Citrus Sinensis ID: 038518
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 255579560 | 168 | chaperone protein DNAj, putative [Ricinu | 0.656 | 0.511 | 0.535 | 2e-21 | |
| 225462060 | 148 | PREDICTED: chaperone protein dnaJ 11, ch | 0.809 | 0.716 | 0.516 | 2e-21 | |
| 15231204 | 157 | chaperone DnaJ-domain containing protein | 0.664 | 0.554 | 0.557 | 5e-19 | |
| 224061637 | 99 | predicted protein [Populus trichocarpa] | 0.656 | 0.868 | 0.554 | 9e-19 | |
| 297834156 | 157 | DNAJ heat shock N-terminal domain-contai | 0.664 | 0.554 | 0.547 | 2e-18 | |
| 356552398 | 142 | PREDICTED: chaperone protein dnaJ 11, ch | 0.870 | 0.802 | 0.440 | 3e-18 | |
| 357460317 | 161 | Chaperone protein dnaJ [Medicago truncat | 0.885 | 0.720 | 0.447 | 3e-18 | |
| 224093380 | 142 | predicted protein [Populus trichocarpa] | 0.763 | 0.704 | 0.440 | 7e-17 | |
| 356566293 | 151 | PREDICTED: chaperone protein dnaJ 11, ch | 0.938 | 0.814 | 0.420 | 1e-16 | |
| 118487648 | 171 | unknown [Populus trichocarpa] | 0.656 | 0.502 | 0.495 | 6e-16 |
| >gi|255579560|ref|XP_002530622.1| chaperone protein DNAj, putative [Ricinus communis] gi|223529832|gb|EEF31765.1| chaperone protein DNAj, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 107 bits (267), Expect = 2e-21, Method: Compositional matrix adjust.
Identities = 53/99 (53%), Positives = 69/99 (69%), Gaps = 13/99 (13%)
Query: 39 SLYEVLRVEPKATISEIKTA-----KVYHPD------LSGNGRDFTEIHNTYETLLDPKA 87
SLYE+LR++ A++ EIKTA K+YHPD + +GRDF EIHN YETL DP A
Sbjct: 72 SLYEILRIKRTASLMEIKTAYRSLAKLYHPDAAVREDVETDGRDFMEIHNAYETLSDPAA 131
Query: 88 KAVYDMSLVSRRRTRTTSFGCSGRSGFHPTRRWETDQCW 126
+A+YD+SL + R R + G +G G++PTRRWETDQCW
Sbjct: 132 RALYDLSLDAASRRRRPAVGFTG--GYYPTRRWETDQCW 168
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225462060|ref|XP_002275924.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Vitis vinifera] gi|296090000|emb|CBI39819.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15231204|ref|NP_187939.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|9294537|dbj|BAB02800.1| DnaJ-like protein [Arabidopsis thaliana] gi|21592683|gb|AAM64632.1| DnaJ protein, putative [Arabidopsis thaliana] gi|32815917|gb|AAP88343.1| At3g13310 [Arabidopsis thaliana] gi|332641811|gb|AEE75332.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224061637|ref|XP_002300579.1| predicted protein [Populus trichocarpa] gi|222847837|gb|EEE85384.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297834156|ref|XP_002884960.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330800|gb|EFH61219.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356552398|ref|XP_003544555.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357460317|ref|XP_003600440.1| Chaperone protein dnaJ [Medicago truncatula] gi|358349362|ref|XP_003638707.1| Chaperone protein dnaJ [Medicago truncatula] gi|355489488|gb|AES70691.1| Chaperone protein dnaJ [Medicago truncatula] gi|355504642|gb|AES85845.1| Chaperone protein dnaJ [Medicago truncatula] gi|388517361|gb|AFK46742.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224093380|ref|XP_002309904.1| predicted protein [Populus trichocarpa] gi|222852807|gb|EEE90354.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356566293|ref|XP_003551367.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|118487648|gb|ABK95649.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| TAIR|locus:2088100 | 157 | AT3G13310 [Arabidopsis thalian | 0.816 | 0.681 | 0.427 | 1.6e-17 | |
| TAIR|locus:2827820 | 160 | AT2G17880 "AT2G17880" [Arabido | 0.625 | 0.512 | 0.363 | 1.1e-09 | |
| TAIR|locus:2135159 | 161 | J11 "AT4G36040" [Arabidopsis t | 0.770 | 0.627 | 0.330 | 1.8e-09 | |
| FB|FBgn0032474 | 389 | DnaJ-H "DnaJ homolog" [Drosoph | 0.412 | 0.138 | 0.466 | 2.6e-06 | |
| TAIR|locus:2052426 | 344 | AT2G42750 [Arabidopsis thalian | 0.396 | 0.151 | 0.459 | 7.2e-06 | |
| POMBASE|SPCC830.07c | 379 | psi1 "DNAJ domain protein, inv | 0.404 | 0.139 | 0.440 | 1.4e-05 | |
| UNIPROTKB|Q5ZJV3 | 397 | DNAJA1 "Uncharacterized protei | 0.396 | 0.130 | 0.448 | 1.6e-05 | |
| UNIPROTKB|A6QM13 | 250 | DNAJA1 "DnaJ homolog subfamily | 0.396 | 0.208 | 0.448 | 1.8e-05 | |
| GENEDB_PFALCIPARUM|PF11_0099 | 540 | PF11_0099 "heat shock protein | 0.435 | 0.105 | 0.437 | 1.9e-05 | |
| UNIPROTKB|Q8IIR6 | 540 | PF11_0099 "Heat shock protein | 0.435 | 0.105 | 0.437 | 1.9e-05 |
| TAIR|locus:2088100 AT3G13310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 214 (80.4 bits), Expect = 1.6e-17, P = 1.6e-17
Identities = 50/117 (42%), Positives = 63/117 (53%)
Query: 19 KRSPRAVSVEMPVMALGTR---GSLYEVLRVEPKATISEIKTA-----KVYHPDLS-GNG 69
K S + ++ E P + R SLYE+L+V A+++EIKTA KVYHPD S +G
Sbjct: 42 KASAQTLNAE-PAVTESVRRRVSSLYELLKVNETASLTEIKTAYRSLAKVYHPDASESDG 100
Query: 70 RDFTEIHNTYETLLDPKAKAVYDMSLVXXXXXXXXXXXXXXXXXXHPTRRWETDQCW 126
RDF EIH Y TL DP +A+YD +L TRRWETDQCW
Sbjct: 101 RDFMEIHKAYATLADPTTRAIYDSTLRVPRRRVHAGAMGRSGRVYATTRRWETDQCW 157
|
|
| TAIR|locus:2827820 AT2G17880 "AT2G17880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135159 J11 "AT4G36040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032474 DnaJ-H "DnaJ homolog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052426 AT2G42750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC830.07c psi1 "DNAJ domain protein, involved in translation initiation Psi1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJV3 DNAJA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QM13 DNAJA1 "DnaJ homolog subfamily A member 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF11_0099 PF11_0099 "heat shock protein DnaJ homologue Pfj2" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IIR6 PF11_0099 "Heat shock protein DnaJ homologue Pfj2" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033470001 | SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (148 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00017724001 | • | 0.498 | |||||||||
| GSVIVG00022013001 | • | 0.497 | |||||||||
| GSVIVG00022731001 | • | 0.495 | |||||||||
| GSVIVG00006687001 | • | 0.495 | |||||||||
| GSVIVG00001482001 | • | 0.495 | |||||||||
| GSVIVG00037232001 | • | 0.494 | |||||||||
| GSVIVG00017185001 | • | 0.494 | |||||||||
| GSVIVG00019978001 | • | 0.490 | |||||||||
| GSVIVG00024357001 | • | 0.489 | |||||||||
| GSVIVG00018506001 | • | 0.489 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 3e-12 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 2e-09 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 3e-09 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 1e-08 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 4e-08 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 4e-08 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 5e-08 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 9e-08 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 3e-07 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 5e-07 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 1e-06 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-06 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-06 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 4e-05 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 4e-05 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 6e-05 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 7e-05 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 1e-04 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-04 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 4e-04 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 5e-04 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 6e-04 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 0.001 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 0.001 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 0.001 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 0.002 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 0.003 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 57.2 bits (139), Expect = 3e-12
Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 9/62 (14%)
Query: 40 LYEVLRVEPKATISEIKTA-----KVYHPDLSGNG----RDFTEIHNTYETLLDPKAKAV 90
YE+L V A+ EIK A YHPD + F EI+ YE L DP+ +A+
Sbjct: 2 YYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRAI 61
Query: 91 YD 92
YD
Sbjct: 62 YD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.84 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.8 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.71 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.69 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.69 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.68 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.64 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.64 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.63 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.63 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.63 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.61 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.61 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.6 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.59 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.59 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.58 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.58 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.57 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.56 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.56 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.52 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.49 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.48 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.47 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.45 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.45 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.45 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.41 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.37 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.34 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.34 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.33 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.29 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.23 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.23 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.13 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.07 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.07 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.99 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.95 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.94 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.91 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.75 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 98.74 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.65 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.5 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.44 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.89 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.67 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.61 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 97.46 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 93.69 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 90.73 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 89.75 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.84 E-value=2.1e-21 Score=158.69 Aligned_cols=64 Identities=39% Similarity=0.591 Sum_probs=59.8
Q ss_pred ccCcccccccCCCCCHHHHHH-----HHHhCCCCCC----ChHHHHHHHHHHHHcCChhHHHHHHhhcccccC
Q 038518 37 RGSLYEVLRVEPKATISEIKT-----AKVYHPDLSG----NGRDFTEIHNTYETLLDPKAKAVYDMSLVSRRR 100 (131)
Q Consensus 37 ~~~~Y~iLgv~~~a~~~eIk~-----a~~~HPDk~~----~~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~~~~ 100 (131)
.+|||+||||+++|+.+|||+ |++||||+|+ ++++|++|++||+||+||++|+.||+++.....
T Consensus 3 ~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~ 75 (371)
T COG0484 3 KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFK 75 (371)
T ss_pred ccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccc
Confidence 679999999999999999999 9999999999 357999999999999999999999999988654
|
|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 131 | ||||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 6e-05 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 2e-04 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 5e-04 |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
|
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 9e-12 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 3e-11 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-11 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 5e-11 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 8e-11 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 8e-10 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 1e-09 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 1e-09 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-09 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 2e-09 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-09 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 2e-09 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-09 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 5e-09 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 8e-09 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 9e-09 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 1e-08 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-08 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 2e-08 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-08 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 2e-08 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-08 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 1e-07 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 4e-07 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 9e-07 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-06 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 2e-05 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 3e-05 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 1e-04 |
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
Score = 56.2 bits (136), Expect = 9e-12
Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 6/59 (10%)
Query: 40 LYEVLRVEPKATISEIKT-----AKVYHPDLS-GNGRDFTEIHNTYETLLDPKAKAVYD 92
LY++L V P A E+K A YHPD G+ F EI +E L DP+ + +YD
Sbjct: 10 LYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYD 68
|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.78 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.76 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.75 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.74 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.74 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.74 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.73 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.73 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.72 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.72 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.71 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.71 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.71 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.71 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.68 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.67 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.65 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.61 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.6 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.56 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.56 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.55 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.54 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.53 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.53 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.5 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.47 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.43 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.4 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.37 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.36 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.3 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.22 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.77 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.35 |
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.78 E-value=2.3e-19 Score=119.88 Aligned_cols=67 Identities=34% Similarity=0.596 Sum_probs=60.7
Q ss_pred CccCcccccccCCCCCHHHHHH-----HHHhCCCCCC-ChHHHHHHHHHHHHcCChhHHHHHHhhcccccCCC
Q 038518 36 TRGSLYEVLRVEPKATISEIKT-----AKVYHPDLSG-NGRDFTEIHNTYETLLDPKAKAVYDMSLVSRRRTR 102 (131)
Q Consensus 36 ~~~~~Y~iLgv~~~a~~~eIk~-----a~~~HPDk~~-~~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~~~~~~ 102 (131)
...|||+||||+++++.++||+ ++++|||+++ +.++|++|++||++|+||.+|..||..+.......
T Consensus 6 ~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~~ 78 (92)
T 2o37_A 6 KETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSG 78 (92)
T ss_dssp SCCHHHHHHTCCTTCCHHHHHHHHHHHHHHHCTTSTTCCHHHHHHHHHHHHHHTSHHHHHHHHHHCHHHHHTT
T ss_pred cCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCChHHHHHHHHHHHHHHCCHHHHHHHHHHCHHHhhcc
Confidence 4679999999999999999999 9999999986 56799999999999999999999999988765543
|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 131 | ||||
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 4e-08 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 3e-07 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 6e-07 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 8e-07 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 6e-06 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 6e-06 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 4e-05 |
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Large T antigen, the N-terminal J domain species: Murine polyomavirus [TaxId: 10634]
Score = 45.4 bits (107), Expect = 4e-08
Identities = 11/70 (15%), Positives = 28/70 (40%), Gaps = 7/70 (10%)
Query: 31 VMALGTRGSLYEVLRVEPKATIS--EIKTA-----KVYHPDLSGNGRDFTEIHNTYETLL 83
V++ + L E+L++ + ++ A + HPD G+ E+++ + T
Sbjct: 4 VLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFK 63
Query: 84 DPKAKAVYDM 93
++
Sbjct: 64 TEVYNLRMNL 73
|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.81 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.72 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.71 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.61 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.57 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.35 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.31 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.81 E-value=3.1e-20 Score=118.70 Aligned_cols=62 Identities=35% Similarity=0.545 Sum_probs=56.9
Q ss_pred ccCcccccccCCCCCHHHHHH-----HHHhCCCCCCC----hHHHHHHHHHHHHcCChhHHHHHHhhcccc
Q 038518 37 RGSLYEVLRVEPKATISEIKT-----AKVYHPDLSGN----GRDFTEIHNTYETLLDPKAKAVYDMSLVSR 98 (131)
Q Consensus 37 ~~~~Y~iLgv~~~a~~~eIk~-----a~~~HPDk~~~----~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~~ 98 (131)
.+|||+||||+++++.++||+ ++++|||+++. ++.|.+|++||+||+||.+|..||.+|..+
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~ 72 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA 72 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence 579999999999999999999 99999999874 358999999999999999999999998653
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|