Citrus Sinensis ID: 038516


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------71
MPPTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELHRLRGNMRKLVTDEFGKEVI
cccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccc
ccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccc
MPPTHENLCRNIATLIQICASITSLKRARQIHALVLTtnhipinaqspymYNNVLSMygrcgsirdarqvfdeipkrsLVSYNALIAAYSRDHDHAHLTFRLIDQMEfeclrpngltfTSLAQAVSLLEDQLMGSLLHAQVIKygssedtcvQTSLLgmysncgdfesAKRIFGLIGDKDAVAWNSIIlgnfkndkmKEGLSLFGAmvgsgvnptqFSYSMLLNACSRMGNFVCGKVIHARVIIsntqvdlpLENALLDMYSKCSDTQTAFSVFtrienpdlvswNSMIAGYmengngekAVDMFVALRRMSLLKPDEYTFAAIISATsalpasaygkplhALVIKTGYDSSVFVGTTLLNMyfkngdaespQKVFMLIAEKDIVLWTEMIighsrmgdgECAIKLFCKMCreglkcdnfalSGALSACADLAILKQGEMIHSqaektghgvemsVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALlggyshygmaEEAFMVFEVILehglrpdeITFLSLLSACSHSGLVERGKILWNQMkehslipghkhYSCMVSLLSRaglldeaenliaespysEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLrldpedgttHILLSNLYAATGRWDCVAKMRRKMkgsmlgkepglswieaknnvhvfssgdqshpkiDDAQAELHRLRGNMRKLVTDEFGKEVI
mppthenlCRNIATLIQICASITSLKRARQIHALVLttnhipinaqSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLsnlyaatgrWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFssgdqshpkIDDAQAELHRLRGNmrklvtdefgkevi
MPPTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELHRLRGNMRKLVTDEFGKEVI
*******LCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRK**********GLSWIEAKNNVHV**************************************
*PPTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELHRLRGNMRKLVTDE*GKEV*
MPPTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELHRLRGNMRKLVTDEFGKEVI
****HENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELHRLRGNMRKLVTDEFGKE*I
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKxxxxxxxxxxxxxxxxxxxxxEFGKEVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query708 2.2.26 [Sep-21-2011]
Q9SCT2794 Pentatricopeptide repeat- yes no 0.990 0.882 0.568 0.0
Q9SVP71064 Pentatricopeptide repeat- no no 0.956 0.636 0.331 1e-114
Q9LFI1768 Pentatricopeptide repeat- no no 0.959 0.884 0.352 1e-111
Q9LYV3822 Putative pentatricopeptid no no 0.884 0.761 0.335 1e-109
Q9ZUW3868 Pentatricopeptide repeat- no no 0.954 0.778 0.321 1e-108
Q9FWA6903 Pentatricopeptide repeat- no no 0.973 0.763 0.314 1e-106
P93005727 Pentatricopeptide repeat- no no 0.925 0.900 0.320 1e-104
Q9STS9706 Putative pentatricopeptid no no 0.957 0.960 0.322 1e-103
O04659691 Pentatricopeptide repeat- no no 0.951 0.975 0.311 2e-99
Q7XJN6860 Pentatricopeptide repeat- no no 0.937 0.772 0.341 4e-99
>sp|Q9SCT2|PP277_ARATH Pentatricopeptide repeat-containing protein At3g50420 OS=Arabidopsis thaliana GN=PCMP-E85 PE=2 SV=1 Back     alignment and function desciption
 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/707 (56%), Positives = 522/707 (73%), Gaps = 6/707 (0%)

Query: 3   PTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCG 62
           P +E +  ++  L + C SIT LKRARQIHALVLT        +SPY  NN++SMY RCG
Sbjct: 89  PLNE-IASSVVELTRKCVSITVLKRARQIHALVLTAG-AGAATESPYANNNLISMYVRCG 146

Query: 63  SIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLA 122
           S+  AR+VFD++P R++VSYNAL +AYSR+ D A   F L   M FE ++PN  TFTSL 
Sbjct: 147 SLEQARKVFDKMPHRNVVSYNALYSAYSRNPDFASYAFPLTTHMAFEYVKPNSSTFTSLV 206

Query: 123 QAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAV 182
           Q  ++LED LMGS L++Q+IK G S++  VQTS+LGMYS+CGD ESA+RIF  + ++DAV
Sbjct: 207 QVCAVLEDVLMGSSLNSQIIKLGYSDNVVVQTSVLGMYSSCGDLESARRIFDCVNNRDAV 266

Query: 183 AWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARV 242
           AWN++I+G+ KNDK+++GL  F  M+ SGV+PTQF+YS++LN CS++G++  GK+IHAR+
Sbjct: 267 AWNTMIVGSLKNDKIEDGLMFFRNMLMSGVDPTQFTYSIVLNGCSKLGSYSLGKLIHARI 326

Query: 243 IISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAV 302
           I+S++  DLPL+NALLDMY  C D + AF VF RI NP+LVSWNS+I+G  ENG GE+A+
Sbjct: 327 IVSDSLADLPLDNALLDMYCSCGDMREAFYVFGRIHNPNLVSWNSIISGCSENGFGEQAM 386

Query: 303 DMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNM 362
            M+  L RMS  +PDEYTF+A ISAT+      +GK LH  V K GY+ SVFVGTTLL+M
Sbjct: 387 LMYRRLLRMSTPRPDEYTFSAAISATAEPERFVHGKLLHGQVTKLGYERSVFVGTTLLSM 446

Query: 363 YFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFAL 422
           YFKN +AES QKVF ++ E+D+VLWTEMI+GHSR+G+ E A++ F +M RE  + D F+L
Sbjct: 447 YFKNREAESAQKVFDVMKERDVVLWTEMIVGHSRLGNSELAVQFFIEMYREKNRSDGFSL 506

Query: 423 SGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLH 482
           S  + AC+D+A+L+QGE+ H  A +TG    MSVCG+LVDMY KNG    AE+IFS   +
Sbjct: 507 SSVIGACSDMAMLRQGEVFHCLAIRTGFDCVMSVCGALVDMYGKNGKYETAETIFSLASN 566

Query: 483 PDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKIL 542
           PDLKCWN++LG YS +GM E+A   FE ILE+G  PD +T+LSLL+ACSH G   +GK L
Sbjct: 567 PDLKCWNSMLGAYSQHGMVEKALSFFEQILENGFMPDAVTYLSLLAACSHRGSTLQGKFL 626

Query: 543 WNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKR 602
           WNQMKE  +  G KHYSCMV+L+S+AGL+DEA  LI +SP    + ELWRTLLS CV  R
Sbjct: 627 WNQMKEQGIKAGFKHYSCMVNLVSKAGLVDEALELIEQSPPGNNQAELWRTLLSACVNTR 686

Query: 603 NSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWI 662
           N ++ + AAEQ+L+LDPED  THILLSNLYA  GRW+ VA+MRRK++G    K+PGLSWI
Sbjct: 687 NLQIGLYAAEQILKLDPEDTATHILLSNLYAVNGRWEDVAEMRRKIRGLASSKDPGLSWI 746

Query: 663 EA-KNNVHVFSSGDQSHPK-IDDAQAELHRLRGNMRKLVTDEFGKEV 707
           E   NN  VFSSGDQS+P+ +  AQ EL+RL+ NM  L    F K V
Sbjct: 747 EVNNNNTQVFSSGDQSNPEVVSQAQDELNRLKRNM--LCKSSFNKLV 791





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein At3g53360, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E86 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H89 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2 Back     alignment and function description
>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=3 SV=1 Back     alignment and function description
>sp|Q9STS9|PP268_ARATH Putative pentatricopeptide repeat-containing protein At3g47840 OS=Arabidopsis thaliana GN=PCMP-E43 PE=3 SV=1 Back     alignment and function description
>sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protein At5g27110 OS=Arabidopsis thaliana GN=PCMP-E14 PE=2 SV=2 Back     alignment and function description
>sp|Q7XJN6|PP197_ARATH Pentatricopeptide repeat-containing protein At2g40720 OS=Arabidopsis thaliana GN=PCMP-E26 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query708
255562697704 pentatricopeptide repeat-containing prot 0.977 0.982 0.621 0.0
356540705715 PREDICTED: pentatricopeptide repeat-cont 0.970 0.960 0.595 0.0
357483095 985 Pentatricopeptide repeat-containing prot 0.980 0.704 0.579 0.0
297819724764 pentatricopeptide repeat-containing prot 0.971 0.900 0.582 0.0
15229753794 pentatricopeptide repeat-containing prot 0.990 0.882 0.568 0.0
449460648696 PREDICTED: pentatricopeptide repeat-cont 0.974 0.991 0.544 0.0
224084249561 predicted protein [Populus trichocarpa] 0.778 0.982 0.658 0.0
449502762690 PREDICTED: pentatricopeptide repeat-cont 0.919 0.943 0.518 0.0
359359183760 putative pentatricopeptide [Oryza minuta 0.949 0.884 0.470 1e-179
115461254719 Os04g0672700 [Oryza sativa Japonica Grou 0.947 0.933 0.466 1e-175
>gi|255562697|ref|XP_002522354.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538432|gb|EEF40038.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/692 (62%), Positives = 541/692 (78%)

Query: 12  IATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVF 71
           +  LI+ C +I SLK+ARQ+HAL+L T      AQSPY+ NN+++MY  CGS  DA+++F
Sbjct: 7   LEALIKKCTTINSLKKARQLHALILATTASTSYAQSPYLNNNLIAMYAHCGSRSDAQKLF 66

Query: 72  DEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQ 131
           D +P+++ +SYNALIAAY RD  +  L+F+L   M  + LRPNG TFTSL Q   LLED 
Sbjct: 67  DRMPRKNAISYNALIAAYCRDSSYETLSFKLFSDMGIQRLRPNGATFTSLLQVCCLLEDW 126

Query: 132 LMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAVAWNSIILGN 191
            +GS LH QV+++G   D CVQT LLGMYS+CGD ESA ++FG   +KD V WNS+I G 
Sbjct: 127 FLGSTLHGQVLQFGYVNDICVQTMLLGMYSDCGDLESACKVFGYAVEKDDVFWNSMISGY 186

Query: 192 FKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIISNTQVDL 251
            KND++KE LSLFG MV SG   TQF+ SM LNACS++G +  G++IHA+VI+SN   D 
Sbjct: 187 LKNDRIKESLSLFGEMVRSGTIFTQFTCSMALNACSKLGYYSQGRIIHAQVIVSNILPDS 246

Query: 252 PLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRM 311
            L+NALLDMY  C D +TA ++F+RI+ P L+SWNSMI+ + +N  GEKA+ +FV L  M
Sbjct: 247 ALQNALLDMYYSCGDRRTALTLFSRIQIPSLISWNSMISWFAKNEEGEKAMGLFVKLLGM 306

Query: 312 SLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAES 371
           S  KPDEYTF AIISAT    A+ YG+PLHA VIK G   SVF+G  LL+MYF+N D E+
Sbjct: 307 STCKPDEYTFTAIISATGEFRATDYGQPLHAQVIKAGLQWSVFIGNALLSMYFRNSDVEA 366

Query: 372 PQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACAD 431
            + VF L+ EKD+VLWTEMI+GH R+GDGE AIKLFCKM +EG K D+FALSGALS CAD
Sbjct: 367 ARGVFSLMEEKDVVLWTEMIMGHCRLGDGESAIKLFCKMRQEGHKSDSFALSGALSVCAD 426

Query: 432 LAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDLKCWNAL 491
           LAILKQG+M+H+QA KTG   E+SVCGSLVDMYAKNG+L+AA+ IFSQV +PDLKCWN++
Sbjct: 427 LAILKQGQMLHTQAVKTGCEAEISVCGSLVDMYAKNGNLQAAQLIFSQVCNPDLKCWNSM 486

Query: 492 LGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEHSL 551
           +GGYSH+GMAEEA M+F  +LE GL PD++TFLSLLSAC+HSGLVE+GK LW+ MK++ +
Sbjct: 487 IGGYSHHGMAEEAVMLFAEVLECGLTPDQVTFLSLLSACNHSGLVEKGKFLWDYMKKNGI 546

Query: 552 IPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAA 611
            PG KHYSCMVSLLSRAGLLDEAE LI ES  SE  ++LWRTLLS+CV +RN  +  +AA
Sbjct: 547 TPGPKHYSCMVSLLSRAGLLDEAEELITESTCSEEHLKLWRTLLSSCVNRRNLTVGARAA 606

Query: 612 EQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWIEAKNNVHVF 671
           +QVLRLDPED  T+ILLSNLYA TGRWD VA++R+K++G ML K+PG+SWIEAKN++HVF
Sbjct: 607 KQVLRLDPEDSATYILLSNLYAVTGRWDGVAELRKKIRGLMLEKDPGVSWIEAKNDIHVF 666

Query: 672 SSGDQSHPKIDDAQAELHRLRGNMRKLVTDEF 703
           SS DQS+P ID+AQAE+ RL+ NM + VTDE+
Sbjct: 667 SSDDQSNPVIDEAQAEVRRLQRNMIRSVTDEY 698




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356540705|ref|XP_003538826.1| PREDICTED: pentatricopeptide repeat-containing protein At3g50420-like [Glycine max] Back     alignment and taxonomy information
>gi|357483095|ref|XP_003611834.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513169|gb|AES94792.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297819724|ref|XP_002877745.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323583|gb|EFH54004.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15229753|ref|NP_190611.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75202753|sp|Q9SCT2.1|PP277_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g50420 gi|6561982|emb|CAB62471.1| putative protein [Arabidopsis thaliana] gi|332645144|gb|AEE78665.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449460648|ref|XP_004148057.1| PREDICTED: pentatricopeptide repeat-containing protein At3g50420-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224084249|ref|XP_002307242.1| predicted protein [Populus trichocarpa] gi|222856691|gb|EEE94238.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449502762|ref|XP_004161735.1| PREDICTED: pentatricopeptide repeat-containing protein At3g50420-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359359183|gb|AEV41088.1| putative pentatricopeptide [Oryza minuta] Back     alignment and taxonomy information
>gi|115461254|ref|NP_001054227.1| Os04g0672700 [Oryza sativa Japonica Group] gi|70663948|emb|CAE54552.2| OSJNBb0004A17.12 [Oryza sativa Japonica Group] gi|113565798|dbj|BAF16141.1| Os04g0672700 [Oryza sativa Japonica Group] gi|125592028|gb|EAZ32378.1| hypothetical protein OsJ_16588 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query708
TAIR|locus:2098670794 AT3G50420 [Arabidopsis thalian 0.990 0.882 0.568 2.1e-215
TAIR|locus:21194401064 AT4G13650 [Arabidopsis thalian 0.937 0.624 0.334 2.7e-107
TAIR|locus:2083961768 AT3G53360 "AT3G53360" [Arabido 0.959 0.884 0.352 1.7e-105
TAIR|locus:2183931822 AT5G13230 [Arabidopsis thalian 0.908 0.782 0.332 1.8e-103
TAIR|locus:2038603868 AT2G27610 "AT2G27610" [Arabido 0.954 0.778 0.321 4.2e-102
TAIR|locus:2057630727 AT2G33680 "AT2G33680" [Arabido 0.925 0.900 0.320 7.9e-101
TAIR|locus:2162207 830 CRR21 "chlororespiratory reduc 0.699 0.596 0.276 3.6e-51
TAIR|locus:2100392706 AT3G47840 [Arabidopsis thalian 0.942 0.944 0.327 4.5e-98
TAIR|locus:2196583866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.937 0.766 0.329 2e-97
TAIR|locus:2064828860 AT2G40720 [Arabidopsis thalian 0.937 0.772 0.341 5.2e-97
TAIR|locus:2098670 AT3G50420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2062 (730.9 bits), Expect = 2.1e-215, Sum P(2) = 2.1e-215
 Identities = 402/707 (56%), Positives = 522/707 (73%)

Query:     3 PTHENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCG 62
             P +E +  ++  L + C SIT LKRARQIHALVLT        +SPY  NN++SMY RCG
Sbjct:    89 PLNE-IASSVVELTRKCVSITVLKRARQIHALVLTAG-AGAATESPYANNNLISMYVRCG 146

Query:    63 SIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLA 122
             S+  AR+VFD++P R++VSYNAL +AYSR+ D A   F L   M FE ++PN  TFTSL 
Sbjct:   147 SLEQARKVFDKMPHRNVVSYNALYSAYSRNPDFASYAFPLTTHMAFEYVKPNSSTFTSLV 206

Query:   123 QAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDKDAV 182
             Q  ++LED LMGS L++Q+IK G S++  VQTS+LGMYS+CGD ESA+RIF  + ++DAV
Sbjct:   207 QVCAVLEDVLMGSSLNSQIIKLGYSDNVVVQTSVLGMYSSCGDLESARRIFDCVNNRDAV 266

Query:   183 AWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARV 242
             AWN++I+G+ KNDK+++GL  F  M+ SGV+PTQF+YS++LN CS++G++  GK+IHAR+
Sbjct:   267 AWNTMIVGSLKNDKIEDGLMFFRNMLMSGVDPTQFTYSIVLNGCSKLGSYSLGKLIHARI 326

Query:   243 IISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAV 302
             I+S++  DLPL+NALLDMY  C D + AF VF RI NP+LVSWNS+I+G  ENG GE+A+
Sbjct:   327 IVSDSLADLPLDNALLDMYCSCGDMREAFYVFGRIHNPNLVSWNSIISGCSENGFGEQAM 386

Query:   303 DMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNM 362
              M+  L RMS  +PDEYTF+A ISAT+      +GK LH  V K GY+ SVFVGTTLL+M
Sbjct:   387 LMYRRLLRMSTPRPDEYTFSAAISATAEPERFVHGKLLHGQVTKLGYERSVFVGTTLLSM 446

Query:   363 YFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFAL 422
             YFKN +AES QKVF ++ E+D+VLWTEMI+GHSR+G+ E A++ F +M RE  + D F+L
Sbjct:   447 YFKNREAESAQKVFDVMKERDVVLWTEMIVGHSRLGNSELAVQFFIEMYREKNRSDGFSL 506

Query:   423 SGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLH 482
             S  + AC+D+A+L+QGE+ H  A +TG    MSVCG+LVDMY KNG    AE+IFS   +
Sbjct:   507 SSVIGACSDMAMLRQGEVFHCLAIRTGFDCVMSVCGALVDMYGKNGKYETAETIFSLASN 566

Query:   483 PDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKIL 542
             PDLKCWN++LG YS +GM E+A   FE ILE+G  PD +T+LSLL+ACSH G   +GK L
Sbjct:   567 PDLKCWNSMLGAYSQHGMVEKALSFFEQILENGFMPDAVTYLSLLAACSHRGSTLQGKFL 626

Query:   543 WNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKR 602
             WNQMKE  +  G KHYSCMV+L+S+AGL+DEA  LI +SP    + ELWRTLLS CV  R
Sbjct:   627 WNQMKEQGIKAGFKHYSCMVNLVSKAGLVDEALELIEQSPPGNNQAELWRTLLSACVNTR 686

Query:   603 NSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKMKGSMLGKEPGLSWI 662
             N ++ + AAEQ+L+LDPED  THILLSNLYA  GRW+ VA+MRRK++G    K+PGLSWI
Sbjct:   687 NLQIGLYAAEQILKLDPEDTATHILLSNLYAVNGRWEDVAEMRRKIRGLASSKDPGLSWI 746

Query:   663 EAKNN-VHVFSSGDQSHPKI-DDAQAELHRLRGNMRKLVTDEFGKEV 707
             E  NN   VFSSGDQS+P++   AQ EL+RL+ NM  L    F K V
Sbjct:   747 EVNNNNTQVFSSGDQSNPEVVSQAQDELNRLKRNM--LCKSSFNKLV 791


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083961 AT3G53360 "AT3G53360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183931 AT5G13230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057630 AT2G33680 "AT2G33680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162207 CRR21 "chlororespiratory reduction 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100392 AT3G47840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064828 AT2G40720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SCT2PP277_ARATHNo assigned EC number0.56850.99010.8828yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00008484001
SubName- Full=Chromosome undetermined scaffold_1496, whole genome shotgun sequence; Flags- Fragment; (720 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query708
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-139
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-89
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-69
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-67
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-55
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-51
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-48
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-22
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-04
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  428 bits (1102), Expect = e-139
 Identities = 229/641 (35%), Positives = 354/641 (55%), Gaps = 10/641 (1%)

Query: 52  NNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRD--HDHAHLTFRLIDQMEFE 109
           N +LSM+ R G +  A  VF ++P+R L S+N L+  Y++    D A     L  +M + 
Sbjct: 125 NAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEA---LCLYHRMLWA 181

Query: 110 CLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESA 169
            +RP+  TF  + +    + D   G  +HA V+++G   D  V  +L+ MY  CGD  SA
Sbjct: 182 GVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSA 241

Query: 170 KRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRM 229
           + +F  +  +D ++WN++I G F+N +  EGL LF  M    V+P   + + +++AC  +
Sbjct: 242 RLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELL 301

Query: 230 GNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMI 289
           G+   G+ +H  V+ +   VD+ + N+L+ MY        A  VF+R+E  D VSW +MI
Sbjct: 302 GDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMI 361

Query: 290 AGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGY 349
           +GY +NG  +KA++ + AL     + PDE T A+++SA + L     G  LH L  + G 
Sbjct: 362 SGYEKNGLPDKALETY-ALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGL 420

Query: 350 DSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCK 409
            S V V   L+ MY K    +   +VF  I EKD++ WT +I G         A+  F +
Sbjct: 421 ISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQ 480

Query: 410 MCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGD 469
           M    LK ++  L  ALSACA +  L  G+ IH+   +TG G +  +  +L+D+Y + G 
Sbjct: 481 MLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGR 539

Query: 470 LRAAESIFSQVLHPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSA 529
           +  A + F+     D+  WN LL GY  +G    A  +F  ++E G+ PDE+TF+SLL A
Sbjct: 540 MNYAWNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCA 598

Query: 530 CSHSGLVERGKILWNQMKE-HSLIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRI 588
           CS SG+V +G   ++ M+E +S+ P  KHY+C+V LL RAG L EA N I + P +    
Sbjct: 599 CSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITP-DP 657

Query: 589 ELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKMRRKM 648
            +W  LL+ C   R+  +   AA+ +  LDP     +ILL NLYA  G+WD VA++R+ M
Sbjct: 658 AVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTM 717

Query: 649 KGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELH 689
           + + L  +PG SW+E K  VH F + D+SHP+I +    L 
Sbjct: 718 RENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLE 758


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 708
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.81
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.78
KOG2076895 consensus RNA polymerase III transcription factor 99.76
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.73
KOG2003840 consensus TPR repeat-containing protein [General f 99.72
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.72
KOG2076895 consensus RNA polymerase III transcription factor 99.71
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.69
KOG2003 840 consensus TPR repeat-containing protein [General f 99.64
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.61
KOG0547606 consensus Translocase of outer mitochondrial membr 99.61
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.59
KOG1126638 consensus DNA-binding cell division cycle control 99.57
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
KOG1915677 consensus Cell cycle control protein (crooked neck 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.51
KOG1126638 consensus DNA-binding cell division cycle control 99.51
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.5
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.5
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.5
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.48
KOG0547606 consensus Translocase of outer mitochondrial membr 99.47
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.45
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.43
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.35
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.32
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.31
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.3
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.3
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.29
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.29
KOG2376652 consensus Signal recognition particle, subunit Srp 99.28
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.28
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.27
PRK11189296 lipoprotein NlpI; Provisional 99.26
KOG1129478 consensus TPR repeat-containing protein [General f 99.25
PRK12370553 invasion protein regulator; Provisional 99.23
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.23
PF1304150 PPR_2: PPR repeat family 99.2
PF1304150 PPR_2: PPR repeat family 99.2
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.19
PRK12370553 invasion protein regulator; Provisional 99.18
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.17
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.14
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.13
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.11
PRK11189296 lipoprotein NlpI; Provisional 99.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.09
KOG1129478 consensus TPR repeat-containing protein [General f 99.08
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.06
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.06
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.05
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.04
KOG2376652 consensus Signal recognition particle, subunit Srp 99.03
KOG1125579 consensus TPR repeat-containing protein [General f 98.99
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.99
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.97
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.97
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.96
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.95
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.89
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.87
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.86
PRK15359144 type III secretion system chaperone protein SscB; 98.86
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.84
PRK10370198 formate-dependent nitrite reductase complex subuni 98.79
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.79
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.79
PRK15359144 type III secretion system chaperone protein SscB; 98.78
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.77
PRK04841903 transcriptional regulator MalT; Provisional 98.63
PRK04841903 transcriptional regulator MalT; Provisional 98.63
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.61
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.61
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.61
KOG1128777 consensus Uncharacterized conserved protein, conta 98.6
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.6
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.59
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.59
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.58
PLN02789320 farnesyltranstransferase 98.58
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.56
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.56
PRK10370198 formate-dependent nitrite reductase complex subuni 98.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.52
PLN02789320 farnesyltranstransferase 98.52
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.5
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.46
PF1285434 PPR_1: PPR repeat 98.44
PF1285434 PPR_1: PPR repeat 98.42
KOG1125579 consensus TPR repeat-containing protein [General f 98.41
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.38
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.38
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.36
KOG0553304 consensus TPR repeat-containing protein [General f 98.36
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.35
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.33
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.31
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.29
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.27
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.27
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.24
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.22
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.22
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.21
PRK15331165 chaperone protein SicA; Provisional 98.21
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.19
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.18
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.18
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.16
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.09
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.09
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.08
KOG0553304 consensus TPR repeat-containing protein [General f 98.07
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.03
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.02
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.0
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.99
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.98
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.96
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.94
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.91
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.9
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.9
PF1337173 TPR_9: Tetratricopeptide repeat 97.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.84
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.81
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.8
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.79
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.74
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.74
COG3898531 Uncharacterized membrane-bound protein [Function u 97.7
PF1343134 TPR_17: Tetratricopeptide repeat 97.7
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.7
COG4700251 Uncharacterized protein conserved in bacteria cont 97.64
PRK10803263 tol-pal system protein YbgF; Provisional 97.59
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.58
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.58
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.57
PF12688120 TPR_5: Tetratrico peptide repeat 97.56
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.55
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.52
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.5
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.5
COG4700251 Uncharacterized protein conserved in bacteria cont 97.5
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.47
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.47
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.47
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.39
PF1342844 TPR_14: Tetratricopeptide repeat 97.36
KOG20411189 consensus WD40 repeat protein [General function pr 97.35
KOG20411189 consensus WD40 repeat protein [General function pr 97.34
PRK10803263 tol-pal system protein YbgF; Provisional 97.33
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.33
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.33
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.31
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.28
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.25
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.25
PF1337173 TPR_9: Tetratricopeptide repeat 97.24
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.2
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.18
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.16
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.12
PF13512142 TPR_18: Tetratricopeptide repeat 97.11
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.1
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.06
KOG4234271 consensus TPR repeat-containing protein [General f 97.05
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.03
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.03
PF12688120 TPR_5: Tetratrico peptide repeat 96.96
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.96
KOG4555175 consensus TPR repeat-containing protein [Function 96.92
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.9
PRK11906458 transcriptional regulator; Provisional 96.9
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.9
KOG1258577 consensus mRNA processing protein [RNA processing 96.89
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.8
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.79
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.76
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.74
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.68
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.64
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.63
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.61
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.6
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.59
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.59
PRK11906458 transcriptional regulator; Provisional 96.52
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.51
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.43
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.3
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.22
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.2
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.2
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.16
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.93
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.92
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.91
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.84
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.75
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.73
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.68
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.65
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.45
PRK11619 644 lytic murein transglycosylase; Provisional 95.2
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.14
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.11
PF1342844 TPR_14: Tetratricopeptide repeat 95.1
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.02
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.96
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.91
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.87
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.85
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.81
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.74
PRK15331165 chaperone protein SicA; Provisional 94.73
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.71
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.68
smart00299140 CLH Clathrin heavy chain repeat homology. 94.66
KOG4555175 consensus TPR repeat-containing protein [Function 94.61
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.58
smart00299140 CLH Clathrin heavy chain repeat homology. 94.58
PRK10941269 hypothetical protein; Provisional 94.51
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.51
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.44
PF13512142 TPR_18: Tetratricopeptide repeat 94.4
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.36
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.36
KOG3941406 consensus Intermediate in Toll signal transduction 94.28
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.19
KOG1585308 consensus Protein required for fusion of vesicles 94.1
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.0
KOG3941406 consensus Intermediate in Toll signal transduction 93.91
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.89
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.8
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.78
PRK09687280 putative lyase; Provisional 93.75
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.52
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.44
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.14
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.01
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.0
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 92.84
KOG4648 536 consensus Uncharacterized conserved protein, conta 92.79
KOG1258577 consensus mRNA processing protein [RNA processing 92.51
KOG1585308 consensus Protein required for fusion of vesicles 92.47
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.4
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 92.16
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.12
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 92.12
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.09
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.77
PRK09687280 putative lyase; Provisional 91.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.1
COG3629280 DnrI DNA-binding transcriptional activator of the 91.03
KOG4234271 consensus TPR repeat-containing protein [General f 91.02
KOG3364149 consensus Membrane protein involved in organellar 90.87
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.85
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.79
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.74
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.65
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.56
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.43
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 90.4
PF06552186 TOM20_plant: Plant specific mitochondrial import r 90.3
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.21
KOG1586288 consensus Protein required for fusion of vesicles 90.17
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.11
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 89.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.71
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.63
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.98
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 88.97
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.86
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.63
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.37
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.9
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.72
PF1343134 TPR_17: Tetratricopeptide repeat 87.5
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.31
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.02
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.86
KOG1550552 consensus Extracellular protein SEL-1 and related 86.8
COG3629280 DnrI DNA-binding transcriptional activator of the 86.76
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.62
COG2976207 Uncharacterized protein conserved in bacteria [Fun 86.54
PRK11619644 lytic murein transglycosylase; Provisional 86.09
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 86.05
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.99
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.87
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.82
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 85.76
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.75
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.7
KOG4570418 consensus Uncharacterized conserved protein [Funct 85.24
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 85.24
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.21
KOG1586288 consensus Protein required for fusion of vesicles 85.15
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 85.0
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 84.88
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.87
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 84.8
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 84.7
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 84.38
PF09986214 DUF2225: Uncharacterized protein conserved in bact 84.22
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.91
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.53
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 83.17
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 82.84
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.83
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.35
KOG1550552 consensus Extracellular protein SEL-1 and related 82.24
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.49
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 81.01
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 80.42
PF13929292 mRNA_stabil: mRNA stabilisation 80.25
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1e-103  Score=883.79  Aligned_cols=686  Identities=33%  Similarity=0.561  Sum_probs=670.3

Q ss_pred             cchhchHHHHHHHHhccCChHHHHHHHHHHHHhcCCCCCCCCcchhhHHHHHHhccCChHHHHHHhhcCCCCCcccHHHH
Q 038516            6 ENLCRNIATLIQICASITSLKRARQIHALVLTTNHIPINAQSPYMYNNVLSMYGRCGSIRDARQVFDEIPKRSLVSYNAL   85 (708)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l   85 (708)
                      ++...++..++.+|.+.+.+..|.++|+.+...|+.    ++..++|.|+.+|+++|+++.|.++|++|++||+.+||++
T Consensus        83 ~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~----~~~~~~n~li~~~~~~g~~~~A~~~f~~m~~~d~~~~n~l  158 (857)
T PLN03077         83 PVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPS----LGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVL  158 (857)
T ss_pred             CCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCC----CCchHHHHHHHHHHhCCChHHHHHHHhcCCCCCeeEHHHH
Confidence            344567788888888888888899999988888887    8899999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCChHHHHHHHHHHHHcCCCCCcchHHHHHHHhccccchHHHHHHHHHHHHhCCCCchhHHhHHHHHhHhCCC
Q 038516           86 IAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGSLLHAQVIKYGSSEDTCVQTSLLGMYSNCGD  165 (708)
Q Consensus        86 l~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~  165 (708)
                      |.+|++.|+ +++|+++|++|...|+.||..||++++++|+..+++..+.+++..|.+.|+.||..++++||.+|+++|+
T Consensus       159 i~~~~~~g~-~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~  237 (857)
T PLN03077        159 VGGYAKAGY-FDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGD  237 (857)
T ss_pred             HHHHHhCCC-HHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCC
Confidence            999999999 9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHhccCCCCCcccHHHHHHHHhcCCChhHHHHHHHHHHhCCCCCCcchHHHHHHHHhccCChhHHHHHHHHHHHh
Q 038516          166 FESAKRIFGLIGDKDAVAWNSIILGNFKNDKMKEGLSLFGAMVGSGVNPTQFSYSMLLNACSRMGNFVCGKVIHARVIIS  245 (708)
Q Consensus       166 ~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~  245 (708)
                      ++.|.++|+.|+.+|..+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.+.+++..+.+.
T Consensus       238 ~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~  317 (857)
T PLN03077        238 VVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKT  317 (857)
T ss_pred             HHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCChhhHHHHHHhcccCCChHHHHHHHhccCCCChhHHHHHHHHHHcCCCchHHHHHHHHHHHcCCCCCCHhHHHHHH
Q 038516          246 NTQVDLPLENALLDMYSKCSDTQTAFSVFTRIENPDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAII  325 (708)
Q Consensus       246 ~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~p~~~t~~~ll  325 (708)
                      |..||..+|+.|+.+|++.|++++|.++|++|..||..+||.+|.+|++.|++++|+++|++|.+. |+.||..||+.++
T Consensus       318 g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~-g~~Pd~~t~~~ll  396 (857)
T PLN03077        318 GFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQD-NVSPDEITIASVL  396 (857)
T ss_pred             CCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHh-CCCCCceeHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999998 9999999999999


Q ss_pred             HHHcCCCCccchHHHHHHHHHHCCCCchhHHhHHHHHHHhcCCChhHHHHHhhcCCCCEeeehhhHHHHhcCCChHHHHH
Q 038516          326 SATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIK  405 (708)
Q Consensus       326 ~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~  405 (708)
                      .+|++.|+++.+.++++.+.+.|+.|+..+++.|+++|++.|++++|.++|++|.++|..+|+.+|.+|++.|+.++|+.
T Consensus       397 ~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~  476 (857)
T PLN03077        397 SACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALI  476 (857)
T ss_pred             HHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhHCCCccCHHHHHHHHHHHhCcccHHHHHHHHHHHHHhCCCCchhHHHHHHHhhHhcCCHHHHHHHHhhCCCCCh
Q 038516          406 LFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVLHPDL  485 (708)
Q Consensus       406 ~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~  485 (708)
                      +|++|.. ++.||..||+.++.+|++.|.++.+.+++..+.+.|+.++..++|+|+++|+++|++++|.++|+.+ .+|.
T Consensus       477 lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~  554 (857)
T PLN03077        477 FFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDV  554 (857)
T ss_pred             HHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CCCh
Confidence            9999986 6999999999999999999999999999999999999999999999999999999999999999999 9999


Q ss_pred             HHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCChHHHHHHHHHHhccCcHHHHHHHHHHhhH-CCCCcChHHHHHHHHH
Q 038516          486 KCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKE-HSLIPGHKHYSCMVSL  564 (708)
Q Consensus       486 ~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~-~~~~p~~~~~~~l~~~  564 (708)
                      .+||++|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|++.|++++|.++|+.|.+ .|+.|+..+|++|+++
T Consensus       555 ~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~  634 (857)
T PLN03077        555 VSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDL  634 (857)
T ss_pred             hhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999995 5999999999999999


Q ss_pred             HHhcCCHHHHHHHHHhCCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCcchHHHHHHHHHhcCCchHHHHH
Q 038516          565 LSRAGLLDEAENLIAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAATGRWDCVAKM  644 (708)
Q Consensus       565 ~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~eA~~~  644 (708)
                      |++.|++++|.+++++|+.. |+..+|.+|+.+|..+|+.+.|+.+.+++++++|+++..|..|+++|...|+|++|.++
T Consensus       635 l~r~G~~~eA~~~~~~m~~~-pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~v  713 (857)
T PLN03077        635 LGRAGKLTEAYNFINKMPIT-PDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARV  713 (857)
T ss_pred             HHhCCCHHHHHHHHHHCCCC-CCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHH
Confidence            99999999999999999977 99999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCccCCceeEEEecCeEEEEEeCCCCCcchHHHHHHHHHHHHHHHhhhh
Q 038516          645 RRKMKGSMLGKEPGLSWIEAKNNVHVFSSGDQSHPKIDDAQAELHRLRGNMRKLVT  700 (708)
Q Consensus       645 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~  700 (708)
                      ++.|+++|++|+||+|||++++++|.|.+||.+||+.++||..|+.|..+|++..+
T Consensus       714 r~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~  769 (857)
T PLN03077        714 RKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGL  769 (857)
T ss_pred             HHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCc
Confidence            99999999999999999999999999999999999999999999999999998643



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query708
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 67.9 bits (164), Expect = 7e-12
 Identities = 27/163 (16%), Positives = 53/163 (32%), Gaps = 11/163 (6%)

Query: 439 EMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIF-------SQVLHPDLKCWNAL 491
              HSQA+ +G    +    +          L  A  +         +     L  +NA+
Sbjct: 115 SGQHSQAQLSGQQQRL---LAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAV 171

Query: 492 LGGYSHYGMAEEAFMVFEVILEHGLRPDEITFLSLLSACSHSGLVERG-KILWNQMKEHS 550
           + G++  G  +E   V  ++ + GL PD +++ + L             +    QM +  
Sbjct: 172 MLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEG 231

Query: 551 LIPGHKHYSCMVSLLSRAGLLDEAENLIAESPYSEIRIELWRT 593
           L       + ++S   RA +L     +               T
Sbjct: 232 LKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNT 274


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query708
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.65
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.63
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.62
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.49
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.49
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.49
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.46
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.42
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.42
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.42
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.42
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.39
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.31
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.31
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.28
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.26
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.24
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.18
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.12
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.11
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.11
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.1
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.08
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.02
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.0
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.0
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.99
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.99
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.97
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.95
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.94
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.89
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.86
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.86
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.85
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.82
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.79
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.77
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.75
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.74
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.74
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.73
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.73
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.7
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.7
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.7
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.69
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.68
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.67
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.67
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.67
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.66
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.65
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.64
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.64
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.62
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.59
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.57
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.56
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.49
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.48
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.48
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.45
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.45
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.37
3k9i_A117 BH0479 protein; putative protein binding protein, 98.36
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.36
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.35
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.32
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.3
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.28
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.28
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.27
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.26
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.26
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.26
3k9i_A117 BH0479 protein; putative protein binding protein, 98.25
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.24
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.24
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.22
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.21
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.18
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.18
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.18
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.16
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.15
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.09
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.07
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.01
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.93
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.92
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.84
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.79
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.79
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.76
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.66
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.58
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.56
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.48
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.48
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.41
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.31
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.06
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.94
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.83
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.75
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.75
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.5
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.47
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.29
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.17
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.15
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.06
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.04
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.94
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.87
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.66
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.06
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.54
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.41
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.32
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.32
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.14
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 90.85
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.68
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.52
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.14
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.94
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.17
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.78
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.12
2p58_C116 Putative type III secretion protein YSCG; type III 86.79
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.44
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.26
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 86.04
2p58_C116 Putative type III secretion protein YSCG; type III 84.81
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.72
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 82.31
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 81.54
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 81.54
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 81.35
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 80.23
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4.5e-41  Score=367.90  Aligned_cols=501  Identities=8%  Similarity=-0.060  Sum_probs=360.2

Q ss_pred             HHHhccCChHHHHHHhhcCCCCCcccHHHHHHHHHhCCCChHHHHHHHHHHHHcCCCCCcchHHHHHHHhccccchHHHH
Q 038516           56 SMYGRCGSIRDARQVFDEIPKRSLVSYNALIAAYSRDHDHAHLTFRLIDQMEFECLRPNGLTFTSLAQAVSLLEDQLMGS  135 (708)
Q Consensus        56 ~~~~~~g~~~~A~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~  135 (708)
                      ..+.+.|.+..+...|..++.+++..|+.++..+.+.|+ ++.|+.+|++|..  ..|+..++..++.+|...|+++.|.
T Consensus        61 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~-~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~  137 (597)
T 2xpi_A           61 NNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQ-YKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAK  137 (597)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHTTC-HHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             ccccccCccCCCCCccccchHHHHHHHHHHHHHHHHccC-chHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHH
Confidence            346678888999999999998899999999999999999 9999999999985  4678899999999999999999999


Q ss_pred             HHHHHHHHhCCCCchhHHhHHHHHhHhCCChhHHHHHhccCCCC-------------------CcccHHHHHHHHhcCCC
Q 038516          136 LLHAQVIKYGSSEDTCVQTSLLGMYSNCGDFESAKRIFGLIGDK-------------------DAVAWNSIILGNFKNDK  196 (708)
Q Consensus       136 ~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~  196 (708)
                      .+++.+...  +++..+++.++.+|.+.|++++|.++|+++...                   +..+|+.++.+|.+.|+
T Consensus       138 ~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  215 (597)
T 2xpi_A          138 CLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSN  215 (597)
T ss_dssp             HHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCC
Confidence            999987644  688999999999999999999999999964433                   36789999999999999


Q ss_pred             hhHHHHHHHHHHhCCCCCCc-chHHHHHHHHhccCChhH--HHHH-HHHHHHhCCCCChhhHHHHHHhcccCCChHHHHH
Q 038516          197 MKEGLSLFGAMVGSGVNPTQ-FSYSMLLNACSRMGNFVC--GKVI-HARVIISNTQVDLPLENALLDMYSKCSDTQTAFS  272 (708)
Q Consensus       197 ~~~A~~~~~~m~~~g~~p~~-~~~~~ll~~~~~~~~~~~--a~~~-~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~  272 (708)
                      +++|+++|++|.+.  .|+. ..+..+...+...+..+.  +..+ +..+...+..+...+++.++..|.+.|++++|.+
T Consensus       216 ~~~A~~~~~~~~~~--~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~  293 (597)
T 2xpi_A          216 FDRAKECYKEALMV--DAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAED  293 (597)
T ss_dssp             HHHHHHHHHHHHHH--CTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHh--CchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHH
Confidence            99999999999875  3543 334444433332222111  1111 3334333444455566777888888888888888


Q ss_pred             HHhccCC--CChhHHHHHHHHHHcCCCchHHHHHHHHHHHcCCCCCCHhHHHHHHHHHcCCCCccchHHHHHHHHHHCCC
Q 038516          273 VFTRIEN--PDLVSWNSMIAGYMENGNGEKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYD  350 (708)
Q Consensus       273 ~~~~~~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~  350 (708)
                      +|+++.+  ++..+|+.++..|.+.|++++|..+|+++.+.  .+.+..++..++.++...|++++|..+++.+.+.. +
T Consensus       294 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~  370 (597)
T 2xpi_A          294 YLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEI--DPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-P  370 (597)
T ss_dssp             HHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-T
T ss_pred             HHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHc--CcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-c
Confidence            8888877  78888888888888888888888888888765  23355566666666666666666666666665433 3


Q ss_pred             CchhHHhHHHHHHHhcCCChhHHHHHhhcCCCCEeeehhhHHHHhcCCChHHHHHHHHHHhHCCCccCHHHHHHHHHHHh
Q 038516          351 SSVFVGTTLLNMYFKNGDAESPQKVFMLIAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACA  430 (708)
Q Consensus       351 ~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~  430 (708)
                      .+..+++                               .++..|.+.|++++|.++|+++.+..  |             
T Consensus       371 ~~~~~~~-------------------------------~l~~~~~~~g~~~~A~~~~~~~~~~~--~-------------  404 (597)
T 2xpi_A          371 EKAVTWL-------------------------------AVGIYYLCVNKISEARRYFSKSSTMD--P-------------  404 (597)
T ss_dssp             TSHHHHH-------------------------------HHHHHHHHTTCHHHHHHHHHHHHHHC--T-------------
T ss_pred             ccHHHHH-------------------------------HHHHHHHHhccHHHHHHHHHHHHHhC--C-------------
Confidence            3444444                               44455555556666666666655421  1             


Q ss_pred             CcccHHHHHHHHHHHHHhCCCCchhHHHHHHHhhHhcCCHHHHHHHHhhCC---CCChHHHHHHHHHHHhcCChHHHHHH
Q 038516          431 DLAILKQGEMIHSQAEKTGHGVEMSVCGSLVDMYAKNGDLRAAESIFSQVL---HPDLKCWNALLGGYSHYGMAEEAFMV  507 (708)
Q Consensus       431 ~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~  507 (708)
                                           .+..+++.++.+|.+.|++++|.++|+++.   +.+..+|+.++.+|.+.|++++|.++
T Consensus       405 ---------------------~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~  463 (597)
T 2xpi_A          405 ---------------------QFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEY  463 (597)
T ss_dssp             ---------------------TCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHH
T ss_pred             ---------------------CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHH
Confidence                                 123344455555555566666666555542   34667788888888888888888888


Q ss_pred             HHHHHHCCCCCChHHHHHHHHHHhccCcHHHHHHHHHHhhHC----CCCcC--hHHHHHHHHHHHhcCCHHHHHHHHHhC
Q 038516          508 FEVILEHGLRPDEITFLSLLSACSHSGLVERGKILWNQMKEH----SLIPG--HKHYSCMVSLLSRAGLLDEAENLIAES  581 (708)
Q Consensus       508 ~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~----~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~~  581 (708)
                      |+++.+.. +.+..+|..+...|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.+.++++
T Consensus       464 ~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~  542 (597)
T 2xpi_A          464 LQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQG  542 (597)
T ss_dssp             HHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             HHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHH
Confidence            88888753 336777888888888888888888888888765    55777  678999999999999999999999887


Q ss_pred             C-CCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCcchHHHHHHHHHh
Q 038516          582 P-YSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLYAA  634 (708)
Q Consensus       582 ~-~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~  634 (708)
                      . ..+.+...|..++..|...|++++|...++++++++|+++.++..|+++|..
T Consensus       543 ~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          543 LLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             HHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC-
T ss_pred             HHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhc
Confidence            2 3335789999999999999999999999999999999999999999988743



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 708
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.0 bits (92), Expect = 8e-04
 Identities = 21/184 (11%), Positives = 49/184 (26%), Gaps = 12/184 (6%)

Query: 460 LVDMYAKNGDLRAAESIFSQVL---HPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGL 516
           L ++  +      A + + + L            L   Y   G+ + A   +   +E  L
Sbjct: 209 LGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--L 266

Query: 517 RPDEITFLSLLSACSHSGLVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAEN 576
           +P        L+                              + + ++    G ++EA  
Sbjct: 267 QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVR 326

Query: 577 L----IAESPYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQVLRLDPEDGTTHILLSNLY 632
           L    +   P           L S    +   +  +   ++ +R+ P     +  + N  
Sbjct: 327 LYRKALEVFPEF---AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTL 383

Query: 633 AATG 636
               
Sbjct: 384 KEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query708
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.14
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.1
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.09
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.03
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.03
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.02
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.01
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.95
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.93
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.87
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.79
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.78
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.7
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.65
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.62
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.61
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.56
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.53
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.52
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.49
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.41
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.41
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.23
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.22
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.16
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.05
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.97
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.96
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.93
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.93
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.89
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.82
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.75
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.65
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.28
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.27
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.06
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.95
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.7
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.21
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.62
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.54
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.7
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.96
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.63
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.52
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=6.3e-21  Score=193.22  Aligned_cols=376  Identities=11%  Similarity=0.037  Sum_probs=269.3

Q ss_pred             HHHHHhccCChhHHHHHHHHHHHhCCCCChhhHHHHHHhcccCCChHHHHHHHhccCC---CChhHHHHHHHHHHcCCCc
Q 038516          222 LLNACSRMGNFVCGKVIHARVIISNTQVDLPLENALLDMYSKCSDTQTAFSVFTRIEN---PDLVSWNSMIAGYMENGNG  298 (708)
Q Consensus       222 ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~---~~~~~~~~li~~~~~~g~~  298 (708)
                      +...+.+.|++++|.++++++++.. +-+...+..+..+|.+.|++++|...|++..+   .+..+|..+..+|...|++
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccc
Confidence            3445667788888888888887764 33566777777777777888888877777654   3456677777777777777


Q ss_pred             hHHHHHHHHHHHcCCCCCCHhHHHHHHHHHcCCCCccchHHHHHHHHHHCCCCchhHHhHHHHHHHhcCCChhHHHHHhh
Q 038516          299 EKAVDMFVALRRMSLLKPDEYTFAAIISATSALPASAYGKPLHALVIKTGYDSSVFVGTTLLNMYFKNGDAESPQKVFML  378 (708)
Q Consensus       299 ~~A~~~~~~m~~~~~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~  378 (708)
                      ++|+..+......  .+.+................................ .                           
T Consensus        84 ~~A~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~---------------------------  133 (388)
T d1w3ba_          84 QEAIEHYRHALRL--KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNP-D---------------------------  133 (388)
T ss_dssp             HHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCT-T---------------------------
T ss_pred             ccccccccccccc--cccccccccccccccccccccccccccccccccccc-c---------------------------
Confidence            7777777777765  233333333333333333333333333322222221 1                           


Q ss_pred             cCCCCEeeehhhHHHHhcCCChHHHHHHHHHHhHCCCccCHHHHHHHHHHHhCcccHHHHHHHHHHHHHhCCCCchhHHH
Q 038516          379 IAEKDIVLWTEMIIGHSRMGDGECAIKLFCKMCREGLKCDNFALSGALSACADLAILKQGEMIHSQAEKTGHGVEMSVCG  458 (708)
Q Consensus       379 ~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  458 (708)
                          ...............+....+...+....... +-+...+..+...+...|.++.|...+....+.. +.+...+.
T Consensus       134 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~  207 (388)
T d1w3ba_         134 ----LYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYI  207 (388)
T ss_dssp             ----CTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             ----cccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHH
Confidence                11122223333444555566666665555432 2234455556666777888888888887776654 34566778


Q ss_pred             HHHHhhHhcCCHHHHHHHHhhCC---CCChHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCC-hHHHHHHHHHHhccC
Q 038516          459 SLVDMYAKNGDLRAAESIFSQVL---HPDLKCWNALLGGYSHYGMAEEAFMVFEVILEHGLRPD-EITFLSLLSACSHSG  534 (708)
Q Consensus       459 ~l~~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~~~~~ll~~~~~~~  534 (708)
                      .+...+...|++++|...++...   ..+...+..+...+.+.|++++|+..|+++.+.  .|+ ...+..+...+...|
T Consensus       208 ~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~  285 (388)
T d1w3ba_         208 NLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKG  285 (388)
T ss_dssp             HHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHS
T ss_pred             HHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcC
Confidence            88889999999999999998764   456778888999999999999999999999984  564 567888888999999


Q ss_pred             cHHHHHHHHHHhhHCCCCcChHHHHHHHHHHHhcCCHHHHHHHHHhC-CCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHH
Q 038516          535 LVERGKILWNQMKEHSLIPGHKHYSCMVSLLSRAGLLDEAENLIAES-PYSEIRIELWRTLLSTCVAKRNSRMVIQAAEQ  613 (708)
Q Consensus       535 ~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~  613 (708)
                      ++++|.+.++..... .+.+...+..++..+...|++++|.+.++++ ...|.+...|..++..+...|++++|...+++
T Consensus       286 ~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~  364 (388)
T d1w3ba_         286 SVAEAEDCYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             CHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHH
T ss_pred             CHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            999999999988773 3345677888999999999999999999987 33434678899999999999999999999999


Q ss_pred             HHhcCCCCcchHHHHHHHHHhcCC
Q 038516          614 VLRLDPEDGTTHILLSNLYAATGR  637 (708)
Q Consensus       614 ~~~~~p~~~~~~~~l~~~~~~~g~  637 (708)
                      +++++|+++.+|..||.+|.+.|+
T Consensus       365 al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         365 AIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure