Citrus Sinensis ID: 038513

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80-

MVQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKPPKEHHKHKNFKDRVA

cccEEEEEEEEcccHHHHHHHHHHHccccEEEEccccccHHHHHHHccHHHHHHHcccccEEEEccccccccccccccccc

ccEEEEEEEEEEccHHHHHHHHHHHccccEEEEcccccHHHHHHHHccHHHHHHccccccEEEEEcccccccccccccccc

MVQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSvsdycahhavcpilivkppkehhkhknfkdrva

MVQVNAqtlildgdaRDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILivkppkehhkhknfkdrva

MVQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKPPKEHHKHKNFKDRVA

******QTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVK****************

*VQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIV*****************

MVQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKPPK*************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKPPKEHHKHKNFKDRVA

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		81	2.2.26 [Sep-21-2011]
Q8LGG8		175	Universal stress protein	no	no	0.790	0.365	0.468	6e-13
P74897		137	Universal stress protein	N/A	no	0.716	0.423	0.431	8e-06
Q57951		170	Universal stress protein	yes	no	0.827	0.394	0.358	2e-05
P42297		148	Universal stress protein	yes	no	0.765	0.418	0.370	2e-05
P72745		108	Universal stress protein	N/A	no	0.679	0.509	0.4	4e-05
P74148		154	Universal stress protein	N/A	no	0.456	0.240	0.540	0.0002
O07552		166	Stress response protein N	no	no	0.777	0.379	0.333	0.0002
O53472		294	Universal stress protein	yes	no	0.395	0.108	0.514	0.0005

>sp\|Q8LGG8\|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2	Back alignment and function desciption

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 45/64 (70%)

Query: 2   VQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPI 61
           + V  +  I  GD +DVICQ V+++  D LVVGSRGLG+ ++ F+G+VS +C  HA CP+
Sbjct: 99  IGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPV 158

Query: 62  LIVK 65
           + +K
Sbjct: 159 MTIK 162

Arabidopsis thaliana (taxid: 3702)

>sp\|P74897\|YQA3_THEAQ Universal stress protein in QAH/OAS sulfhydrylase 3'region OS=Thermus aquaticus PE=3 SV=1	Back alignment and function description

>sp\|Q57951\|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1	Back alignment and function description

>sp\|P42297\|YXIE_BACSU Universal stress protein YxiE OS=Bacillus subtilis (strain 168) GN=yxiE PE=3 SV=1	Back alignment and function description

>sp\|P72745\|Y1101_SYNY3 Universal stress protein Slr1101 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1101 PE=3 SV=1	Back alignment and function description

>sp\|P74148\|Y1388_SYNY3 Universal stress protein Sll1388 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1388 PE=3 SV=1	Back alignment and function description

>sp\|O07552\|NHAX_BACSU Stress response protein NhaX OS=Bacillus subtilis (strain 168) GN=nhaX PE=2 SV=2	Back alignment and function description

>sp\|O53472\|Y2026_MYCTU Universal stress protein Rv2026c/MT2085 OS=Mycobacterium tuberculosis GN=Rv2026c PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		81
297829748		200	universal stress protein family protein	0.864	0.35	0.785	7e-28
79313191		201	adenine nucleotide alpha hydrolases-like	0.864	0.348	0.757	4e-27
18399413		199	adenine nucleotide alpha hydrolases-like	0.864	0.351	0.757	4e-27
30681955		200	adenine nucleotide alpha hydrolases-like	0.864	0.35	0.757	5e-27
21594903		199	ethylene-responsive protein, putative [A	0.864	0.351	0.757	5e-27
359481111		203	PREDICTED: universal stress protein A-li	0.814	0.325	0.803	1e-25
296089313		129	unnamed protein product [Vitis vinifera]	0.814	0.511	0.803	4e-25
224139952		180	predicted protein [Populus trichocarpa]	0.938	0.422	0.684	4e-25
224088144		172	predicted protein [Populus trichocarpa]	0.925	0.436	0.706	3e-24
30694811		204	universal stress protein (USP) family pr	0.814	0.323	0.742	1e-23

>gi\|297829748\|ref\|XP_002882756.1\| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi\|297328596\|gb\|EFH59015.1\| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

 Score =  127 bits (319), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 55/70 (78%), Positives = 65/70 (92%)

Query: 3   QVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPIL 62
           Q+  +TL+L+GDA+++IC+AVEQMH+DLLVVGSRGLGK+KRAFLGSVSDYCAHHA CPIL
Sbjct: 131 QIRTETLVLEGDAKEMICEAVEQMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPIL 190

Query: 63  IVKPPKEHHK 72
           IVKPPKE  K
Sbjct: 191 IVKPPKEMTK 200

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|79313191\|ref\|NP_001030675.1\| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi\|332641601\|gb\|AEE75122.1\| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|18399413\|ref\|NP_566406.1\| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi\|332641598\|gb\|AEE75119.1\| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|30681955|ref|NP_850562.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|6671949|gb|AAF23209.1|AC016795_22 unknown protein [Arabidopsis thaliana] gi|13926250|gb|AAK49598.1|AF372882_1 MEC18.3/MEC18.3 [Arabidopsis thaliana] gi|16226626|gb|AAL16217.1|AF428448_1 At3g11930/MEC18.3 [Arabidopsis thaliana] gi|10998131|dbj|BAB03102.1| unnamed protein product [Arabidopsis thaliana] gi|15215662|gb|AAK91376.1| MEC18.3/MEC18.3 [Arabidopsis thaliana] gi|16323234|gb|AAL15351.1| AT3g11930/MEC18.3 [Arabidopsis thaliana] gi|332641600|gb|AEE75121.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|21594903\|gb\|AAM66054.1\| ethylene-responsive protein, putative [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|359481111\|ref\|XP_002266746.2\| PREDICTED: universal stress protein A-like protein [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296089313\|emb\|CBI39085.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224139952\|ref\|XP_002323356.1\| predicted protein [Populus trichocarpa] gi\|222867986\|gb\|EEF05117.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224088144\|ref\|XP_002308342.1\| predicted protein [Populus trichocarpa] gi\|222854318\|gb\|EEE91865.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|30694811\|ref\|NP_191404.2\| universal stress protein (USP) family protein [Arabidopsis thaliana] gi\|28393267\|gb\|AAO42062.1\| unknown protein [Arabidopsis thaliana] gi\|28827498\|gb\|AAO50593.1\| unknown protein [Arabidopsis thaliana] gi\|332646261\|gb\|AEE79782.1\| universal stress protein (USP) family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		81
TAIR\|locus:2081531		226	AT3G11930 "AT3G11930" [Arabido	0.506	0.181	0.658	2.1e-25
TAIR\|locus:2076381		204	AT3G58450 "AT3G58450" [Arabido	0.814	0.323	0.742	8.7e-24
TAIR\|locus:2024291		171	AT1G09740 "AT1G09740" [Arabido	0.814	0.385	0.545	5.3e-17
TAIR\|locus:2043273		162	AT2G47710 "AT2G47710" [Arabido	0.728	0.364	0.576	2.3e-16
TAIR\|locus:2084153		175	AT3G01520 "AT3G01520" [Arabido	0.790	0.365	0.468	4.4e-13
TAIR\|locus:2096089		162	AT3G62550 "AT3G62550" [Arabido	0.765	0.382	0.483	9.1e-13
TAIR\|locus:2199282		160	AT1G68300 "AT1G68300" [Arabido	0.654	0.331	0.509	2.4e-12
TAIR\|locus:2222687		175	AT5G14680 "AT5G14680" [Arabido	0.839	0.388	0.411	1.3e-11
TAIR\|locus:2131719		260	PHOS34 "AT4G27320" [Arabidopsi	0.753	0.234	0.421	3.1e-11
TAIR\|locus:2147319		242	PHOS32 "AT5G54430" [Arabidopsi	0.753	0.252	0.4	1.1e-10

TAIR\|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 161 (61.7 bits), Expect = 2.1e-25, Sum P(2) = 2.1e-25
 Identities = 27/41 (65%), Positives = 39/41 (95%)

Query:     3 QVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKR 43
             Q+  +TL+L+G+A+++IC+AVE+MH+DLLVVGSRGLGK+KR
Sbjct:   131 QIRTETLVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIKR 171

GO:0003674 "molecular_function" evidence=ND

GO:0005737 "cytoplasm" evidence=ISM

GO:0002238 "response to molecule of fungal origin" evidence=RCA

TAIR\|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2084153 AT3G01520 "AT3G01520" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2222687 AT5G14680 "AT5G14680" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.3__1240__AT3G11930.2	annotation not avaliable (200 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		81
cd00293		130	cd00293, USP_Like, Usp: Universal stress protein f	1e-18
pfam00582		139	pfam00582, Usp, Universal stress protein family	2e-17
COG0589		154	COG0589, UspA, Universal stress protein UspA and r	6e-13
cd01988		132	cd01988, Na_H_Antiporter_C, The C-terminal domain	1e-04

>gnl\|CDD\|238182 cd00293, USP_Like, Usp: Universal stress protein family	Back alignment and domain information

 Score = 73.2 bits (180), Expect = 1e-18
 Identities = 26/61 (42%), Positives = 42/61 (68%)

Query: 4   VNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILI 63
           V  +T++L+GD  + I +A E++  DL+V+GSRG   ++R  LGSV++    HA CP+L+
Sbjct: 70  VKVETVVLEGDPAEAILEAAEELGADLIVMGSRGRSGLRRLLLGSVAERVLRHAPCPVLV 129

Query: 64  V 64
           V
Sbjct: 130 V 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130

>gnl\|CDD\|216006 pfam00582, Usp, Universal stress protein family	Back alignment and domain information

>gnl\|CDD\|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|238946 cd01988, Na_H_Antiporter_C, The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		81
PRK15456		142	universal stress protein UspG; Provisional	99.82
PRK15005		144	universal stress protein F; Provisional	99.79
cd01989		146	STK_N The N-terminal domain of Eukaryotic Serine T	99.76
PF00582		140	Usp: Universal stress protein family; InterPro: IP	99.7
PRK11175		305	universal stress protein UspE; Provisional	99.69
cd01988		132	Na_H_Antiporter_C The C-terminal domain of a subfa	99.69
COG0589		154	UspA Universal stress protein UspA and related nuc	99.69
PRK09982		142	universal stress protein UspD; Provisional	99.69
PRK15118		144	universal stress global response regulator UspA; P	99.68
PRK11175		305	universal stress protein UspE; Provisional	99.65
PRK10116		142	universal stress protein UspC; Provisional	99.64
cd01987		124	USP_OKCHK USP domain is located between the N-term	99.62
cd00293		130	USP_Like Usp: Universal stress protein family. The	99.51
PRK10490		895	sensor protein KdpD; Provisional	98.39
cd01984		86	AANH_like Adenine nucleotide alpha hydrolases supe	98.21
PRK12652		357	putative monovalent cation/H+ antiporter subunit E	97.95
COG2205		890	KdpD Osmosensitive K+ channel histidine kinase [Si	97.87
PLN03159		832	cation/H(+) antiporter 15; Provisional	96.93
PRK00109		138	Holliday junction resolvase-like protein; Reviewed	92.22
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844		100	GARS_N: Phosphoribosylglycinamide synthetase, N do	91.75
COG0041		162	PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m	90.7
PF03652		135	UPF0081: Uncharacterised protein family (UPF0081);	90.42
TIGR00250		130	RNAse_H_YqgF RNAse H-fold protein YqgF. This prote	90.39
TIGR01162		156	purE phosphoribosylaminoimidazole carboxylase, Pur	88.21
PF02887		117	PK_C: Pyruvate kinase, alpha/beta domain; InterPro	87.87
COG1927		277	Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet	87.83
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	85.83
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	85.8
TIGR01826		310	CofD_related conserved hypothetical protein, cofD-	84.91
PRK00766		194	hypothetical protein; Provisional	84.67
PRK00994		277	F420-dependent methylenetetrahydromethanopterin de	84.58
PRK08185		283	hypothetical protein; Provisional	84.44
cd07187		308	YvcK_like family of mostly uncharacterized protein	83.74
PF07355		349	GRDB: Glycine/sarcosine/betaine reductase selenopr	83.11
PF02601		319	Exonuc_VII_L: Exonuclease VII, large subunit; Inte	82.49
PRK03359		256	putative electron transfer flavoprotein FixA; Revi	82.39
COG0420		390	SbcD DNA repair exonuclease [DNA replication, reco	82.13
cd01985		181	ETF The electron transfer flavoprotein (ETF) serve	81.52
cd07044		309	CofD_YvcK Family of CofD-like proteins and protein	80.7

>PRK15456 universal stress protein UspG; Provisional	Back alignment and domain information

Probab=99.82  E-value=5.5e-20  Score=108.25  Aligned_cols=62  Identities=27%  Similarity=0.466  Sum_probs=57.9

Q ss_pred             cceEEEEEecCCHHHHHHHHHHhcCCCEEEEcccCCCCCCceecCcHHHHHhhhCCccEEEEC
Q 038513            3 QVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVK   65 (81)
Q Consensus         3 ~v~~~~~~~~g~~~~~I~~~a~~~~~dliVmG~~~~~~~~~~~~gs~~~~vi~~~~~Pvlvv~   65 (81)
                      ++++++.+..|+|.++|.++++++++||||||++|++ +.++++||++++++++++||||+||
T Consensus        81 ~~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         81 PSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             CcceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCEEEeC
Confidence            4577888999999999999999999999999999976 7888999999999999999999986

>PRK15005 universal stress protein F; Provisional	Back alignment and domain information

>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases	Back alignment and domain information

>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents	Back alignment and domain information

>PRK11175 universal stress protein UspE; Provisional	Back alignment and domain information

>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea	Back alignment and domain information

>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK09982 universal stress protein UspD; Provisional	Back alignment and domain information

>PRK15118 universal stress global response regulator UspA; Provisional	Back alignment and domain information

>PRK11175 universal stress protein UspE; Provisional	Back alignment and domain information

>PRK10116 universal stress protein UspC; Provisional	Back alignment and domain information

>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family	Back alignment and domain information

>cd00293 USP_Like Usp: Universal stress protein family	Back alignment and domain information

>PRK10490 sensor protein KdpD; Provisional	Back alignment and domain information

>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF)	Back alignment and domain information

>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed	Back alignment and domain information

>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]	Back alignment and domain information

>PLN03159 cation/H(+) antiporter 15; Provisional	Back alignment and domain information

>PRK00109 Holliday junction resolvase-like protein; Reviewed	Back alignment and domain information

>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6	Back alignment and domain information

>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination	Back alignment and domain information

>TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF	Back alignment and domain information

>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein	Back alignment and domain information

>PF02887 PK_C: Pyruvate kinase, alpha/beta domain; InterPro: IPR015795 Pyruvate kinase (2	Back alignment and domain information

>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion]	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>TIGR01826 CofD_related conserved hypothetical protein, cofD-related	Back alignment and domain information

>PRK00766 hypothetical protein; Provisional	Back alignment and domain information

>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>cd07187 YvcK_like family of mostly uncharacterized proteins similar to B	Back alignment and domain information

>PF07355 GRDB: Glycine/sarcosine/betaine reductase selenoprotein B (GRDB); InterPro: IPR022787 This entry represents selenoprotein B of glycine reductase, sarcosine reductase, betaine reductase, D-proline reductase, and perhaps others	Back alignment and domain information

>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3	Back alignment and domain information

>PRK03359 putative electron transfer flavoprotein FixA; Reviewed	Back alignment and domain information

>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases	Back alignment and domain information

>cd07044 CofD_YvcK Family of CofD-like proteins and proteins related to YvcK	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		81
2gm3_A		175	Crystal Structure Of An Universal Stress Protein Fa		1e-13
1wjg_A		137	Crystal Structure Of A Probable Atp Binding Protein		3e-07

>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175

Back alignment and structure

Iteration: 1

Score = 71.6 bits (174), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 30/64 (46%), Positives = 44/64 (68%) Query: 2 VQVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPI 61 + V + I GD +DVICQ V+++ D LVVGSRGLG+ ++ F+G+VS +C HA CP+ Sbjct: 99 IGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPV 158 Query: 62 LIVK 65 +K Sbjct: 159 XTIK 162

PyMOL of 2gm3

>pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		81
2gm3_A		175	Unknown protein; AT3G01520, putative ethylene-resp	6e-30
1tq8_A		163	Hypothetical protein RV1636; MTCY01B2.28, structur	1e-21
2dum_A		170	Hypothetical protein PH0823; conserved hypothetica	8e-20
2z08_A		137	Universal stress protein family; uncharacterized c	9e-20
1mjh_A		162	Protein (ATP-binding domain of protein MJ0577); hy	1e-19
3idf_A		138	USP-like protein; universal, stress, PSI, MCSG, st	1e-19
3s3t_A		146	Nucleotide-binding protein, universal stress PROT	3e-19
3loq_A		294	Universal stress protein; structural genomics, PSI	2e-18
3loq_A		294	Universal stress protein; structural genomics, PSI	7e-14
3tnj_A		150	Universal stress protein (USP); structural genomic	8e-18
3hgm_A		147	Universal stress protein TEAD; rossman fold, signa	9e-18
3dlo_A		155	Universal stress protein; unknown function, struct	3e-17
3fdx_A		143	Putative filament protein / universal stress PROT;	3e-16
3fg9_A		156	Protein of universal stress protein USPA family; A	2e-15
1jmv_A		141	USPA, universal stress protein A; chaperone; 1.85A	3e-15
3olq_A		319	Universal stress protein E; structural genomics, P	3e-15
3olq_A		319	Universal stress protein E; structural genomics, P	3e-09
3cis_A		309	Uncharacterized protein; alpha/beta hydrolase, ATP	6e-15
3cis_A		309	Uncharacterized protein; alpha/beta hydrolase, ATP	7e-14
3mt0_A		290	Uncharacterized protein PA1789; structural genomic	3e-14
3mt0_A		290	Uncharacterized protein PA1789; structural genomic	4e-09
3ab8_A		268	Putative uncharacterized protein TTHA0350; tandem-	6e-12
3ab8_A		268	Putative uncharacterized protein TTHA0350; tandem-	6e-11

>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175	Back alignment and structure

 Score =  102 bits (257), Expect = 6e-30
 Identities = 31/75 (41%), Positives = 46/75 (61%)

Query: 4   VNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILI 63
           V  +  I  GD +DVICQ V+++  D LVVGSRGLG+ ++ F+G+VS +C  HA CP++ 
Sbjct: 101 VGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMT 160

Query: 64  VKPPKEHHKHKNFKD 78
           +K   +        D
Sbjct: 161 IKRNADETPSDPADD 175

PyMOL of 2gm3

>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163	Back alignment and structure

>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170	Back alignment and structure

>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137	Back alignment and structure

>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162	Back alignment and structure

>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138	Back alignment and structure

>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146	Back alignment and structure

>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294	Back alignment and structure

>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294	Back alignment and structure

>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150	Back alignment and structure

>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147	Back alignment and structure

>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155	Back alignment and structure

>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143	Back alignment and structure

>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156	Back alignment and structure

>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141	Back alignment and structure

>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319	Back alignment and structure

>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319	Back alignment and structure

>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309	Back alignment and structure

>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309	Back alignment and structure

>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290	Back alignment and structure

>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290	Back alignment and structure

>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268	Back alignment and structure

>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		81
2gm3_A		175	Unknown protein; AT3G01520, putative ethylene-resp	99.83
1mjh_A		162	Protein (ATP-binding domain of protein MJ0577); hy	99.82
1tq8_A		163	Hypothetical protein RV1636; MTCY01B2.28, structur	99.8
3s3t_A		146	Nucleotide-binding protein, universal stress PROT	99.79
2z08_A		137	Universal stress protein family; uncharacterized c	99.79
2dum_A		170	Hypothetical protein PH0823; conserved hypothetica	99.79
3fdx_A		143	Putative filament protein / universal stress PROT;	99.78
3hgm_A		147	Universal stress protein TEAD; rossman fold, signa	99.78
3tnj_A		150	Universal stress protein (USP); structural genomic	99.77
3dlo_A		155	Universal stress protein; unknown function, struct	99.76
3fg9_A		156	Protein of universal stress protein USPA family; A	99.75
3idf_A		138	USP-like protein; universal, stress, PSI, MCSG, st	99.75
3mt0_A		290	Uncharacterized protein PA1789; structural genomic	99.69
3loq_A		294	Universal stress protein; structural genomics, PSI	99.69
3cis_A		309	Uncharacterized protein; alpha/beta hydrolase, ATP	99.67
3olq_A		319	Universal stress protein E; structural genomics, P	99.66
1jmv_A		141	USPA, universal stress protein A; chaperone; 1.85A	99.66
3olq_A		319	Universal stress protein E; structural genomics, P	99.65
3ab8_A		268	Putative uncharacterized protein TTHA0350; tandem-	99.65
3cis_A		309	Uncharacterized protein; alpha/beta hydrolase, ATP	99.64
3mt0_A		290	Uncharacterized protein PA1789; structural genomic	99.63
1q77_A		138	Hypothetical protein AQ_178; structural genomics,	99.57
3loq_A		294	Universal stress protein; structural genomics, PSI	99.55
3ab8_A		268	Putative uncharacterized protein TTHA0350; tandem-	99.48
2iel_A		138	Hypothetical protein TT0030; TT0030,thermus thermo	94.56
1iv0_A		98	Hypothetical protein; rnaseh-like, YQGF, structura	94.36
1nu0_A		138	Hypothetical protein YQGF; structural genomics, st	89.78
3oow_A		166	Phosphoribosylaminoimidazole carboxylase,catalyic;	88.6
4b4k_A		181	N5-carboxyaminoimidazole ribonucleotide mutase; is	88.54
4grd_A		173	N5-CAIR mutase, phosphoribosylaminoimidazole carbo	88.23
1vhx_A		150	Putative holliday junction resolvase; structural g	87.53
3lp6_A		174	Phosphoribosylaminoimidazole carboxylase catalyti;	87.36
2ywx_A		157	Phosphoribosylaminoimidazole carboxylase catalyti;	87.06
3trh_A		169	Phosphoribosylaminoimidazole carboxylase carboxylt	86.82
1o4v_A		183	Phosphoribosylaminoimidazole mutase PURE; structur	85.58
3ors_A		163	N5-carboxyaminoimidazole ribonucleotide mutase; is	85.01
3kuu_A		174	Phosphoribosylaminoimidazole carboxylase catalyti	84.43
1xmp_A		170	PURE, phosphoribosylaminoimidazole carboxylase; pu	83.86
1qv9_A		283	F420-dependent methylenetetrahydromethanopterin de	82.67
1o97_C		264	Electron transferring flavoprotein beta-subunit; F	81.95
1u11_A		182	PURE (N5-carboxyaminoimidazole ribonucleotide MUT;	81.86
1efv_B		255	Electron transfer flavoprotein; electron transport	81.1
1efp_B		252	ETF, protein (electron transfer flavoprotein); ele	80.45

>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4	Back alignment and structure

Probab=99.83  E-value=2.7e-20  Score=111.20  Aligned_cols=74  Identities=41%  Similarity=0.820  Sum_probs=58.9

Q ss_pred             cceEEEEEecCCHHHHHHHHHHhcCCCEEEEcccCCCCCCceecCcHHHHHhhhCCccEEEECCCCCCCCCCCC
Q 038513            3 QVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKPPKEHHKHKNF   76 (81)
Q Consensus         3 ~v~~~~~~~~g~~~~~I~~~a~~~~~dliVmG~~~~~~~~~~~~gs~~~~vi~~~~~Pvlvv~~~~~~~~~~~~   76 (81)
                      |+++++.+..|++.++|+++++++++||||||+++++.+.++++||++++|+++++||||+||..........|
T Consensus       100 g~~~~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~~~~~~~~Gsva~~vl~~a~~pVlvv~~~~~~~~~~p~  173 (175)
T 2gm3_A          100 GVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADETPSDPA  173 (175)
T ss_dssp             TCEEEEEEEESCHHHHHHHHHHHHCCSEEEEEECCCC--------CHHHHHHHHCSSCEEEEECCGGGSCSSTT
T ss_pred             CCceEEEEecCCHHHHHHHHHHHhCCCEEEEeCCCCChhhhhhcCchHHHHHhCCCCCEEEEcCCcCCCCCCCC
Confidence            57788888999999999999999999999999999999999999999999999999999999987655544444

PyMOL of 2gm3

>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4	Back alignment and structure

>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4	Back alignment and structure

>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0	Back alignment and structure

>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A	Back alignment and structure

>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A*	Back alignment and structure

>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0	Back alignment and structure

>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A*	Back alignment and structure

>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A*	Back alignment and structure

>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum}	Back alignment and structure

>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes}	Back alignment and structure

>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa}	Back alignment and structure

>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus}	Back alignment and structure

>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A*	Back alignment and structure

>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis}	Back alignment and structure

>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4	Back alignment and structure

>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis}	Back alignment and structure

>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A*	Back alignment and structure

>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A*	Back alignment and structure

>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa}	Back alignment and structure

>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4	Back alignment and structure

>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus}	Back alignment and structure

>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A*	Back alignment and structure

>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4	Back alignment and structure

>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8	Back alignment and structure

>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A	Back alignment and structure

>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A*	Back alignment and structure

>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis}	Back alignment and structure

>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia}	Back alignment and structure

>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8	Back alignment and structure

>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0	Back alignment and structure

>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii}	Back alignment and structure

>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii}	Back alignment and structure

>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1	Back alignment and structure

>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp}	Back alignment and structure

>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A*	Back alignment and structure

>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1	Back alignment and structure

>1qv9_A F420-dependent methylenetetrahydromethanopterin dehydrogenase; monomer: alpha/beta domain, helix bundle, trimer of dimers, oxidoreductase; HET: MSE; 1.54A {Methanopyrus kandleri} SCOP: c.127.1.1 PDB: 1u6i_A 1u6j_A 1u6k_A* 3iqe_A* 3iqf_A* 3iqz_A*	Back alignment and structure

>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C*	Back alignment and structure

>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A	Back alignment and structure

>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S*	Back alignment and structure

>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		81
d2gm3a1		171	c.26.2.4 (A:5-175) Putative ethylene-responsive pr	2e-14
d1mjha_		160	c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa	4e-12
d1tq8a_		147	c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac	8e-12
d2z3va1		135	c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {	2e-11
d1jmva_		140	c.26.2.4 (A:) Universal stress protein A, UspA {Ha	6e-07

>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 62.2 bits (150), Expect = 2e-14
 Identities = 29/65 (44%), Positives = 44/65 (67%)

Query: 5   NAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIV 64
             +  I  GD +DVICQ V+++  D LVVGSRGLG+ ++ F+G+VS +C  HA CP++ +
Sbjct: 98  GCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTI 157

Query: 65  KPPKE 69
           K   +
Sbjct: 158 KRNAD 162

PyMOL of d2gm3a1

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160	Back information, alignment and structure

>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147	Back information, alignment and structure

>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135	Back information, alignment and structure

>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		81
d1mjha_		160	"Hypothetical" protein MJ0577 {Archaeon Methanococ	99.84
d2gm3a1		171	Putative ethylene-responsive protein AT3g01520/F4P	99.81
d1tq8a_		147	Hypothetical protein Rv1636 {Mycobacterium tubercu	99.75
d2z3va1		135	Hypothetical protein TTHA0895 {Thermus thermophilu	99.74
d1jmva_		140	Universal stress protein A, UspA {Haemophilus infl	99.6
d1q77a_		138	Hypothetical protein Aq_178 {Aquifex aeolicus [Tax	99.38
d1nu0a_		138	Hypothetical protein YqgF (RuvX) {Escherichia coli	91.19
d1gsoa2		105	Glycinamide ribonucleotide synthetase (GAR-syn), N	90.65
d1u11a_		159	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	90.25
d1iv0a_		98	Hypothetical protein, YqgF homologue {Thermus ther	89.01
d3clsc1		262	Small, beta subunit of electron transfer flavoprot	88.76
d1qcza_		163	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	88.61
d1xmpa_		155	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	87.94
d1uf3a_		228	Hypothetical protein TT1561 {Thermus thermophilus	87.83
d1o4va_		169	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	87.69
d2a9pa1		117	DNA-binding response regulator MicA, N-terminal do	86.55
d1efpb_		246	Small, beta subunit of electron transfer flavoprot	86.44
d2pjua1		186	Propionate catabolism operon regulatory protein Pr	85.67
d1efvb_		252	Small, beta subunit of electron transfer flavoprot	85.23
d1vhxa_		140	Hypothetical protein YrrK (RuvX) {Bacillus subtili	84.97
d3bzka5		149	Transcriptional accessory factor Tex {Pseudomonas	84.25
d1xhfa1		121	Aerobic respiration control protein ArcA, N-termin	80.1

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.84  E-value=7.3e-21  Score=111.02  Aligned_cols=66  Identities=26%  Similarity=0.481  Sum_probs=63.2

Q ss_pred             cceEEEEEecCCHHHHHHHHHHhcCCCEEEEcccCCCCCCceecCcHHHHHhhhCCccEEEECCCC
Q 038513            3 QVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKPPK   68 (81)
Q Consensus         3 ~v~~~~~~~~g~~~~~I~~~a~~~~~dliVmG~~~~~~~~~~~~gs~~~~vi~~~~~Pvlvv~~~~   68 (81)
                      |+++++.+..|+|.+.|+++|+++++||||||+++++++.++|+||++++|+++++||||+||++.
T Consensus        94 gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~~~  159 (160)
T d1mjha_          94 GFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRKN  159 (160)
T ss_dssp             TCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECCCC
T ss_pred             CCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcCCC
Confidence            578889999999999999999999999999999999999999999999999999999999999764

PyMOL of d1mjha_

>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}	Back information, alignment and structure

>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}	Back information, alignment and structure

>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure