHEASNYIKKCL  134 (609)
Q Consensus        55 ~~~~r~~~~g~~~~~~~p~g~~~~vyld~~a~g~~~~~v~~ai~~~~~~~~~n~~~~~~~~~~~~~~~~~e~r~~ia~~~  134 (609)
                      ++.+|++||.....+   . .++++|||++++++.|+.|.+++.+.++..|+|++++.+..+....+.++++|+.+++++
T Consensus         4 ~~~vR~~FP~l~~~~---~-~~~~iYld~a~~~~~p~~v~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~e~~R~~ia~~l   79 (405)
T d1jf9a_           4 VDKVRADFPVLSREV---N-GLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFI   79 (405)
T ss_dssp             HHHHHHTCGGGGCEE---T-TEECEECCTTTCCCCCHHHHHHHHHHHHHTCCCCSSCSSHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHhChhcccCc---C-CCCeEEEeCccccCCCHHHHHHHHHHHHhccCCCccchhHHHHHHHHHHHHHHHHHHHHc
Confidence            688999998654111   1 136799999999999999999999999888999998777788888899999999999999


Q ss_pred             CCCCCCcEEEeCChHHHHHHHHHHHhcccchhhHHHHHHhhhcCCCceEEEECCCCccchHHHHHH----cCceEEEEec
Q 038499          135 GGGQEDAMIFCGSGTTAAIKRLQEVMGIAVPSILREKLIKCLRDEERWVVFVGPHEHHSNLLSWRQ----SLAEVVEIGL  210 (609)
Q Consensus       135 g~~~~~~vift~sGttaal~~l~~~l~~~~~~~~~~~~~~~l~~gd~~~Vlv~~~~h~s~~~~~~~----~G~~vv~v~~  210 (609)
                      |+.+.++|+|+ +|+|++++.++..+..           ..+++|+  .|++++.+|+++..+|+.    .|++|+.+|+
T Consensus        80 ~~~~~~~i~~~-~~~T~~~~~~~~~~~~-----------~~~~~g~--~il~~~~e~~s~~~~~~~~a~~~g~~v~~~~~  145 (405)
T d1jf9a_          80 NARSAEELVFV-RGTTEGINLVANSWGN-----------SNVRAGD--NIIISQMEHHANIVPWQMLCARVGAELRVIPL  145 (405)
T ss_dssp             TCSCGGGEEEE-SSHHHHHHHHHHHHHH-----------HHCCTTC--EEEEETTCCGGGTHHHHHHHHHHTCEEEEECB
T ss_pred             CCCCccccccc-CcHHHHHHHHHhcccc-----------cccCCCC--EEEEEeCcccchHHHHHHHHHHcCcEEEEECC
Confidence            97654589998 6777788888766421           1257788  799999999999999964    5999999999


Q ss_pred             CCCCCCCHHHHHHHHhhhccCCCceEEEEecccCccccccCHHHHHHHHHHhCCeEEEeccccCCcccccCCCCCCCCcc
Q 038499          211 DDDGLLDIEALRSKLELYKDAKRPILGSFSACSNVTGIYSDTRSIARLLHQYGGFACFDFAASGPYVEIDVRSGQTDGYD  290 (609)
Q Consensus       211 ~~~g~ld~e~L~~al~~~~~~~~~~lv~~s~~sn~TG~~~dl~~I~~la~~~g~~vivD~A~~~~~~~id~~~~~~~~~D  290 (609)
                      +++|.+|+++++++++     ++|+++++++++|.||.+.|+++|+++||++|+++++|++|+.|+.++|+..+   ++|
T Consensus       146 ~~~g~~~~~~~~~~i~-----~~t~lv~~~~v~~~tG~~~pi~~i~~~~~~~g~~~~vD~~q~~g~~~id~~~~---~~D  217 (405)
T d1jf9a_         146 NPDGTLQLETLPTLFD-----EKTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQAL---DCD  217 (405)
T ss_dssp             CTTSCBCGGGHHHHCC-----TTEEEEEEESBCTTTCCBCCHHHHHHHHHHTTCEEEEECTTTTTTSCCCHHHH---TCS
T ss_pred             CCCCcCCHHHHHHhcc-----CCcEEEEEecCCCcccccCchHHhhhHHHHcCCeeecccceeccccccchhhc---CCc
Confidence            9999999999999988     79999999999999999999999999999999999999999999999999886   899


Q ss_pred             EEEEcCCCCCCCCCCcEEEEEechhhccCCCCCCccCCCceEeecccccccccccccccccccCCChhHHHHHHHHHHHH
Q 038499          291 AIFLSTHKFLGGPGSPGILLMTKALYQLGSFPPSTCGGGTVNYVNGFNEKDTLYLEDIEERESGGTPQVIQMIRAALAFW  370 (609)
Q Consensus       291 ~v~~S~hK~lggp~g~G~L~~~~~~~~l~~~~p~~~ggg~v~~~~~~~~~~~~~~~~~~~r~~~gtp~i~~~~~aal~~~  370 (609)
                      ++++|+|||+ ||.|+|+++++++.  ++.+.|...++.......   ..+...+.+.+.|++.||+++..++.+..++.
T Consensus       218 ~~~~s~hK~~-Gp~G~g~l~v~~~~--~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~r~e~GT~~~~~~~~l~~al~  291 (405)
T d1jf9a_         218 FYVFSGHKLY-GPTGIGILYVKEAL--LQEMPPWEGGGSMIATVS---LSEGTTWTKAPWRFEAGTPNTGGIIGLGAALE  291 (405)
T ss_dssp             EEEEEGGGTT-SCSSCEEEEECHHH--HTTCCCSSCSSSSEEECC---TTTCCEECCTTGGGCCSSCCHHHHHHHHHHHH
T ss_pred             eeeccccccc-cCCCceeeeechhh--hcccCcccccccccCccc---cccccccccchhhhcCCCCcHHHHHHHHHHHH
Confidence            9999999996 59999999999999  667777777666654432   23334455668889999999988775554444


Q ss_pred             HHHhcCHHHHHHHHHHHHHHHHHHhCCCCceEEeCCCCCCCcceEEEEeccCCCCCcCCCCCCCCCCCCCChHHHHHHHh
Q 038499          371 VKEYIGHEVIKKQEETYIERALERLLPNQNIKILGNTSTKRQAILSFNIHSSTINSSLGENTKTETDKPLHGPFVATLLN  450 (609)
Q Consensus       371 ~~~~~g~~~i~~~~~~l~~~~~~~L~~~p~i~v~~~~~~~r~~~~~f~~~~~~~~~~~~~~~~~~~~~~l~~~~v~~~L~  450 (609)
                      ..+..|.+.+.++...+.+++.+.+..++.+.+.++.  .+.++++|.+..                  .++..+...| 
T Consensus       292 ~~~~~g~~~i~~~~~~L~~~~~~~l~~~~~~~~~~~~--~r~~ivsf~~~~------------------~~~~~~~~~L-  350 (405)
T d1jf9a_         292 YVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQ--NRLGVIAFNLGK------------------HHAYDVGSFL-  350 (405)
T ss_dssp             HHHHHCHHHHHHHHHHHHHHHHHHHTTSTTEEEESCT--TCCSEEEEEETT------------------CCHHHHHHHH-
T ss_pred             HHHHhChHHHHHHHHHHHHHHHhhhhcCCcccccCCc--CcCcEEEEEcCC------------------CCHHHHHHHH-
Confidence            4477899999999999999999999999999888874  688999999876                  4678888888 


Q ss_pred             hhcCcEeccCcccCChhhhhhcCCChhHHHHHHHHHhhCCCCCCCcEEEEecCCCCCHHHHHHHHHHHHHHHHh
Q 038499          451 DLFGIQARGGCACAGPYGHHLLDLDEAQSYQIRSAIQKGYVGVKPGWTRISFPYYMSNEEFEFTLEALEFIAIY  524 (609)
Q Consensus       451 ~~~GI~v~~G~~ca~p~~~~ll~i~~~~~~~~~~~~~~~~~~~~~g~iRls~~~~~t~eeid~ll~al~~v~~~  524 (609)
                      +++||.++.|++|+.+.- ..++                    .+|++|||+++|||++||++++++|+++.+-
T Consensus       351 ~~~gI~v~~G~~c~~~~~-~~~~--------------------~~g~iRiS~~~ynt~eDid~l~~~l~~i~r~  403 (405)
T d1jf9a_         351 DNYGIAVRTGHHCAMPLM-AYYN--------------------VPAMCRASLAMYNTHEEVDRLVTGLQRIHRL  403 (405)
T ss_dssp             HHTTEECEEECTTCHHHH-HHTT--------------------CSCEEEEECCTTCCHHHHHHHHHHHHHHHHH
T ss_pred             HHCCcEEEccchhhhhHH-HhcC--------------------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHh
Confidence            568999999999985431 1122                    2589999999999999999999999998864



>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure